HHsearch alignment for GI: 254780582 and conserved domain: KOG1500

>KOG1500 consensus.
Probab=97.27  E-value=0.00098  Score=41.38  Aligned_cols=99  Identities=18%  Similarity=0.193  Sum_probs=61.7

Q ss_pred             CCCCCCEEEEECCCCCHHHHHHHCC--CCEEEEEECHHHHHHHHHCCCC-------CEEEECHHHCCCCCCCCCCHHHH-
Q ss_conf             1048975999653881113553123--8748873058999832311686-------23653336567754720200220-
Q gi|254780582|r   33 DDVTGCRLLGLGYAIPFFSCFHGKV--ERTLAFMPAGQGATNWPDQYFS-------STALVSEGNLPLADSSVDCVLMV-  102 (242)
Q Consensus        33 ~~~~g~~vLdiGcg~g~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~-------~~~~~d~~~LPf~~~sfD~Vi~~-  102 (242)
T Consensus       174 sDF~~kiVlDVGaGSGILS~FAaqAGA~~vYA-vEAS~MAqyA~~Lv~~N~~~~rItVI~GKiEdieLP-Ek~DviISEP  251 (517)
T KOG1500         174 SDFQDKIVLDVGAGSGILSFFAAQAGAKKVYA-VEASEMAQYARKLVASNNLADRITVIPGKIEDIELP-EKVDVIISEP  251 (517)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHCCCEEEE-EEHHHHHHHHHHHHHCCCCCCEEEECCCCCCEECCC-CCCCEEEECC
T ss_conf             34577489981588248999998738653898-745679999999874366320378705632010375-1034787256


Q ss_pred             -HHHHHHCCHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             -2477522999999999984699988999733
Q gi|254780582|r  103 -HYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP  133 (242)
Q Consensus       103 -h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~  133 (242)
T Consensus       252 MG~mL~NERMLEsYl~Ark~l~P~GkMfPT~g  283 (517)
T KOG1500         252 MGYMLVNERMLESYLHARKWLKPNGKMFPTVG  283 (517)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             21411108889999999874287774467525