RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780577|ref|YP_003064990.1| phosphatidylserine decarboxylase [Candidatus Liberibacter asiaticus str. psy62] (232 letters) >1qle_C Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} (C:1-77) Length = 77 Score = 29.7 bits (67), Expect = 0.36 Identities = 9/53 (16%), Positives = 18/53 (33%), Gaps = 15/53 (28%) Query: 19 WPFIVSFAAFTIIIG--MW------------SYGLLWFGAILTVWCAYF-FRD 56 WPF + AF ++ G W + G + ++ + + D Sbjct: 16 WPFFGAIGAFVMLTGAVAWMKGITFFGLPVEGPWMFLIGLVGVLYVMFGWWAD 68 >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} (A:83-190) Length = 108 Score = 28.5 bits (64), Expect = 0.77 Identities = 12/50 (24%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Query: 171 VKPTMKV--EAGMRFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGETVIA 218 ++P +K+ G I FLP A +++E G + +G+ +A Sbjct: 53 LRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGD-TLA 101 >2a6h_D DNA-directed RNA polymerase beta' chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} (D:165-395) Length = 231 Score = 26.9 bits (59), Expect = 2.2 Identities = 8/57 (14%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Query: 174 TMKVEAGMRFGIIRF--GSRVDLFLPKDANIRVEIGQKTVAGETVIAEFNSTKPPLL 228 + E + + D + N+ V G + AG+ ++A + + + Sbjct: 159 EAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIA 215 >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrate binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} (A:142-227) Length = 86 Score = 26.2 bits (58), Expect = 3.8 Identities = 7/40 (17%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Query: 5 QAIRKILVPIHFHGWPFIV------SFAAFTIIIGMWSYG 38 +++ K++ + +I+ S + I G S G Sbjct: 15 ESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPG 54 >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* (A:236-484) Length = 249 Score = 26.0 bits (57), Expect = 4.3 Identities = 12/50 (24%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 182 RFGIIRFGSRVDLFLPKDANIRVEIGQKTVAGET-VIAEFNSTKPPLLVC 230 R+ I+ F S DL +P + I + + +T E+ I +++ + ++V Sbjct: 185 RYSIMPFMSAADLVVPAEGTISIAVKSRTGGEESFTIPAWSADRHSIIVQ 234 >1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe- 2S] cluster, rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} (B:1-62,B:100-133) Length = 96 Score = 25.5 bits (56), Expect = 5.8 Identities = 11/58 (18%), Positives = 19/58 (32%), Gaps = 15/58 (25%) Query: 46 LTVWCAYFFRDPERVTPIDPNLLI---SPADGLV---------SAICEMSPPPELELE 91 L F P+ +P + + +P G V S +C + P + L Sbjct: 17 LAANEPVSFTYPDTSSP---CVAVKLGAPVPGGVGPDDDIVAYSVLCTHADLPRVLLR 71 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.328 0.142 0.448 Gapped Lambda K H 0.267 0.0682 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,899,171 Number of extensions: 87078 Number of successful extensions: 281 Number of sequences better than 10.0: 1 Number of HSP's gapped: 280 Number of HSP's successfully gapped: 17 Length of query: 232 Length of database: 4,956,049 Length adjustment: 86 Effective length of query: 146 Effective length of database: 2,048,819 Effective search space: 299127574 Effective search space used: 299127574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.3 bits)