RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780572|ref|YP_003064985.1| hypothetical protein CLIBASIA_02295 [Candidatus Liberibacter asiaticus str. psy62] (192 letters) >gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion]. Length = 185 Score = 71.3 bits (174), Expect = 2e-13 Identities = 37/172 (21%), Positives = 59/172 (34%), Gaps = 19/172 (11%) Query: 1 MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVAR 60 + LL+ RR R GA A+EFA++ P +LVF I+E ++F A Q ++AA AR Sbjct: 7 GLRGLLRRFRRD---RRGAAAVEFALVAPPLLLLVFGIVEFGIAFLAKQSLQNAADAAAR 63 Query: 61 KIRTGEISSKNTHSL-TEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITET 119 G + F N + ++S T Sbjct: 64 AAARGLTTDAADLDTIQAAATAFLNAIAPANAFLT---------------VQSNTPSRGT 108 Query: 120 VPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQYISSVK 171 V ++ D F+ + N+ R + DL S + Sbjct: 109 VTVTANVADATLFDTSQFTVTSAVTVSINLARGLVLVAVVPDLTGPGTSGSR 160 >gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like. The Mycobacterium tuberculosis NAD+-dependent, aldehyde dehydrogenase PDB structure, 3B4W, and the Mycobacterium tuberculosis H37Rv aldehyde dehydrogenase AldA (locus Rv0768) sequence, as well as the Rhodococcus rhodochrous ALDH involved in haloalkane catabolism, and other similar sequences, are included in this CD. Length = 471 Score = 27.9 bits (63), Expect = 1.9 Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 52 ESAAYDVARKIRTGEIS 68 VAR+IRTG + Sbjct: 415 VERGLAVARRIRTGTVG 431 >gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid; and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and also, the Mycobacterium tuberculosis H37Rv ALDH AldA (locus Rv0768) sequence; and other similar sequences, are included in this CD. Length = 459 Score = 27.2 bits (61), Expect = 3.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 54 AAYDVARKIRTGEIS 68 AY VAR+IRTG + Sbjct: 404 RAYRVARRIRTGSVG 418 >gnl|CDD|34850 COG5253, MSS4, Phosphatidylinositol-4-phosphate 5-kinase [Signal transduction mechanisms]. Length = 612 Score = 26.6 bits (58), Expect = 4.3 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 137 FSFHPGGPSTYNVLRAYYHW-PLFTDLMRQYISSVKHPGKKGDFLLSS 183 FS P + LRA L+ +YI + GK G F L + Sbjct: 336 FSCKDYFPEVFRELRALCGCDEALVSLLSRYILWESNGGKSGSFFLFT 383 >gnl|CDD|37146 KOG1935, KOG1935, KOG1935, Membrane protein Patched/PTCH [Signal transduction mechanisms]. Length = 1143 Score = 25.7 bits (56), Expect = 7.5 Identities = 15/61 (24%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Query: 115 EITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAYYHWPLFTDLMRQY---ISSVK 171 E+T+ VP + D+ FSF+P + V + + +P L+ Y S K Sbjct: 674 ELTDVVPEHTAEAAFLRAQDKYFSFYP----MFAVTQGPFDYPHQQQLLDDYHQSFGSSK 729 Query: 172 H 172 + Sbjct: 730 Y 730 >gnl|CDD|145098 pfam01763, Herpes_UL6, Herpesvirus UL6 like. This family consists of various proteins from the herpesviridae that are similar to herpes simplex virus type I UL6 virion protein. UL6 is essential for cleavage and packaging of the viral genome. Length = 551 Score = 25.7 bits (57), Expect = 8.9 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 103 LYLDVKQIKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGP 144 L +++ ++K + IT+ V D S I D+N F P Sbjct: 296 LLINLSEMKHVGGITDVV-ESFLQDVSPNIVDQNKLFDTSQP 336 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.139 0.403 Gapped Lambda K H 0.267 0.0598 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,270,616 Number of extensions: 113350 Number of successful extensions: 277 Number of sequences better than 10.0: 1 Number of HSP's gapped: 275 Number of HSP's successfully gapped: 12 Length of query: 192 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 103 Effective length of database: 4,340,536 Effective search space: 447075208 Effective search space used: 447075208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (25.3 bits)