HHsearch alignment for GI: 254780582 and conserved domain: KOG2539

>KOG2539 consensus.
Probab=90.19  E-value=0.35  Score=26.83  Aligned_cols=115  Identities=13%  Similarity=0.105  Sum_probs=60.7

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCC--H-HHHHHHCC-CCEE-EEEECHHHHHHHHHCCCC-----CE----EEEC
Q ss_conf             99999999997501048975999653881--1-13553123-8748-873058999832311686-----23----6533
Q gi|254780582|r   20 TTDAISKVLSTTWDDVTGCRLLGLGYAIP--F-FSCFHGKV-ERTL-AFMPAGQGATNWPDQYFS-----ST----ALVS   85 (242)
Q Consensus        20 ~~~~~~~~l~~~l~~~~g~~vLdiGcg~g--~-~~~~~~~~-~~~~-~~~~~~~~~~~~~~~~~~-----~~----~~~d   85 (242)
T Consensus       184 ~v~~~~~e~~~~~p~f~pd~~~dfgsg~~~~~~a~~~lwr~t~~~~~~Vdrs~~~~~~~e~~lr~~~~~g~~~v~~~~~~  263 (491)
T KOG2539         184 LVTRSNKEINMRSPKFRPDLLRDFGSGAGNGGWAAVLLWRQTKREYSLVDRSRAMLKQSEKNLRDGSHIGEPIVRKLVFH  263 (491)
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCHHHCCCHHCCCCCHH
T ss_conf             99989999851072117079999874315551035343002122067632555888888876247333275021553201


Q ss_pred             HHHCCCCCCC-CCCHHHHHHHHHHCCHHH---HHHHHHH-HCCCCCEEEEEECC
Q ss_conf             3656775472-020022024775229999---9999998-46999889997338
Q gi|254780582|r   86 EGNLPLADSS-VDCVLMVHYLEFAEDPFL---MLHEIWR-VLTSGGRMIVVVPN  134 (242)
Q Consensus        86 ~~~LPf~~~s-fD~Vi~~h~LE~~~dp~~---~L~Ei~R-vLkPgG~lii~~~n  134 (242)
T Consensus       264 r~~~pi~~~~~yDlvi~ah~l~~~~s~~~R~~v~~s~~r~~~r~g~~lViIe~g  317 (491)
T KOG2539         264 RQRLPIDIKNGYDLVICAHKLHELGSKFSRLDVPESLWRKTDRSGYFLVIIEKG  317 (491)
T ss_pred             CCCCCCCCCCCEEEEEEEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             012788855532368866343014782046563699998606877417998558