HHsearch alignment for GI: 254780582 and conserved domain: TIGR00138

>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far. Its mode of action is unknown, but a methytransferase fold is reported from the crystal structure. It may be a family of bacterial glucose inhibited division proteins that are involved in the regulation of cell division .; GO: 0007049 cell cycle.
Probab=95.10  E-value=0.11  Score=29.61  Aligned_cols=91  Identities=12%  Similarity=0.093  Sum_probs=56.1

Q ss_pred             CCEEEEECCCCCHHH--HH-HHCCCCEEEEEECH-------HHHHHHHHCCCCCEEEECHHHC--CCCCCCCCCHHHHHH
Q ss_conf             975999653881113--55-31238748873058-------9998323116862365333656--775472020022024
Q gi|254780582|r   37 GCRLLGLGYAIPFFS--CF-HGKVERTLAFMPAG-------QGATNWPDQYFSSTALVSEGNL--PLADSSVDCVLMVHY  104 (242)
Q Consensus        37 g~~vLdiGcg~g~~~--~~-~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~d~~~L--Pf~~~sfD~Vi~~h~  104 (242)
T Consensus        50 ~~~~~DiGSG~GfPGipL~Ci~~p~~~~~Lles~~KK~~FL~~v~~~L~L~N~~i~~~R~E~~g~~~~~~~~D~~~~RAl  129 (197)
T TIGR00138        50 GKKVIDIGSGAGFPGIPLACILRPELKLTLLESNKKKVNFLKEVKKELGLNNVEILNGRVEDLGSKQHEEQFDVITSRAL  129 (197)
T ss_pred             CCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCHHEEHHHHHCCCCCCCCCCCEEEECCC
T ss_conf             31267734789714565342205764289842774068999999998389982420011255055453335787898031


Q ss_pred             HHHHCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             775229999999999846999889997
Q gi|254780582|r  105 LEFAEDPFLMLHEIWRVLTSGGRMIVV  131 (242)
Q Consensus       105 LE~~~dp~~~L~Ei~RvLkPgG~lii~  131 (242)
T Consensus       130 ~----~l~~~~e~~~~L~~~~G~~~~~  152 (197)
T TIGR00138       130 V----SLNELLELTLPLLKVGGYFLAY  152 (197)
T ss_pred             H----HHHHHHHHHHHCCCCCCEEEEE
T ss_conf             0----2468888663037889789997