HHsearch alignment for GI: 254780582 and conserved domain: KOG3420

>KOG3420 consensus.
Probab=95.56  E-value=0.019  Score=34.05  Aligned_cols=57  Identities=19%  Similarity=0.261  Sum_probs=40.5

Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHH--HCCCCEEEEEECHHHHHHHHHC
Q ss_conf             99999999997501048975999653881113553--1238748873058999832311
Q gi|254780582|r   20 TTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH--GKVERTLAFMPAGQGATNWPDQ   76 (242)
Q Consensus        20 ~~~~~~~~l~~~l~~~~g~~vLdiGcg~g~~~~~~--~~~~~~~~~~~~~~~~~~~~~~   76 (242)
T Consensus        32 iAasM~~~Ih~TygdiEgkkl~DLgcgcGmLs~a~sm~~~e~vlGfDIdpeALEIf~rN   90 (185)
T KOG3420          32 IAASMLYTIHNTYGDIEGKKLKDLGCGCGMLSIAFSMPKNESVLGFDIDPEALEIFTRN   90 (185)
T ss_pred             HHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHC
T ss_conf             99999999986201204746225247611567775057873378640588999998616