>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid dehydrogenase (BCDH), contain at least three different enzymes, 2-oxo acid dehydrogenase (E1), dihydrolipoyl acyltransferase (E2) and dihydrolipoamide dehydrogenase (E3) and play a key role in redox regulation. E2, the central component of the complex, catalyzes the transfer of the acyl group of CoA from E1 to E3 via reductive acetylation of a lipoyl group covalently attached to a lysine residue.

Probab=92.48 E-value=0.48 Score=26.84 Aligned_cols=51 Identities=31% Similarity=0.341 Sum_probs=37.5 Q ss_pred EECCCCCEEECCCEEEEEEE-CCEEEEEECCC---CEEEEECCCEEEEEEEEEEEE Q ss_conf 51389985703866888832-89899996399---736762298899307787971 Q gi|254780577|r 169 CWVKPTMKVEAGMRFGIIRF-GSRVDLFLPKD---ANIRVEIGQKTVAGETVIAEF 220 (232) Q Consensus 169 ~~~~~g~~v~~G~r~G~irf-GS~vdi~lP~~---~~~~V~~Gq~V~aGeTila~l 220 (232) T Consensus 20 w~v~~Gd~V~~gd~l~~vEt~K~~~~i~a~~~G~v~~i~~~~G~~v~~G~-~l~~i 74 (74) T cd06849 20 WLVKEGDSVEEGDVLAEVETDKATVEVEAPAAGVLAKILVEEGDTVPVGQ-VIAVI 74 (74) T ss_pred EEECCCCEECCCCEEEEEECCCEEEEEECCCCEEEEEEEECCCCEECCCC-EEEEC T ss_conf 99279899978999999985850784107989999999878999988999-99979

HHsearch alignment for GI: 254780577 and conserved domain: cd06849