HHsearch alignment for GI: 254780582 and conserved domain: KOG3201

>KOG3201 consensus.
Probab=96.42  E-value=0.0015  Score=40.41  Aligned_cols=126  Identities=16%  Similarity=0.225  Sum_probs=73.8

Q ss_pred             HCCCCCCCEEEEECCCCCHHHHHH-HCC--CCEEEEEEC-HHHH---HHHHHCC--CCCEEE------ECHHHCCCCCCC
Q ss_conf             501048975999653881113553-123--874887305-8999---8323116--862365------333656775472
Q gi|254780582|r   31 TWDDVTGCRLLGLGYAIPFFSCFH-GKV--ERTLAFMPA-GQGA---TNWPDQY--FSSTAL------VSEGNLPLADSS   95 (242)
Q Consensus        31 ~l~~~~g~~vLdiGcg~g~~~~~~-~~~--~~~~~~~~~-~~~~---~~~~~~~--~~~~~~------~d~~~LPf~~~s   95 (242)
T Consensus        24 ~~n~~rg~~ilelgggft~laglmia~~a~~~~v~ltdgne~svrnv~ki~~~n~~s~~tsc~vlrw~~~~aqsq~eq~t  103 (201)
T KOG3201          24 DPNKIRGRRILELGGGFTGLAGLMIACKAPDSSVWLTDGNEESVRNVEKIRNSNMASSLTSCCVLRWLIWGAQSQQEQHT  103 (201)
T ss_pred             CHHHHHHHHHHHHCCCHHHHHHHHEEEECCCCEEEEECCCHHHHHHHHHHHHCCCCCCCCEEHHHHHHHHHHHHHHHHCC
T ss_conf             60677678898726744655455204535873588716978999979999851200256500034787764488875170


Q ss_pred             CCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCEEE
Q ss_conf             02002202477522999999999984699988999733877403456532766565578889999999628762125
Q gi|254780582|r   96 VDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSIT  172 (242)
Q Consensus        96 fD~Vi~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~~~~~~~~~r~~~~~~l~~~l~~~gf~~~~~  172 (242)
T Consensus       104 FDiIlaADClFfdE~h~sLvdtIk~lL~p~g~Al~fsPRRg----------------~sL~kF~de~~~~gf~v~l~  164 (201)
T KOG3201         104 FDIILAADCLFFDEHHESLVDTIKSLLRPSGRALLFSPRRG----------------QSLQKFLDEVGTVGFTVCLE  164 (201)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCC----------------CHHHHHHHHHHHCEEEEEEC
T ss_conf             22798601025889999999999998584666167667555----------------56999999987540699953