RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780575|ref|YP_003064988.1| hypothetical protein CLIBASIA_02310 [Candidatus Liberibacter asiaticus str. psy62] (316 letters) >d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 Score = 26.2 bits (57), Expect = 3.5 Identities = 11/59 (18%), Positives = 20/59 (33%), Gaps = 9/59 (15%) Query: 265 TAPLLMIVSSVFILKQPIDTVR---------TIVFGIVVIAMVVYLLPTVINSGKNKTK 314 P M+V F + +P +IV G + + + + P V + K Sbjct: 6 NKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPYEEHGRIK 64 >d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Length = 230 Score = 26.1 bits (57), Expect = 4.5 Identities = 6/13 (46%), Positives = 9/13 (69%) Query: 226 NIPDTLFLIGYGL 238 +P +LIG+GL Sbjct: 174 PMPKGSWLIGFGL 186 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.329 0.143 0.434 Gapped Lambda K H 0.267 0.0517 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,139,245 Number of extensions: 51589 Number of successful extensions: 106 Number of sequences better than 10.0: 1 Number of HSP's gapped: 106 Number of HSP's successfully gapped: 12 Length of query: 316 Length of database: 2,407,596 Length adjustment: 85 Effective length of query: 231 Effective length of database: 1,240,546 Effective search space: 286566126 Effective search space used: 286566126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 53 (24.7 bits)