HHsearch alignment for GI: 254780571 and conserved domain: pfam04917

>pfam04917 Shufflon_N Bacterial shufflon protein, N-terminal constant region. This family represents the high-similarity N-terminal 'constant region' shared by shufflon proteins.
Probab=94.58  E-value=0.2  Score=27.27  Aligned_cols=49  Identities=22%  Similarity=0.266  Sum_probs=40.2

Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1244554899999999999999999999999999999999999999999
Q gi|254780571|r   12 LSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM   60 (182)
Q Consensus        12 ~rd~~G~aaVEFAli~P~ll~ll~~~~e~~~~~~~~~~l~~A~~~~ar~   60 (182)
T Consensus         2 r~~~kGf~LlE~~~~L~I~~~~~~~~~~~~~~~~~~~~~q~aA~q~~~v   50 (356)
T pfam04917         2 KKTDKGVSLLEVGAVLLIVVMVIPKVAENIEDYLNNVRWQNAAEHANTY   50 (356)
T ss_pred             CEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1203443089999999999999999999999899999999999999999