RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|140299 PTZ00273, PTZ00273, oxidase reductase; Provisional. Length = 320 Score = 26.6 bits (59), Expect = 4.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 14/50 (28%) Query: 15 FIMGFISFIRYVKQMHIP-DHPSVSAIVVLTG---EPIRIERAFELLENQ 60 F MG H+P DHP V A L G P ++E EL+E Sbjct: 103 FDMGC----------HLPKDHPDVMAGKPLRGPNNHPTQVEGWMELMETH 142 >gnl|CDD|185656 PTZ00478, PTZ00478, Sec superfamily; Provisional. Length = 81 Score = 26.6 bits (59), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Query: 8 LFVCLI-FFIMGFISFIRYVKQMHIP 32 + C + FFIMGFI + +K + IP Sbjct: 49 AYACSVGFFIMGFIGYS--IKLVFIP 72 >gnl|CDD|163199 TIGR03282, methan_mark_13, putative methanogenesis marker 13 metalloprotein. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. This metal cluster-binding family is related to nitrogenase structural protein NifD and accessory protein NifE, among others. Length = 352 Score = 26.3 bits (58), Expect = 5.7 Identities = 10/28 (35%), Positives = 19/28 (67%) Query: 47 PIRIERAFELLENQIGEKIFISGVHHSV 74 P+ E+A E++E++ + I+GV H+V Sbjct: 265 PVTGEKAAEIIEDEDPDFAVITGVPHAV 292 >gnl|CDD|147793 pfam05832, DUF846, Eukaryotic protein of unknown function (DUF846). This family consists of several of unknown function from a variety of eukaryotic organisms. Length = 140 Score = 26.1 bits (58), Expect = 6.6 Identities = 7/24 (29%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Query: 2 RYFWYGLFVC-LIFFIMGFISFIR 24 FW L+V L + ++ I+ I Sbjct: 91 NLFWLALYVAPLFWVVLAIINLIS 114 >gnl|CDD|162012 TIGR00728, OPT_sfam, oligopeptide transporters, OPT superfamily. Homology between the two branches of the superfamily is seen most easily at the ends of the protein. The central regions are poorly conserved within each branch and may not be homologous between branches. Length = 654 Score = 25.9 bits (57), Expect = 7.3 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 5 WYGLFVCLIFFIMGFI 20 W+G+ V LI + I Sbjct: 407 WWGVIVALIIAFVLAI 422 >gnl|CDD|162103 TIGR00913, 2A0310, amino acid permease (yeast). Length = 478 Score = 25.7 bits (57), Expect = 7.8 Identities = 7/20 (35%), Positives = 11/20 (55%), Gaps = 1/20 (5%) Query: 5 WYGLFVC-LIFFIMGFISFI 23 +Y LF LI G+++F Sbjct: 415 YYALFFNILILIAQGYVAFA 434 >gnl|CDD|162465 TIGR01652, ATPase-Plipid, phospholipid-translocating P-type ATPase, flippase. This model describes the P-type ATPase responsible for transporting phospholipids from one leaflet of bilayer membranes to the other. These ATPases are found only in eukaryotes. Length = 1057 Score = 25.8 bits (57), Expect = 8.4 Identities = 6/32 (18%), Positives = 14/32 (43%) Query: 3 YFWYGLFVCLIFFIMGFISFIRYVKQMHIPDH 34 FW L V ++ ++ ++ + PD+ Sbjct: 1021 GFWLVLLVIVLISLLPRFTYKAIQRLFRPPDY 1052 >gnl|CDD|180655 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed. Length = 390 Score = 25.6 bits (57), Expect = 9.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Query: 147 FIPYPIISHDLEENSSIFKIKILRVLLIEY 176 FIP +IS E+ S FK K L V +IE Sbjct: 131 FIPASLISTRFVEDFSDFKGKTLEVKIIEL 160 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.328 0.142 0.420 Gapped Lambda K H 0.267 0.0726 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,358,111 Number of extensions: 210507 Number of successful extensions: 701 Number of sequences better than 10.0: 1 Number of HSP's gapped: 697 Number of HSP's successfully gapped: 28 Length of query: 207 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,071,361 Effective search space: 480420598 Effective search space used: 480420598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (25.0 bits)