HHsearch alignment for GI: 254780582 and conserved domain: KOG1540

>KOG1540 consensus.
Probab=99.71  E-value=1.5e-16  Score=114.47  Aligned_cols=148  Identities=13%  Similarity=0.084  Sum_probs=107.3

Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHC---C------CCEEEEEECHHHHHHHHHCC------C---CCEEEEC
Q ss_conf             999999750104897599965388111355312---3------87488730589998323116------8---6236533
Q gi|254780582|r   24 ISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK---V------ERTLAFMPAGQGATNWPDQY------F---SSTALVS   85 (242)
Q Consensus        24 ~~~~l~~~l~~~~g~~vLdiGcg~g~~~~~~~~---~------~~~~~~~~~~~~~~~~~~~~------~---~~~~~~d   85 (242)
T Consensus        88 WKd~~v~~L~p~~~m~~lDvaGGTGDiaFril~~v~s~~~~~~~~V~v~Dinp~mL~vgkqRa~~~~l~~~~~~~w~~~d  167 (296)
T KOG1540          88 WKDMFVSKLGPGKGMKVLDVAGGTGDIAFRILRHVKSQFGDRESKVTVLDINPHMLAVGKQRAKKRPLKASSRVEWVEGD  167 (296)
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCCEEEEECC
T ss_conf             88876621587778758983477525677798761134577776179993898999999877751597768716999477


Q ss_pred             HHHCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCC--HH-HHH-----------------HC
Q ss_conf             36567754720200220247752299999999998469998899973387740--34-565-----------------32
Q gi|254780582|r   86 EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--WA-RME-----------------HT  145 (242)
Q Consensus        86 ~~~LPf~~~sfD~Vi~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~--w~-~~~-----------------~~  145 (242)
T Consensus       168 AE~LpFdd~s~D~yTiafGIRN~th~~k~l~EAYRVLKpGGrf~cLeFskv~~~~l~~fy~~ysf~VlpvlG~~iagd~~  247 (296)
T KOG1540         168 AEDLPFDDDSFDAYTIAFGIRNVTHIQKALREAYRVLKPGGRFSCLEFSKVENEPLKWFYDQYSFDVLPVLGEIIAGDRK  247 (296)
T ss_pred             CCCCCCCCCCCEEEEEECCEECCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_conf             01089997751158884211147877899999987527786799997354540778999971222321105576652176


Q ss_pred             CC-----CCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             76-----656557888999999962876212
Q gi|254780582|r  146 PF-----GSGQPYSWYQMISLLREANFTLSI  171 (242)
Q Consensus       146 ~~-----~~~r~~~~~~l~~~l~~~gf~~~~  171 (242)
T Consensus       248 sYqYLveSI~rfp~qe~f~~miedaGF~~~~  278 (296)
T KOG1540         248 SYQYLVESIRRFPPQEEFASMIEDAGFSSVN  278 (296)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHCCCCCCC
T ss_conf             5454776650699889999999972875102