HHsearch alignment for GI: 254780582 and conserved domain: PRK05396

>PRK05396 tdh L-threonine 3-dehydrogenase; Validated.
Probab=92.24  E-value=0.9  Score=24.49  Aligned_cols=96  Identities=16%  Similarity=0.149  Sum_probs=53.6

Q ss_pred             CCCCCEEEEECCCC-CHHHHHHHC---CCCEEEEEECHHHHHHHHHCCCCCEEEECHHHCC-----C-CCCCCCCHHHHH
Q ss_conf             04897599965388-111355312---3874887305899983231168623653336567-----7-547202002202
Q gi|254780582|r   34 DVTGCRLLGLGYAI-PFFSCFHGK---VERTLAFMPAGQGATNWPDQYFSSTALVSEGNLP-----L-ADSSVDCVLMVH  103 (242)
Q Consensus        34 ~~~g~~vLdiGcg~-g~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~LP-----f-~~~sfD~Vi~~h  103 (242)
T Consensus       161 ~~~g~~VlV~GaG~vGl~~~~~ak~~Ga~~Vi~~d~~~~kl~~a~~lGa~~~i~~~~~~~~~~~~~~t~~~G~Dvv----  236 (341)
T PRK05396        161 DLVGEDVLITGAGPIGIMAAAVAKHVGARHVVITDVNEYRLELARKMGATRAVNVAKEDLRDVMAELGMTEGFDVG----  236 (341)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEEEECCHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHCCCCCEEE----
T ss_conf             7788869998997543299999998499289999489999998986499499968850689999997489997699----


Q ss_pred             HHHHHCCHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             47752299999999998469998899973387
Q gi|254780582|r  104 YLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK  135 (242)
Q Consensus       104 ~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~  135 (242)
T Consensus       237 -id~~G~~~-~~~~~~~~l~~gG~vv~~G~~~  266 (341)
T PRK05396        237 -LEMSGAPS-AFRQMLDAMNHGGRIAMLGIPP  266 (341)
T ss_pred             -EECCCCHH-HHHHHHHHHHCCCEEEEEECCC
T ss_conf             -98789899-9999999863598999995579