RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 36.8 bits (85), Expect = 0.001 Identities = 13/73 (17%), Positives = 26/73 (35%), Gaps = 13/73 (17%) Query: 3 QIYSPISERFLFVILERM---------RKKLY--GIFLMMWICYAAIILSVSLLALSFLS 51 Q Y + + E + +K++ G+ ++ W+ + L +S Sbjct: 178 QTYHVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPIS 237 Query: 52 M-IITVAIALVQY 63 +I V I L Y Sbjct: 238 CPLIGV-IQLAHY 249 Score = 26.8 bits (59), Expect = 1.3 Identities = 9/41 (21%), Positives = 15/41 (36%), Gaps = 12/41 (29%) Query: 40 LSVSLLALSFLSMIIT-----------VAIALVQYLRGSFV 69 LS+S L + + V I+LV + + V Sbjct: 339 LSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAK-NLV 378 >2qyg_A Ribulose bisphosphate carboxylase-like protein 2; beta-alpha-barrel, unknown function; 3.30A {Rhodopseudomonas palustris CGA009} Length = 452 Score = 26.7 bits (59), Expect = 1.3 Identities = 14/72 (19%), Positives = 28/72 (38%), Gaps = 9/72 (12%) Query: 3 QIYSPISERFLFVILERMR-------KKLY--GIFLMMWICYAAIILSVSLLALSFLSMI 53 + P++ER + R K+Y I + ++V+ A + L Sbjct: 226 VDWCPLAERAALLGDACRRASAETGVPKIYLANITDEVDRLTELHDVAVANGAGALLINA 285 Query: 54 ITVAIALVQYLR 65 + V ++ V+ LR Sbjct: 286 MPVGLSAVRMLR 297 >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosylation, glucan, membrane; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Length = 555 Score = 25.0 bits (54), Expect = 4.4 Identities = 3/34 (8%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 2 IQIYSPISERFLFVILERMRKKLYGIFLMMWICY 35 +++Y+ + + +E + G+++++ + Sbjct: 104 LRVYAIDPTKSHDICMEALSA--EGMYVLLDLSE 135 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.340 0.148 0.426 Gapped Lambda K H 0.267 0.0448 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 573,462 Number of extensions: 19709 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's gapped: 92 Number of HSP's successfully gapped: 9 Length of query: 70 Length of database: 5,693,230 Length adjustment: 40 Effective length of query: 30 Effective length of database: 4,723,470 Effective search space: 141704100 Effective search space used: 141704100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.9 bits) S2: 50 (23.7 bits)