HHsearch alignment for GI: 254780582 and conserved domain: KOG0820

>KOG0820 consensus.
Probab=95.64  E-value=0.052  Score=31.56  Aligned_cols=89  Identities=7%  Similarity=-0.063  Sum_probs=57.8

Q ss_pred             HHCCHHHHHHHH--HHHHHHHHHCCCCCCCEEEEECCCCCHHHH-HHHCCCCEEEEEECHHHHHHHHHCCCC-------C
Q ss_conf             612889899999--999999975010489759996538811135-531238748873058999832311686-------2
Q gi|254780582|r   11 FYSSFLGKCTTD--AISKVLSTTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATNWPDQYFS-------S   80 (242)
Q Consensus        11 wY~s~~G~~~~~--~~~~~l~~~l~~~~g~~vLdiGcg~g~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~   80 (242)
T Consensus        31 kfnkd~GQHilkNp~v~~~I~~ka~~k~tD~VLEvGPGTGnLT~~lLe~~kkVvA~E~Dprmvael~krv~gtp~~~kLq  110 (315)
T KOG0820          31 KFNKDFGQHILKNPLVIDQIVEKADLKPTDVVLEVGPGTGNLTVKLLEAGKKVVAVEIDPRMVAELEKRVQGTPKSGKLQ  110 (315)
T ss_pred             CCCCCCCHHHHCCHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             65543014555477889999860478998779995798778999999720848999408078999999866998656046


Q ss_pred             EEEECHHHCCCCCCCCCCHHH
Q ss_conf             365333656775472020022
Q gi|254780582|r   81 TALVSEGNLPLADSSVDCVLM  101 (242)
Q Consensus        81 ~~~~d~~~LPf~~~sfD~Vi~  101 (242)
T Consensus       111 V~~gD~l--K~d~P~fd~cVs  129 (315)
T KOG0820         111 VLHGDFL--KTDLPRFDGCVS  129 (315)
T ss_pred             EEECCCC--CCCCCCCCEEEC
T ss_conf             8850312--578851031122