HHsearch alignment for GI: 254780582 and conserved domain: KOG3178

>KOG3178 consensus.
Probab=97.07  E-value=0.015  Score=34.70  Aligned_cols=146  Identities=16%  Similarity=0.088  Sum_probs=94.0

Q ss_pred             HHCCCCCC----CEEEEECCCCCHHHH-HHHCCCCEEEEEECHHHHHHHHHCC-CC-CEEEECH-HHCCCCCCCCCCHHH
Q ss_conf             75010489----759996538811135-5312387488730589998323116-86-2365333-656775472020022
Q gi|254780582|r   30 TTWDDVTG----CRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATNWPDQY-FS-STALVSE-GNLPLADSSVDCVLM  101 (242)
Q Consensus        30 ~~l~~~~g----~~vLdiGcg~g~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~-~~-~~~~~d~-~~LPf~~~sfD~Vi~  101 (242)
T Consensus       167 ~il~~~~Gf~~v~~avDvGgGiG~v~k~ll~~fp~ik~infdlp~v~~~a~~~~~gV~~v~gdmfq~~P~~----daI~m  242 (342)
T KOG3178         167 KILEVYTGFKGVNVAVDVGGGIGRVLKNLLSKYPHIKGINFDLPFVLAAAPYLAPGVEHVAGDMFQDTPKG----DAIWM  242 (342)
T ss_pred             HHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHHCCCCCEECCCCCCCCCCC----CEEEE
T ss_conf             64201026556766887587476999999975887725514789998522320678651236453458876----75998


Q ss_pred             HHHHHHHCC--HHHHHHHHHHHCCCCCEEEEEECCCCC---------CHHHH----HHCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             024775229--999999999846999889997338774---------03456----532766565578889999999628
Q gi|254780582|r  102 VHYLEFAED--PFLMLHEIWRVLTSGGRMIVVVPNKRG---------MWARM----EHTPFGSGQPYSWYQMISLLREAN  166 (242)
Q Consensus       102 ~h~LE~~~d--p~~~L~Ei~RvLkPgG~lii~~~n~~s---------~w~~~----~~~~~~~~r~~~~~~l~~~l~~~g  166 (242)
T Consensus       243 kWiLhdwtDedcvkiLknC~~sL~~~GkIiv~E~V~p~e~~~dd~~s~v~~~~d~lm~~~~~~Gkert~~e~q~l~~~~g  322 (342)
T KOG3178         243 KWILHDWTDEDCVKILKNCKKSLPPGGKIIVVENVTPEEDKFDDIDSSVTRDMDLLMLTQTSGGKERTLKEFQALLPEEG  322 (342)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCEEEHHHHHHHHHHCCCEECCHHHHHHCCHHHC
T ss_conf             70005687688999999999858998889998356887777666432101046789998752560114999971146646


Q ss_pred             CCCEEEEEEEEEC
Q ss_conf             7621257898308
Q gi|254780582|r  167 FTLSITSRSLFFP  179 (242)
Q Consensus       167 f~~~~~~~~~~~p  179 (242)
T Consensus       323 F~~~~~~~~~~~~  335 (342)
T KOG3178         323 FPVCMVALTAYSY  335 (342)
T ss_pred             CCEEEEEECCCCH
T ss_conf             8346897337745