HHsearch results for GI: 254780569 and protein with PDBid: 2rb9_A

>2rb9_A HYPE protein; hydrogenase maturation, dimer, enzyme, X- RAY crystallography, structural genomics, BSGI; 2.00A {Escherichia coli O157} PDB: 2i6r_A
Probab=100.00  E-value=1.6e-37  Score=281.64  Aligned_cols=294  Identities=18%  Similarity=0.212  Sum_probs=225.9

Q ss_pred             HHHHHHHHCCCCCCCCCCCCEEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998862673543667773157565544688718999568887899999982885501688888543467885411221
Q gi|254780569|r   28 IKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSDGVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLF  107 (357)
Q Consensus        28 i~~~~~~t~~~~v~~~ig~f~~~~~l~~~~~~~p~Lv~~tDGVGTK~~ia~~~~~~~~ig~Dlvam~vNDi~~~GA~Pl~  107 (357)
                      |.++..+.++..++ ++|.-++++++....-+...||.+||++-.+...    -.+..+|+.+|++|+|||+||||+|++
T Consensus        17 I~~~f~~~~~~~~l-~~gdDaav~~~~~~~~~~~~lv~stD~~~~~~~~----~~~~~iG~~av~~~~sDlaamGa~P~~   91 (334)
T 2rb9_A           17 INSLFMEAFANPWL-AEQEDQARLDLAQLVAEGDRLAFSTDSYVIDPLF----FPGGNIGKLAICGTANDVAVSGAIPRY   91 (334)
T ss_dssp             HHHHHHHHHCCTTT-TTCCSSEEEEHHHHHHHCSEEEEEEEEECCSSSE----ETTEEHHHHHHHHHHHHHHTTTCCCCE
T ss_pred             HHHHHHHHCCCCCC-CCCCCEEEEECCCCCCCCCEEEEECCCCCCCCCC----CCCCCHHHHHHHHHHHHHHHCCCEEHH
T ss_conf             99998854589766-6899819970533578997599992655517766----895119999999999999986888466


Q ss_pred             HHHHHCCC-CHHHHHHHHHHHHHHHHHHHCCCEECCCCHHHCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCEEEEE
Q ss_conf             10000033-20378999999999999986095221430100000136556633689999741542113334555248999
Q gi|254780569|r  108 FLDYLATS-QLNPDQATSIIKGIAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILG  186 (357)
Q Consensus       108 fldyia~~-~l~~~~~~~ii~gi~~~c~~~g~~liGGETAemP~vy~~~~~Dlag~~vG~v~k~~ii~~~~i~~GD~IIg  186 (357)
                      |++.++++ +.+.+.++++++||.++|+++|++++||||+..+.. ......+++|++|.+++++.+..+++||||.|+.
T Consensus        92 ~~~~l~lp~~~~~~~l~~i~~Gi~~~~~~~g~~lvGGdT~~~~~~-~~~~~~isvt~iG~~~~~~~i~r~~ak~GD~I~v  170 (334)
T 2rb9_A           92 LSCGFILEEGLPMETLKAVVTSMAETARTAGIAIVTGDTKVVQRG-AADKLFINTAGMGAIPTNIHWGAQTLTAGDILLV  170 (334)
T ss_dssp             EEEEEEEETTCCHHHHHHHHHHHHHHHHHTTCEEEEEEEEEECTT-SBSSEEEEEEEEEEECTTCCCCGGGCCTTCEEEE
T ss_pred             HHEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEECCEEEECCCC-CCCCCEEEEEEEECCCCCEEECHHHCCCCCEEEE
T ss_conf             622055799999999999999999999875979977745862477-7898389999997226660454200777998999


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCHHHHCCCCC
Q ss_conf             53865543232034444553115545667666663066875397201226888876304632222345420122012002
Q gi|254780569|r  187 LPSSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKIKALAHITGGGLTENIPRA  266 (357)
Q Consensus       187 l~SsG~HsNGySLvRkil~~~~~~~~~~~~~~~~~tl~e~LL~PtriY~~~i~~ll~~~~~i~~~ahITGGGl~~nL~Ri  266 (357)
                      ..+.|.|.+|+++.|+-....     ...            ...++.+.+.+ +.+.....+++|+|+|+|||..+|.|+
T Consensus       171 tG~~G~~~~~l~~~~~~~~~~-----~~~------------~~~~~~~~~~~-~~l~~~~~v~a~~DitsgGL~~~l~el  232 (334)
T 2rb9_A          171 SGTLGDHGATILNLREQLGLD-----GEL------------VSDCAVLTPLI-QTLRDIPGVKALRDATRGGVNAVVHEF  232 (334)
T ss_dssp             SSCSSHHHHHHHHHHHTCSCT-----TTC------------CCCCCCCHHHH-HTTTTCTTEEEEEECCTTHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHHHCCCCC-----HHH------------HHHHHHHHHHH-HHHHHCCCCEEEEECCCCCHHHHHHHH
T ss_conf             668736689999876236874-----455------------65555138999-999860761056431358478899999


Q ss_pred             CC-CCEEEEECCCCCCCCHHHHHHHHHCCCCHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHC--CCCEEEEEEEEECC
Q ss_conf             54-4304787100489867999999966989889876524671169998689899999999977--99808999999778
Q gi|254780569|r  267 IP-AHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGIGMVIIVHPDNKDCIIKKFQEN--NENIILIGEVTQRS  343 (357)
Q Consensus       267 Lp-~gl~a~Id~~~~p~p~iF~~I~~~g~I~~~EM~rtFNmGiGmvlvV~~e~a~~v~~~l~~~--g~~a~iIG~V~~~~  343 (357)
                      +. ++++++|+.+++|+++.++++++..+++   ++..+++| +|+++++|++++++++.+++.  |.++++||+|++++
T Consensus       233 a~~Sg~g~~I~~~~IPi~~~~~~~~~~~~~d---~l~~~~~g-~ll~~v~~~~~~~~~~~l~~~~~g~~~~vIG~V~~~~  308 (334)
T 2rb9_A          233 AAACGCGIEISESALPVKPAVRGVCELLGLD---ALNFANEG-KLVIAVERNAAEQVLAALHSHPLGKDAALIGEVVERK  308 (334)
T ss_dssp             HHHHTCEEEEETTTCCCCHHHHHHHHHHCCC---TTTSCCSS-CEEEEECGGGHHHHHHHHHTSGGGTTCEEEEEEESSC
T ss_pred             HHHCCCEEEEECCCCCCCHHHHHHHHHHCHH---HHHHCCCC-EEEEEECHHHHHHHHHHHHHCCCCCCEEEEEEEECCC
T ss_conf             9975976999544478888999999875564---78607885-1899993248999999997388897969999998599


Q ss_pred             CCCCEEEEEE
Q ss_conf             8720089963
Q gi|254780569|r  344 EKSPPILYQG  353 (357)
Q Consensus       344 ~~~~~V~~~G  353 (357)
                      .    |.+++
T Consensus       309 g----v~l~~  314 (334)
T 2rb9_A          309 G----VRLAG  314 (334)
T ss_dssp             S----EEEEC
T ss_pred             C----EEEEE
T ss_conf             6----89995