HHsearch alignment for GI: 254780582 and conserved domain: PRK11207

>PRK11207 tellurite resistance protein TehB; Provisional.
Probab=99.12  E-value=5.4e-10  Score=77.11  Aligned_cols=136  Identities=16%  Similarity=0.117  Sum_probs=89.7

Q ss_pred             CCCCCCCEEEEECCCCCHHHHHHHCCC-CEEEEEECHHHHHHHHHC-----CC-CCEEEECHHHCCCCCCCCCCHHHHHH
Q ss_conf             010489759996538811135531238-748873058999832311-----68-62365333656775472020022024
Q gi|254780582|r   32 WDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMPAGQGATNWPDQ-----YF-SSTALVSEGNLPLADSSVDCVLMVHY  104 (242)
Q Consensus        32 l~~~~g~~vLdiGcg~g~~~~~~~~~~-~~~~~~~~~~~~~~~~~~-----~~-~~~~~~d~~~LPf~~~sfD~Vi~~h~  104 (242)
T Consensus        26 ~~~~~~g~~LDlgcG~Grna~~La~~G~~VtavD~s~~al~~~~~~a~~~~l~~v~~~~~Dl~~~~~~-~~yDlIlstvv  104 (198)
T PRK11207         26 VKVVKPGRTLDLGCGNGRNSLYLAANGYDVTAWDKNPMSIANLERIKAAENLDNLHTRVVDLNNLTFD-GEYDFILSTVV  104 (198)
T ss_pred             HCCCCCCCEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCC-CCCCEEEEEEE
T ss_conf             33589974777247887869999868985999979999999999999875998246562031238877-77058978645


Q ss_pred             HHHHC--CHHHHHHHHHHHCCCCCEEEEEEC-CCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             77522--999999999984699988999733-877403456532766565578889999999628762125789
Q gi|254780582|r  105 LEFAE--DPFLMLHEIWRVLTSGGRMIVVVP-NKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS  175 (242)
Q Consensus       105 LE~~~--dp~~~L~Ei~RvLkPgG~lii~~~-n~~s~w~~~~~~~~~~~r~~~~~~l~~~l~~~gf~~~~~~~~  175 (242)
T Consensus       105 ~~fl~p~~~p~iia~mq~~t~PGG~~LIV~~~dt~d----~p~-~~~fpf~f~~gEL~~yy--~~W~il~YnE~  171 (198)
T PRK11207        105 LMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTAD----YPC-TVGFPFAFKEGELRRYY--EGWEMVKYNED  171 (198)
T ss_pred             EEECCHHHHHHHHHHHHHHCCCCCEEEEEEECCHHH----CCC-CCCCCCCCCHHHHHHHH--CCCEEEEECCC
T ss_conf             210486678999999999608994899999745423----789-98977766857999872--79979984315