HHsearch alignment for GI: 254780582 and conserved domain: COG1189

>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].
Probab=94.18  E-value=0.35  Score=26.82  Aligned_cols=155  Identities=17%  Similarity=0.140  Sum_probs=87.7

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHH-HC-CCCEEEEEECHHHHHHHHHCCCCCEEEEC--
Q ss_conf             961288989999999999997501048975999653881113553-12-38748873058999832311686236533--
Q gi|254780582|r   10 QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GK-VERTLAFMPAGQGATNWPDQYFSSTALVS--   85 (242)
Q Consensus        10 ~wY~s~~G~~~~~~~~~~l~~~l~~~~g~~vLdiGcg~g~~~~~~-~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~d--   85 (242)
T Consensus        57 ~~yVSRG~~KL~----~ale~F~l~~k~kv~LDiGsSTGGFTd~lLq~gAk~VyavDVG~~Ql-~~kLR~d~rV~~~E~t  131 (245)
T COG1189          57 QPYVSRGGLKLE----KALEEFELDVKGKVVLDIGSSTGGFTDVLLQRGAKHVYAVDVGYGQL-HWKLRNDPRVIVLERT  131 (245)
T ss_pred             CCCCCCHHHHHH----HHHHHCCCCCCCCEEEEECCCCCCHHHHHHHCCCCEEEEEECCCCCC-CHHHHCCCCEEEEECC
T ss_conf             676261899999----99996486889978998267876299999875874799997037743-7867359847998527


Q ss_pred             -HHHCC---CCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCC-----CCCCCCHH
Q ss_conf             -36567---7547202002202477522999999999984699988999733877403456532766-----56557888
Q gi|254780582|r   86 -EGNLP---LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG-----SGQPYSWY  156 (242)
Q Consensus        86 -~~~LP---f~~~sfD~Vi~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~~~~~~~-----~~r~~~~~  156 (242)
T Consensus       132 N~r~l~~~~~~~-~~d~~v~DvSF--I-SL~~iLp~l~~l~~~~~~~v~LvKP-QFEagr~~v~kkGvv~d~~~~~~v~~  206 (245)
T COG1189         132 NVRYLTPEDFTE-KPDLIVIDVSF--I-SLKLILPALLLLLKDGGDLVLLVKP-QFEAGREQVGKKGVVRDPKLHAEVLS  206 (245)
T ss_pred             CHHHCCHHHCCC-CCCEEEEEEEH--H-HHHHHHHHHHHHCCCCCEEEEEECC-HHHHHHHHCCCCCEECCCCHHHHHHH
T ss_conf             831189878176-77847996423--3-1998889999742788638997365-55540432276863448015899999


Q ss_pred             HHHHHHHHCCCCCEEEEE
Q ss_conf             999999962876212578
Q gi|254780582|r  157 QMISLLREANFTLSITSR  174 (242)
Q Consensus       157 ~l~~~l~~~gf~~~~~~~  174 (242)
T Consensus       207 ~i~~~~~~~g~~~~gl~~  224 (245)
T COG1189         207 KIENFAKELGFQVKGLIK  224 (245)
T ss_pred             HHHHHHHHCCCEEEEEEC
T ss_conf             999888645957865572