BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] (246 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780567|ref|YP_003064980.1| hypothetical protein CLIBASIA_02270 [Candidatus Liberibacter asiaticus str. psy62] Length = 246 Score = 501 bits (1289), Expect = e-144, Method: Compositional matrix adjust. Identities = 246/246 (100%), Positives = 246/246 (100%) Query: 1 MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWP 60 MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWP Sbjct: 1 MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWP 60 Query: 61 SWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLD 120 SWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLD Sbjct: 61 SWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLD 120 Query: 121 FNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEK 180 FNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEK Sbjct: 121 FNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEK 180 Query: 181 VIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLK 240 VIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLK Sbjct: 181 VIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLK 240 Query: 241 ETQQCD 246 ETQQCD Sbjct: 241 ETQQCD 246 >gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Score = 32.0 bits (71), Expect = 0.009, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 18/23 (78%) Query: 63 PSRVVILVGPSGSGKSCLANIWS 85 PS VV ++GP+GSGKS L+ + S Sbjct: 28 PSEVVAIMGPNGSGKSTLSYLLS 50 >gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 31.6 bits (70), Expect = 0.013, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 20/29 (68%) Query: 63 PSRVVILVGPSGSGKSCLANIWSDKSRST 91 P+ +V L+GP+GSGKS +A + + + T Sbjct: 35 PNEIVTLIGPNGSGKSTIAKLITGIIKPT 63 >gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Score = 29.6 bits (65), Expect = 0.048, Method: Compositional matrix adjust. Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Query: 67 VILVGPSGSGKSCLANIWSDKS----RSTRFSNIAKSLDSILIDTRKPVLLEDIDLLDFN 122 V+ VGP G GK+ LA + + + RST IAK+ D + T LED D+L + Sbjct: 57 VLFVGPPGLGKTTLAQVVARELGVNFRSTSGPVIAKAGDLAALLTN----LEDRDVLFID 112 Query: 123 DTQLFHII 130 + II Sbjct: 113 EIHRLSII 120 >gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 28.5 bits (62), Expect = 0.11, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 65 RVVILVGPSGSGKSCLANIWSDKSRSTRFS 94 R+VIL GPSG+GKS L ++ + TR S Sbjct: 27 RIVIL-GPSGAGKSTLLSLMAGFKYPTRGS 55 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 28.5 bits (62), Expect = 0.12, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 64 SRVVILVGPSGSGKSCLANI 83 ++ LVGPSGSGKS + N+ Sbjct: 379 GKMTALVGPSGSGKSTIINL 398 >gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 27.7 bits (60), Expect = 0.22, Method: Compositional matrix adjust. Identities = 11/14 (78%), Positives = 12/14 (85%) Query: 67 VILVGPSGSGKSCL 80 VI+ GPSGSGKS L Sbjct: 46 VIIAGPSGSGKSTL 59 >gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Score = 26.6 bits (57), Expect = 0.41, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Query: 67 VILVGPSGSGKSCLANIWSDKSR-STRFSNIAKSLDSILIDTRKPVLLEDID 117 + +VGP+G+GK+ L + + K + F + +L ID ++ EDID Sbjct: 313 IGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKR----EDID 360 Score = 25.0 bits (53), Expect = 1.3, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 63 PSRVVILVGPSGSGKSCLANI 83 P + LVG +GSGKS L I Sbjct: 30 PKERICLVGCNGSGKSTLLKI 50 >gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 25.8 bits (55), Expect = 0.68, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Query: 44 LVHSAIEQAVRLIDSWPSWPSRVVILVGPSGSGKSCLANIWS 85 L HS+ V L S ++LVGP+G GK+ LA + Sbjct: 100 LAHSSKSSNVELAKSN-------ILLVGPTGCGKTYLAQTLA 134 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 25.8 bits (55), Expect = 0.69, Method: Compositional matrix adjust. Identities = 11/28 (39%), Positives = 18/28 (64%) Query: 67 VILVGPSGSGKSCLANIWSDKSRSTRFS 94 V+LVGP G+GK+ LA + ++ F+ Sbjct: 184 VLLVGPPGTGKTLLARAVAGEANVPFFT 211 >gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Score = 25.8 bits (55), Expect = 0.71, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 14/18 (77%) Query: 63 PSRVVILVGPSGSGKSCL 80 P +V ++GP+G+GK+ L Sbjct: 342 PGGIVGVIGPNGAGKTTL 359 Score = 23.9 bits (50), Expect = 3.0, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 15/22 (68%) Query: 62 WPSRVVILVGPSGSGKSCLANI 83 +P + ++GP+G+GKS + I Sbjct: 30 YPDAKIGILGPNGAGKSTILRI 51 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 25.4 bits (54), Expect = 1.0, Method: Compositional matrix adjust. Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 64 SRVVILVGPSGSGKSCLANI 83 +V LV PSG+GKS + +I Sbjct: 36 GEIVALVSPSGTGKSTILHI 55 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 25.0 bits (53), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/53 (22%), Positives = 25/53 (47%) Query: 95 NIAKSLDSILIDTRKPVLLEDIDLLDFNDTQLFHIINSIHQYDSSLLMTARTF 147 N K+ I++ ++ E D +FN + L+H++ S + L + A + Sbjct: 616 NATKAGYDIVLTVHDEIVCETPDTDEFNASMLYHLMTSNPSWAKGLPLKAEGY 668 >gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 25.0 bits (53), Expect = 1.2, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 63 PSRVVILVGPSGSGKSCL 80 P +V L+GP+G+GK+ Sbjct: 50 PGEIVGLLGPNGAGKTTF 67 >gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Score = 25.0 bits (53), Expect = 1.3, Method: Composition-based stats. Identities = 22/84 (26%), Positives = 34/84 (40%), Gaps = 11/84 (13%) Query: 64 SRVVILVGPSGSGKSCLA--NIWSDKSR---------STRFSNIAKSLDSILIDTRKPVL 112 ++++++ G SGSGKS LA I ++ R + +F K D ID P + Sbjct: 27 NKLIVMTGVSGSGKSSLAFDTIHAEGQRRYVESLSTYARQFLGTIKKPDVEQIDGLSPTI 86 Query: 113 LEDIDLLDFNDTQLFHIINSIHQY 136 + N I IH Y Sbjct: 87 SIEQKNTSHNPRSTVGTITEIHDY 110 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 24.6 bits (52), Expect = 1.4, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 63 PSRVVILVGPSGSGKSCLANI 83 PS+ L+G SG GKS +A + Sbjct: 382 PSKKTALIGESGVGKSTVAKL 402 >gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Score = 24.6 bits (52), Expect = 1.8, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Query: 56 IDSWPSWPSRVVILVGPSGSGKSCLA---NIWSDKSRST-RFSNIAKSLDSI 103 I +P R+V + GP SGK+ LA S K+ T F + +LDSI Sbjct: 61 IGGFP--KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSI 110 >gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Score = 24.3 bits (51), Expect = 2.1, Method: Compositional matrix adjust. Identities = 7/15 (46%), Positives = 13/15 (86%) Query: 67 VILVGPSGSGKSCLA 81 ++LVGP+G GK+ ++ Sbjct: 56 ILLVGPTGVGKTAIS 70 >gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 23.9 bits (50), Expect = 2.6, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 64 SRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSL 100 SRV+ L+ P G G+ L ++ NIA S+ Sbjct: 162 SRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSI 198 >gi|254780968|ref|YP_003065381.1| hypothetical protein CLIBASIA_04345 [Candidatus Liberibacter asiaticus str. psy62] Length = 106 Score = 23.9 bits (50), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 14/49 (28%) Query: 33 PRC------------LGISRD--DLLVHSAIEQAVRLIDSWPSWPSRVV 67 PRC LG+S D+L A+ Q+++ +WP+ P V Sbjct: 29 PRCGFSGKVVQVLDSLGVSYKGIDVLADDALRQSIKEYSNWPTIPQLYV 77 >gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 23.9 bits (50), Expect = 2.8, Method: Compositional matrix adjust. Identities = 9/13 (69%), Positives = 10/13 (76%) Query: 66 VVILVGPSGSGKS 78 V L+GPSG GKS Sbjct: 34 VTALIGPSGCGKS 46 >gi|254780454|ref|YP_003064867.1| DNA polymerase III subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 385 Score = 23.9 bits (50), Expect = 3.1, Method: Compositional matrix adjust. Identities = 9/32 (28%), Positives = 19/32 (59%) Query: 1 MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSF 32 +N+ D +F++ +++ P KEE+ +SF Sbjct: 99 VNISHGDSNFYLQSFPESEFPSTKEEEYVYSF 130 >gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 23.5 bits (49), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 64 SRVVILVGPSGSGKSCLANI 83 +V L+G SGSGKS L I Sbjct: 43 GEIVGLLGRSGSGKSTLLRI 62 >gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62] Length = 750 Score = 22.7 bits (47), Expect = 5.4, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 22/35 (62%) Query: 169 KISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQ 203 +++L + + K I K+ + Q+F D++L Y++Q Sbjct: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169 >gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Score = 22.7 bits (47), Expect = 6.7, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 63 PSRVVILVGPSGSGKSCL 80 P + LVG SG+GK+ + Sbjct: 315 PGETIALVGDSGAGKTSI 332 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.136 0.401 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 149,139 Number of Sequences: 1233 Number of extensions: 5785 Number of successful extensions: 63 Number of sequences better than 100.0: 28 Number of HSP's better than 100.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 34 Number of HSP's gapped (non-prelim): 30 length of query: 246 length of database: 328,796 effective HSP length: 72 effective length of query: 174 effective length of database: 240,020 effective search space: 41763480 effective search space used: 41763480 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 37 (18.9 bits)