HHsearch alignment for GI: 254780582 and conserved domain: PRK06922

>PRK06922 hypothetical protein; Provisional.
Probab=98.76  E-value=3.1e-08  Score=67.05  Aligned_cols=100  Identities=18%  Similarity=0.144  Sum_probs=73.8

Q ss_pred             CCCCCCCEEEEECCCCCHHHHHHHC---CCCEEEEEECHHHHHHHH-----HCCCCCEEEECHHHCC--CCCCCCCCHHH
Q ss_conf             0104897599965388111355312---387488730589998323-----1168623653336567--75472020022
Q gi|254780582|r   32 WDDVTGCRLLGLGYAIPFFSCFHGK---VERTLAFMPAGQGATNWP-----DQYFSSTALVSEGNLP--LADSSVDCVLM  101 (242)
Q Consensus        32 l~~~~g~~vLdiGcg~g~~~~~~~~---~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~d~~~LP--f~~~sfD~Vi~  101 (242)
T Consensus       416 ldyi~G~~ivdiG~GGGVMldli~E~~p~~~i~GIDiS~NVIe~L~kkK~~e~ksW~V~~gDAL~l~d~f~~eSvdTiv~  495 (679)
T PRK06922        416 LDYIKGDTIVDVGAGGGVMLDMIEEETEDKRIYGIDISENVIDTLKKKKQNEGRSWNVIKGDAINLSSSFEKESVDTIVY  495 (679)
T ss_pred             EECCCCCEEEEECCCCCHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEECCCCCCCHHHCCCCCCCEEEE
T ss_conf             20014767998669962148766765899861466660889999988777548984232143036154347566646874


Q ss_pred             HHHHHHH----C---------CHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             0247752----2---------9999999999846999889997
Q gi|254780582|r  102 VHYLEFA----E---------DPFLMLHEIWRVLTSGGRMIVV  131 (242)
Q Consensus       102 ~h~LE~~----~---------dp~~~L~Ei~RvLkPgG~lii~  131 (242)
T Consensus       496 sSIlHElfSYie~dGkkfN~~vi~~~l~Saf~vLkpGGRiIIR  538 (679)
T PRK06922        496 SSILHELFSYIEYEGKKFNHEVIKKGLQSAYEVLKPGGRIIIR  538 (679)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             2778888863456671347999999999999872888649994