RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) >gnl|CDD|163225 TIGR03348, VI_IcmF, type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems. Length = 1169 Score = 25.4 bits (56), Expect = 3.8 Identities = 8/44 (18%), Positives = 12/44 (27%), Gaps = 7/44 (15%) Query: 29 LMMWICYAAIILSVSLLALSFL-------SMIITVAIALVQYLR 65 + YAA L+ L + + V L Y Sbjct: 429 WLRRGAYAAAALAALGLLGLWSLSYLANRDYLDEVRTQLEAYRA 472 >gnl|CDD|148201 pfam06450, NhaB, Bacterial Na+/H+ antiporter B (NhaB). This family consists of several bacterial Na+/H+ antiporter B (NhaB) proteins. The exact function of this family is unknown. Length = 515 Score = 25.2 bits (55), Expect = 4.2 Identities = 17/47 (36%), Positives = 28/47 (59%) Query: 12 FLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAI 58 LF+ + + K I L + C+AA LS L AL+ +++II+VA+ Sbjct: 114 LLFIFTKLLLKIRSKILLSLAFCFAAAFLSAFLDALTVVAVIISVAV 160 >gnl|CDD|115814 pfam07184, CTV_P33, Citrus tristeza virus P33 protein. This family consists of several Citrus tristeza virus (CTV) P33 proteins. The function of P33 is unclear although it is known that the protein is not needed for virion formation. Length = 303 Score = 25.0 bits (54), Expect = 4.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Query: 34 CYAAIILSVSLLALSFLSMIITV 56 CYA +L VSLL +S L II + Sbjct: 281 CYAVCVLVVSLLIMSGLLAIIFI 303 >gnl|CDD|185021 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional. Length = 726 Score = 24.7 bits (55), Expect = 4.9 Identities = 6/10 (60%), Positives = 6/10 (60%) Query: 4 IYSPISERFL 13 Y IS RFL Sbjct: 375 EYEKISRRFL 384 >gnl|CDD|184312 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional. Length = 637 Score = 24.6 bits (54), Expect = 5.2 Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Query: 18 ERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAI---ALVQYLRGS 67 E RK+ ++M I A II + A L II + AL + Sbjct: 113 EEARKRNQMRNMLMMIIIAGIIGYAFIYAGQILWGIIAAGLIYMALRYFRPKE 165 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.340 0.148 0.426 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,125,639 Number of extensions: 57960 Number of successful extensions: 412 Number of sequences better than 10.0: 1 Number of HSP's gapped: 408 Number of HSP's successfully gapped: 72 Length of query: 70 Length of database: 5,994,473 Length adjustment: 41 Effective length of query: 29 Effective length of database: 5,108,545 Effective search space: 148147805 Effective search space used: 148147805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.9 bits) S2: 50 (22.9 bits)