HHsearch alignment for GI: 254780582 and conserved domain: COG1041

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair].
Probab=98.28  E-value=5.6e-06  Score=54.16  Aligned_cols=128  Identities=18%  Similarity=0.040  Sum_probs=87.2

Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCHHHHHH-HCCCCEEEEEECHHHHHHHHHCCC------CCEEEE-CHHHCCCCCCC
Q ss_conf             9999997501048975999653881113553-123874887305899983231168------623653-33656775472
Q gi|254780582|r   24 ISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQYF------SSTALV-SEGNLPLADSS   95 (242)
Q Consensus        24 ~~~~l~~~l~~~~g~~vLdiGcg~g~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~-d~~~LPf~~~s   95 (242)
T Consensus       185 lAR~mVNLa~v~~G~~vlDPFcGTGgiLiEagl~G~~viG~Did~~mv~gak~Nl~~y~i~~~~~~~~~Da~~lpl~~~~  264 (347)
T COG1041         185 LARAMVNLARVKRGELVLDPFCGTGGILIEAGLMGARVIGSDIDERMVRGAKINLEYYGIEDYPVLKVLDATNLPLRDNS  264 (347)
T ss_pred             HHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHCCCEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCC
T ss_conf             99998777416469876457678348888366427567603237999855664156627676168873022127788774


Q ss_pred             CCCHHHH---------HHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             0200220---------2477522999999999984699988999733877403456532766565578889999999628
Q gi|254780582|r   96 VDCVLMV---------HYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREAN  166 (242)
Q Consensus        96 fD~Vi~~---------h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~~~~~~~~~r~~~~~~l~~~l~~~g  166 (242)
T Consensus       265 vdaIatDPPYGrst~~~~~~l~~Ly~~~le~~~evLk~gG~~vf~~p----------------------~~~~~~~~~~~  322 (347)
T COG1041         265 VDAIATDPPYGRSTKIKGEGLDELYEEALESASEVLKPGGRIVFAAP----------------------RDPRHELEELG  322 (347)
T ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECC----------------------CCCHHHHHHCC
T ss_conf             23588469987100245552899999999999987304848999617----------------------86055676439


Q ss_pred             CCCEEEE
Q ss_conf             7621257
Q gi|254780582|r  167 FTLSITS  173 (242)
Q Consensus       167 f~~~~~~  173 (242)
T Consensus       323 f~v~~~~  329 (347)
T COG1041         323 FKVLGRF  329 (347)
T ss_pred             CEEEEEE
T ss_conf             6599999