RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780571|ref|YP_003064984.1| hypothetical protein
CLIBASIA_02290 [Candidatus Liberibacter asiaticus str. psy62]
         (182 letters)



>3fho_A ATP-dependent RNA helicase DBP5; mRNA export, ATPase,
           translation termination, ATP-binding, cytoplasm,
           hydrolase, membrane; 2.80A {Schizosaccharomyces pombe}
           (A:1-326)
          Length = 326

 Score = 26.3 bits (57), Expect = 2.6
 Identities = 19/157 (12%), Positives = 41/157 (26%), Gaps = 30/157 (19%)

Query: 7   YILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDMVAQE-T 65
           + L  LSR +  V    AI L     +   + +          +T    +     A    
Sbjct: 175 FALTMLSRVDASVPKPQAICLAPSRELARQIMD---------VVTEMGKYTEVKTAFGIK 225

Query: 66  SINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVR----KMWNWSSSNVKVER 121
               +  +     +  T  P    +          D K  V      M +          
Sbjct: 226 DSVPKGAKIDAQIVIGT--PGTVMDLMKRRQLDARDIKVFVLDEADNMLDQQG-----LG 278

Query: 122 EDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLK 158
           +             ++  +  N + ++FS    + ++
Sbjct: 279 DQS---------MRIKHLLPRNTQIVLFSATFSERVE 306


>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus}
           (A:)
          Length = 183

 Score = 26.0 bits (57), Expect = 3.4
 Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 2/53 (3%)

Query: 59  DMVAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWN 111
           + V Q T  N   +   ++  +    P+    H++ V G    N Q     WN
Sbjct: 100 NQVDQLTKDNVGIMILAQSVSQNPNDPHL--GHALAVVGNAKINDQEKLIYWN 150


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
          acyl-carrier-protein, beta-ketoacyl reductase,
          beta-ketoacyl synthase, dehydratase; 4.00A
          {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006)
          Length = 120

 Score = 24.7 bits (54), Expect = 8.2
 Identities = 7/28 (25%), Positives = 14/28 (50%), Gaps = 2/28 (7%)

Query: 23 MAIILPILLLIYMAVYE-ITMLYTLSKR 49
          +A ++ I  L+ +  Y  +TM   +  R
Sbjct: 2  LADVMSIESLVEVVFYRGMTMQVAV-PR 28


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.326    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0582    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,375,470
Number of extensions: 56326
Number of successful extensions: 128
Number of sequences better than 10.0: 1
Number of HSP's gapped: 128
Number of HSP's successfully gapped: 8
Length of query: 182
Length of database: 4,956,049
Length adjustment: 83
Effective length of query: 99
Effective length of database: 2,150,234
Effective search space: 212873166
Effective search space used: 212873166
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.1 bits)