RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780578|ref|YP_003064991.1| phosphatidylserine synthase [Candidatus Liberibacter asiaticus str. psy62] (298 letters) >2c82_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870C, DOXP/MEP pathway, oxidoreductase, isoprene biosynthesis, metal-binding; 1.9A {Mycobacterium tuberculosis} PDB: 2jd1_A* 2jcv_A* 2jcz_A* 2jd2_A 2jcx_A* 2jcy_A 2jd0_A* (A:321-413) Length = 93 Score = 28.6 bits (64), Expect = 1.1 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Query: 88 VLVAAFLDG------IDGRIARFMEATSKFGAQLDSLADVI 122 AAFL G I G IA + A ++ + ++ DV+ Sbjct: 12 EAAAAFLAGRIGFPAIVGIIADVLHAADQWAVEPATVDDVL 52 >1s0p_A CAP, adenylyl cyclase-associated protein; alpha helix bundle, membrane protein; 1.40A {Dictyostelium discoideum} (A:) Length = 176 Score = 26.7 bits (59), Expect = 4.4 Identities = 6/33 (18%), Positives = 15/33 (45%) Query: 90 VAAFLDGIDGRIARFMEATSKFGAQLDSLADVI 122 V F + +D I F+ + K ++ + + + Sbjct: 2 VKEFQNLVDQHITPFVALSKKLAPEVGNQVEQL 34 >3bq9_A Predicted rossmann fold nucleotide-binding domain-containing protein; structural genomics, PSI-2, protein structure initiative; 1.80A {Idiomarina baltica OS145} (A:86-460) Length = 375 Score = 26.2 bits (57), Expect = 5.2 Identities = 7/34 (20%), Positives = 12/34 (35%) Query: 229 VWSGKKIHRKFVLPIVLCSVAYIAFMIHFLWEMI 262 +++ LP++L A L E I Sbjct: 182 GILMHPDNQRQSLPVILTGPASSRDYFEALDEFI 215 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.329 0.143 0.454 Gapped Lambda K H 0.267 0.0658 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,396,576 Number of extensions: 108369 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's gapped: 245 Number of HSP's successfully gapped: 13 Length of query: 298 Length of database: 4,956,049 Length adjustment: 88 Effective length of query: 210 Effective length of database: 1,981,209 Effective search space: 416053890 Effective search space used: 416053890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 54 (24.7 bits)