HHsearch alignment for GI: 254780582 and conserved domain: PRK03612

>PRK03612 spermidine synthase; Provisional.
Probab=92.78  E-value=0.75  Score=24.95  Aligned_cols=133  Identities=12%  Similarity=-0.051  Sum_probs=72.9

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHCCC---CEEEEEECHHHHHHHHHC-------------CCCCEEEECHH-HCCCCCCCC
Q ss_conf             0489759996538811135531238---748873058999832311-------------68623653336-567754720
Q gi|254780582|r   34 DVTGCRLLGLGYAIPFFSCFHGKVE---RTLAFMPAGQGATNWPDQ-------------YFSSTALVSEG-NLPLADSSV   96 (242)
Q Consensus        34 ~~~g~~vLdiGcg~g~~~~~~~~~~---~~~~~~~~~~~~~~~~~~-------------~~~~~~~~d~~-~LPf~~~sf   96 (242)
T Consensus       291 ~~~p~~VLiiGGGdG~a~revLk~~~ve~v~lVelD~~vv~lar~~~~l~~~n~~a~~DpRv~v~~~Da~~~l~~~~~~y  370 (516)
T PRK03612        291 SPRARRVLILGGGDGLALREVLKYPDVEQVTLVDLDPAVTELARTSPALRALNGGALDDPRVTVVNDDAFNWLRKLPETF  370 (516)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCHHHHHCCCCCCCCEEEEEHHHHHHHHHCCCCC
T ss_conf             99977389983776087999864899663789951889999998572144441232349964898537899998688878


Q ss_pred             CCHHHHH--HHHHH---CCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             2002202--47752---299999999998469998899973387740345653276656557888999999962876212
Q gi|254780582|r   97 DCVLMVH--YLEFA---EDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSI  171 (242)
Q Consensus        97 D~Vi~~h--~LE~~---~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~~~~~~~~~r~~~~~~l~~~l~~~gf~~~~  171 (242)
T Consensus       371 DvIi~D~pdP~~~~~~~LYs~eFY~~~~~~L~~~G~~v~qs~Sp~~~-----------~--~~f~~i~~T~~~~~~~~~~  437 (516)
T PRK03612        371 DAIIVDLPDPSNPALGKLYSVEFYRLLKRRLAPDGLLVVQSTSPYFA-----------P--KAFWSIEATLEAAGFATTP  437 (516)
T ss_pred             CEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC-----------C--HHHHHHHHHHHHHCCCCCC
T ss_conf             88998189979952246753999999998449995899936897552-----------2--0346899999983880413


Q ss_pred             EEEEEEECCC
Q ss_conf             5789830865
Q gi|254780582|r  172 TSRSLFFPPT  181 (242)
Q Consensus       172 ~~~~~~~pp~  181 (242)
T Consensus       438 --y~~~vpsf  445 (516)
T PRK03612        438 --YHVNVPSF  445 (516)
T ss_pred             --CEECCCCC
T ss_conf             --24558886