BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] (70 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780568|ref|YP_003064981.1| hypothetical protein CLIBASIA_02275 [Candidatus Liberibacter asiaticus str. psy62] Length = 70 Score = 135 bits (339), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL Sbjct: 1 MIQIYSPISERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLLALSFLSMIITVAIAL 60 Query: 61 VQYLRGSFVK 70 VQYLRGSFVK Sbjct: 61 VQYLRGSFVK 70 >gi|254780821|ref|YP_003065234.1| FolC bifunctional protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 23.9 bits (50), Expect = 0.48, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 23/37 (62%) Query: 9 SERFLFVILERMRKKLYGIFLMMWICYAAIILSVSLL 45 S + ++++ + K YG +L ++ + I+LSVSL+ Sbjct: 320 SNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLI 356 >gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 361 Score = 20.4 bits (41), Expect = 6.3, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 19 RMRKKLYGIFLMMWICYA 36 R RKK++ IF+ + I + Sbjct: 300 RQRKKIHPIFISLSISFG 317 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.340 0.148 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,328 Number of Sequences: 1233 Number of extensions: 1060 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 70 length of database: 328,796 effective HSP length: 41 effective length of query: 29 effective length of database: 278,243 effective search space: 8069047 effective search space used: 8069047 T: 11 A: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.9 bits) S2: 31 (16.5 bits)