HHsearch alignment for GI: 254780582 and conserved domain: PRK01683

>PRK01683 trans-aconitate 2-methyltransferase; Provisional.
Probab=99.82  E-value=1.4e-18  Score=126.10  Aligned_cols=171  Identities=12%  Similarity=0.063  Sum_probs=123.1

Q ss_pred             CCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHC---CCCEEEEEECHHHHHHHHHCCC
Q ss_conf             8678899996128898999999999999750104897599965388111355312---3874887305899983231168
Q gi|254780582|r    2 RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK---VERTLAFMPAGQGATNWPDQYF   78 (242)
Q Consensus         2 ~~di~~l~~wY~s~~G~~~~~~~~~~l~~~l~~~~g~~vLdiGcg~g~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~   78 (242)
T Consensus         3 dWnp~~Y~rf-~~~r~rp~~DL-----l~~l~~~~~~~vlDlGCG~G~~t~~l~~r~p~a~v~GiD~S~~Ml~~Ar~~~~   76 (252)
T PRK01683          3 DWNPSLYLQF-EAERTRPAVEL-----LARVPLENVEYVADLGCGPGNSTALLHQRWPAARITGIDSSPAMLAEARQALP   76 (252)
T ss_pred             CCCHHHHHHH-HHHHHCHHHHH-----HHCCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCC
T ss_conf             8899999988-87764639999-----84188889998999377498999999997799879999898999999997589


Q ss_pred             C-CEEEECHHHCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHH-H-H----HC---CCC
Q ss_conf             6-23653336567754720200220247752299999999998469998899973387740345-6-5----32---766
Q gi|254780582|r   79 S-STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR-M-E----HT---PFG  148 (242)
Q Consensus        79 ~-~~~~~d~~~LPf~~~sfD~Vi~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~-~-~----~~---~~~  148 (242)
T Consensus        77 ~~~f~~~D~~~~~~-~~~~D~ifSNaalhW~~d~~~~~~~~~~~L~PGG~la~Q~p~n~~~~sh~l~~e~a~~~~~~~~~  155 (252)
T PRK01683         77 DCQFVEADIRNWQP-EQALDLIYANASLQWLPDHYELFPHLVSLLAPQGVLAVQMPDNWLEPSHVLMREVAWEQNYPDRG  155 (252)
T ss_pred             CCEEEECCHHCCCC-CCCCCEEEEEEEHHHCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             98387250420787-67878895610045078779999999982487879999889875769999999998665424013


Q ss_pred             CCCCCCHHHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             5655788899999996287621257898308
Q gi|254780582|r  149 SGQPYSWYQMISLLREANFTLSITSRSLFFP  179 (242)
Q Consensus       149 ~~r~~~~~~l~~~l~~~gf~~~~~~~~~~~p  179 (242)
T Consensus       156 ~~~~~~~~~Y~~lL~~~g~~v~~w~t~y~~~  186 (252)
T PRK01683        156 REPLLGVHAYYDLLAEAGCEVDIWRTTYYHP  186 (252)
T ss_pred             CCCCCCHHHHHHHHHHCCCEEEEEEEEEEEE
T ss_conf             6678998999999985787366766776544