RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780572|ref|YP_003064985.1| hypothetical protein CLIBASIA_02295 [Candidatus Liberibacter asiaticus str. psy62] (192 letters) >gnl|CDD|149078 pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues. Length = 43 Score = 52.0 bits (126), Expect = 9e-08 Identities = 17/43 (39%), Positives = 29/43 (67%) Query: 18 GAVAIEFAILVMPYFMLVFAILEISLSFTAGQLFESAAYDVAR 60 GA A+EFA+++ +L+F I+E+ F A Q+ ++AA + AR Sbjct: 1 GAAAVEFALVLPVLLLLLFGIVELGRLFYARQVLQNAAREAAR 43 >gnl|CDD|183432 PRK12316, PRK12316, peptide synthase; Provisional. Length = 5163 Score = 28.4 bits (63), Expect = 1.2 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 8/42 (19%) Query: 150 LRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEP 191 LR + H PL+ ++ R G+ G+ L S++VF+N P Sbjct: 4413 LREHEHTPLY-EIQRW-------AGQGGEALFDSLLVFENYP 4446 Score = 28.4 bits (63), Expect = 1.3 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 23/98 (23%) Query: 98 GRPYDLYLDVKQ----IKSLQEITETVPRKDKSDSSSEIDDRNFSFHPGGPSTYNVLRAY 153 GRP +L +Q I +L I P + +D E+ N + LR + Sbjct: 1820 GRPAELPGIEQQIGLFINTLPVIAAPRPDQSVADWLQEVQALNLA-----------LREH 1868 Query: 154 YHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEP 191 H PL+ D+ R G+ G+ L S++VF+N P Sbjct: 1869 EHTPLY-DIQRW-------AGQGGEALFDSLLVFENYP 1898 >gnl|CDD|165257 PHA02947, PHA02947, S-S bond formation pathway protein; Provisional. Length = 215 Score = 27.8 bits (62), Expect = 2.0 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 16/71 (22%) Query: 62 IRTGEISSKNTHSLTEFRRVFCNDLRVLFNCSENEIGRPYDLYLDVKQIKSLQEITETVP 121 I GEI +F+R C LR++ C N + L IK+ +E+ T+P Sbjct: 35 IHIGEIKG-------QFKR--CK-LRIINKCLNN---KRLSFTL---LIKTFKEVISTLP 78 Query: 122 RKDKSDSSSEI 132 K++ + ++EI Sbjct: 79 EKERRELANEI 89 >gnl|CDD|171521 PRK12467, PRK12467, peptide synthase; Provisional. Length = 3956 Score = 26.7 bits (59), Expect = 4.3 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 8/42 (19%) Query: 150 LRAYYHWPLFTDLMRQYISSVKHPGKKGDFLLSSIVVFKNEP 191 LR + H PL D+ R G+ G+ L SI+VF+N P Sbjct: 2957 LREFEHTPLA-DIQRW-------AGQGGEALFDSILVFENYP 2990 >gnl|CDD|147888 pfam05975, EcsB, Bacterial ABC transporter protein EcsB. This family consists of several bacterial ABC transporter proteins which are homologous to the EcsB protein of Bacillus subtilis. EcsB is thought to encode a hydrophobic protein with six membrane-spanning helices in a pattern found in other hydrophobic components of ABC transporters. Length = 385 Score = 25.7 bits (57), Expect = 7.9 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 1 MRKKLLQGIRRSILIREGAVAIEFAILVMPYFMLVF 36 M+K L + IR S++++ + AIL++P + + Sbjct: 93 MKKYLKKAIRYSLILQLILQVL-LAILLLPLLLKIL 127 >gnl|CDD|184451 PRK14013, PRK14013, hypothetical protein; Provisional. Length = 338 Score = 25.5 bits (57), Expect = 8.3 Identities = 10/36 (27%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Query: 12 SILIREGAVAIEFAILVMPYFMLVF--AILEISLSF 45 S ++ + + + + +V A+LEISLSF Sbjct: 9 SFIVTVIGLVLAAWLGGLSALFIVAILAVLEISLSF 44 >gnl|CDD|180017 PRK05326, PRK05326, potassium/proton antiporter; Reviewed. Length = 562 Score = 25.5 bits (57), Expect = 9.5 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 8/34 (23%) Query: 18 GAVAIEFAILVM----P----YFMLVFAILEISL 43 GAV I A M P F +VF ++ +SL Sbjct: 343 GAVPIVLATFPMMAGLPNAQLIFNVVFFVVLVSL 376 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.139 0.403 Gapped Lambda K H 0.267 0.0699 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,068,317 Number of extensions: 186505 Number of successful extensions: 367 Number of sequences better than 10.0: 1 Number of HSP's gapped: 366 Number of HSP's successfully gapped: 19 Length of query: 192 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 104 Effective length of database: 4,092,969 Effective search space: 425668776 Effective search space used: 425668776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 54 (24.6 bits)