RPSBLAST alignment for GI: 254780569 and conserved domain: PRK05385

>gnl|CDD|180049 PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional. Length = 327
 Score =  523 bits (1351), Expect = e-149
 Identities = 190/331 (57%), Positives = 240/331 (72%), Gaps = 4/331 (1%)

Query: 9   LTYGQAGVNIEAGNRTVTQIKSAVKSTKRAGTIGEIGGFGGLFDLKKAGFVDPILVSSSD 68
           LTY  AGV+IEAGN  V +IK AVK T R   +G +GGFGGLFDL K G+ +P+LVS +D
Sbjct: 1   LTYKDAGVDIEAGNELVERIKPAVKRTFRPEVLGGLGGFGGLFDLPK-GYKEPVLVSGTD 59

Query: 69  GVGTKLKIAIETGKNDTIGIDLVAMCVNDILTHGAEPLFFLDYLATSQLNPDQATSIIKG 128
           GVGTKLK+AI+ GK+DTIGIDLVAMCVND+L  GAEPLFFLDY+AT +L+P+ A  ++KG
Sbjct: 60  GVGTKLKLAIDLGKHDTIGIDLVAMCVNDLLVQGAEPLFFLDYIATGKLDPEVAAQVVKG 119

Query: 129 IAAGCCQAGCALIGGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAGDLILGLP 188
           IA GC QAGCALIGGETAEMPG+YH+ DYDLAGFAVG VE+ +++    V  GD+++GL 
Sbjct: 120 IAEGCEQAGCALIGGETAEMPGMYHEGDYDLAGFAVGVVEKDKIIDGSKVKEGDVLIGLA 179

Query: 189 SSGLHSNGFALVRKIISLSQLSWKDPSPISSEHSLGETLLTPTRIYVSPLLKILRKTGKI 248
           SSGLHSNG++LVRKI+    L   D  P     +LGE LL PTRIYV P+L +L++   +
Sbjct: 180 SSGLHSNGYSLVRKIL--EVLDLDDTLPELDGKTLGEELLEPTRIYVKPVLALLKE-VDV 236

Query: 249 KALAHITGGGLTENIPRAIPAHLTASINLNSVEVPQIISWLSKKAHVKPAEVLRTFNCGI 308
           K +AHITGGG  EN+PR +P  L A I+  S  VP I  WL K  +V+  E+ RTFN GI
Sbjct: 237 KGMAHITGGGFIENLPRVLPEGLGAEIDKGSWPVPPIFKWLQKLGNVEEEEMYRTFNMGI 296

Query: 309 GMVIIVHPDNKDCIIKKFQENNENIILIGEV 339
           GMV+IV P++ D  +   +   E+  +IG V
Sbjct: 297 GMVLIVPPEDADAALALLEAAGEDAWVIGRV 327