BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] gi|254040245|gb|ACT57041.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] Length = 70 Score = 135 bits (339), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL Sbjct: 1 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60 Query: 61 VQYLRGSFVK 70 VQYLRGSFVK Sbjct: 61 VQYLRGSFVK 70 >gi|15640289|ref|NP_229916.1| mannosyl-transferase [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121586321|ref|ZP_01676110.1| mannosyl-transferase [Vibrio cholerae 2740-80] gi|147674200|ref|YP_001218516.1| mannosyl-transferase [Vibrio cholerae O395] gi|153818272|ref|ZP_01970939.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|153818499|ref|ZP_01971166.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|153821796|ref|ZP_01974463.1| mannosyl-transferase [Vibrio cholerae B33] gi|229506943|ref|ZP_04396451.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae BX 330286] gi|229509314|ref|ZP_04398797.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae B33] gi|229516261|ref|ZP_04405709.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC9] gi|229521025|ref|ZP_04410446.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae TM 11079-80] gi|229527242|ref|ZP_04416635.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae 12129(1)] gi|229606454|ref|YP_002877102.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae MJ-1236] gi|255744066|ref|ZP_05418020.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholera CIRS 101] gi|262161955|ref|ZP_06030972.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae INDRE 91/1] gi|262168033|ref|ZP_06035732.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC27] gi|298500897|ref|ZP_07010699.1| mannosyl-transferase [Vibrio cholerae MAK 757] gi|1929425|emb|CAA69127.1| mannosyl-transferase [Vibrio cholerae] gi|9654669|gb|AAF93435.1| mannosyl-transferase [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121549441|gb|EAX59469.1| mannosyl-transferase [Vibrio cholerae 2740-80] gi|126510975|gb|EAZ73569.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|126511161|gb|EAZ73755.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|126520692|gb|EAZ77915.1| mannosyl-transferase [Vibrio cholerae B33] gi|146316083|gb|ABQ20622.1| mannosyl-transferase [Vibrio cholerae O395] gi|227012103|gb|ACP08313.1| mannosyl-transferase [Vibrio cholerae O395] gi|229335250|gb|EEO00734.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae 12129(1)] gi|229341910|gb|EEO06911.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae TM 11079-80] gi|229346687|gb|EEO11657.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC9] gi|229353629|gb|EEO18566.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae B33] gi|229356048|gb|EEO20967.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae BX 330286] gi|229369109|gb|ACQ59532.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae MJ-1236] gi|255738331|gb|EET93722.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholera CIRS 101] gi|262023566|gb|EEY42268.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC27] gi|262028333|gb|EEY46989.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae INDRE 91/1] gi|297540401|gb|EFH76460.1| mannosyl-transferase [Vibrio cholerae MAK 757] Length = 621 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 12/71 (16%) Query: 4 IYSPISERFLFVILERMRKK----LYGIFLMMWICYAAIILSVSLLALS-----FLSMII 54 +++PI L + +R K+ LY +F +M+ YAAI L + LA + FLSM+ Sbjct: 1 MFTPIQ---LLLSAQRHHKRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMT 57 Query: 55 TVAIALVQYLR 65 TV + L ++R Sbjct: 58 TVGVTLYCFVR 68 >gi|227080475|ref|YP_002809026.1| mannosyl-transferase [Vibrio cholerae M66-2] gi|227008363|gb|ACP04575.1| mannosyl-transferase [Vibrio cholerae M66-2] Length = 621 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 12/71 (16%) Query: 4 IYSPISERFLFVILERMRKK----LYGIFLMMWICYAAIILSVSLLALS-----FLSMII 54 +++PI L + +R K+ LY +F +M+ YAAI L + LA + FLSM+ Sbjct: 1 MFTPIQ---LLLSAQRHHKRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMT 57 Query: 55 TVAIALVQYLR 65 TV + L ++R Sbjct: 58 TVGVTLYCFVR 68 >gi|227871903|ref|ZP_03990297.1| hypothetical protein HMPREF6123_0236 [Oribacterium sinus F0268] gi|227842244|gb|EEJ52480.1| hypothetical protein HMPREF6123_0236 [Oribacterium sinus F0268] Length = 262 Score = 34.3 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 31/60 (51%) Query: 5 YSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIALVQYL 64 Y P E+F+ + +KK++ + + W+ + + + SF ++ + + IALV +L Sbjct: 107 YLPSEEKFIRFTMAYYKKKIWSLVFIFWLALGLLAFAQYWMGNSFFAICMVILIALVPFL 166 >gi|254286286|ref|ZP_04961245.1| mannosyl-transferase [Vibrio cholerae AM-19226] gi|150423701|gb|EDN15643.1| mannosyl-transferase [Vibrio cholerae AM-19226] Length = 624 Score = 34.3 bits (77), Expect = 6.0, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 12/71 (16%) Query: 4 IYSPISERFLFVILERMRKK----LYGIFLMMWICYAAIILSVSLLALS-----FLSMII 54 +++PI L + +R K+ LY +F +M+ YAAI L + LA + FLSM+ Sbjct: 1 MFTPIQ---LLLSAQRHHKRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMT 57 Query: 55 TVAIALVQYLR 65 TV + L ++R Sbjct: 58 TVGVTLYCFVR 68 >gi|229512757|ref|ZP_04402225.1| hypothetical protein VCB_000400 [Vibrio cholerae TMA 21] gi|229350267|gb|EEO15219.1| hypothetical protein VCB_000400 [Vibrio cholerae TMA 21] Length = 624 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 12/71 (16%) Query: 4 IYSPISERFLFVILERMRKK----LYGIFLMMWICYAAIILSVSLLALS-----FLSMII 54 +++PI L + +R K+ LY +F +M+ YAAI L + LA + FLSM+ Sbjct: 1 MFTPIQ---LLLSAQRHHKRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMT 57 Query: 55 TVAIALVQYLR 65 TV + L ++R Sbjct: 58 TVGVTLYCFVR 68 >gi|153801524|ref|ZP_01956110.1| mannosyl-transferase [Vibrio cholerae MZO-3] gi|124122929|gb|EAY41672.1| mannosyl-transferase [Vibrio cholerae MZO-3] Length = 624 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 12/71 (16%) Query: 4 IYSPISERFLFVILERMRKK----LYGIFLMMWICYAAIILSVSLLALS-----FLSMII 54 +++PI L + +R K+ LY +F +M+ YAAI L + LA + FLSM+ Sbjct: 1 MFTPIQ---LLLSAQRHHKRMITLLYDVFALMFSLYAAIALRLDTLAFTFNFPEFLSMMT 57 Query: 55 TVAIALVQYLR 65 TV + L ++R Sbjct: 58 TVGVTLYCFVR 68 Searching..................................................done Results from round 2 CONVERGED! >gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] gi|254040245|gb|ACT57041.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] Length = 70 Score = 76.9 bits (188), Expect = 8e-13, Method: Composition-based stats. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL Sbjct: 1 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60 Query: 61 VQYLRGSFVK 70 VQYLRGSFVK Sbjct: 61 VQYLRGSFVK 70 >gi|153801524|ref|ZP_01956110.1| mannosyl-transferase [Vibrio cholerae MZO-3] gi|124122929|gb|EAY41672.1| mannosyl-transferase [Vibrio cholerae MZO-3] Length = 624 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65 +RM LY +F +M+ YAAI L + LA + FLSM+ TV + L ++R Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFNFPEFLSMMTTVGVTLYCFVR 68 >gi|229512757|ref|ZP_04402225.1| hypothetical protein VCB_000400 [Vibrio cholerae TMA 21] gi|229350267|gb|EEO15219.1| hypothetical protein VCB_000400 [Vibrio cholerae TMA 21] Length = 624 Score = 33.7 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65 +RM LY +F +M+ YAAI L + LA + FLSM+ TV + L ++R Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68 >gi|254286286|ref|ZP_04961245.1| mannosyl-transferase [Vibrio cholerae AM-19226] gi|150423701|gb|EDN15643.1| mannosyl-transferase [Vibrio cholerae AM-19226] Length = 624 Score = 33.7 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65 +RM LY +F +M+ YAAI L + LA + FLSM+ TV + L ++R Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68 >gi|15640289|ref|NP_229916.1| mannosyl-transferase [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121586321|ref|ZP_01676110.1| mannosyl-transferase [Vibrio cholerae 2740-80] gi|147674200|ref|YP_001218516.1| mannosyl-transferase [Vibrio cholerae O395] gi|153818272|ref|ZP_01970939.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|153818499|ref|ZP_01971166.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|153821796|ref|ZP_01974463.1| mannosyl-transferase [Vibrio cholerae B33] gi|229506943|ref|ZP_04396451.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae BX 330286] gi|229509314|ref|ZP_04398797.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae B33] gi|229516261|ref|ZP_04405709.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC9] gi|229521025|ref|ZP_04410446.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae TM 11079-80] gi|229527242|ref|ZP_04416635.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae 12129(1)] gi|229606454|ref|YP_002877102.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae MJ-1236] gi|255744066|ref|ZP_05418020.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholera CIRS 101] gi|262161955|ref|ZP_06030972.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae INDRE 91/1] gi|262168033|ref|ZP_06035732.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC27] gi|298500897|ref|ZP_07010699.1| mannosyl-transferase [Vibrio cholerae MAK 757] gi|1929425|emb|CAA69127.1| mannosyl-transferase [Vibrio cholerae] gi|9654669|gb|AAF93435.1| mannosyl-transferase [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121549441|gb|EAX59469.1| mannosyl-transferase [Vibrio cholerae 2740-80] gi|126510975|gb|EAZ73569.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|126511161|gb|EAZ73755.1| mannosyl-transferase [Vibrio cholerae NCTC 8457] gi|126520692|gb|EAZ77915.1| mannosyl-transferase [Vibrio cholerae B33] gi|146316083|gb|ABQ20622.1| mannosyl-transferase [Vibrio cholerae O395] gi|227012103|gb|ACP08313.1| mannosyl-transferase [Vibrio cholerae O395] gi|229335250|gb|EEO00734.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae 12129(1)] gi|229341910|gb|EEO06911.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae TM 11079-80] gi|229346687|gb|EEO11657.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC9] gi|229353629|gb|EEO18566.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae B33] gi|229356048|gb|EEO20967.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae BX 330286] gi|229369109|gb|ACQ59532.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae MJ-1236] gi|255738331|gb|EET93722.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholera CIRS 101] gi|262023566|gb|EEY42268.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae RC27] gi|262028333|gb|EEY46989.1| nucleoside-diphosphate sugar epimerase/dehydratase [Vibrio cholerae INDRE 91/1] gi|297540401|gb|EFH76460.1| mannosyl-transferase [Vibrio cholerae MAK 757] Length = 621 Score = 33.7 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65 +RM LY +F +M+ YAAI L + LA + FLSM+ TV + L ++R Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68 >gi|227080475|ref|YP_002809026.1| mannosyl-transferase [Vibrio cholerae M66-2] gi|227008363|gb|ACP04575.1| mannosyl-transferase [Vibrio cholerae M66-2] Length = 621 Score = 33.7 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALS-----FLSMIITVAIALVQYLR 65 +RM LY +F +M+ YAAI L + LA + FLSM+ TV + L ++R Sbjct: 16 KRMITLLYDVFALMFSLYAAIALRLDTLAFTFSFPEFLSMMTTVGVTLYCFVR 68 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.340 0.148 0.426 Lambda K H 0.267 0.0478 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,494,778,957 Number of Sequences: 14124377 Number of extensions: 57152213 Number of successful extensions: 385062 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 34 Number of HSP's that attempted gapping in prelim test: 385039 Number of HSP's gapped (non-prelim): 45 length of query: 70 length of database: 4,842,793,630 effective HSP length: 42 effective length of query: 28 effective length of database: 4,249,569,796 effective search space: 118987954288 effective search space used: 118987954288 T: 11 A: 40 X1: 16 ( 7.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.9 bits) S2: 76 (33.7 bits)