HHsearch alignment for GI: 254780582 and conserved domain: TIGR00452

>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order . Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI ), shared by other AdoMet-Mtases , is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments , although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases , , , . The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences . This is a set of proteobacterial proteins, which have homology in their central region to a large number of methyltransferases active on a variety of substrates. .
Probab=99.14  E-value=5.3e-10  Score=77.14  Aligned_cols=155  Identities=13%  Similarity=0.099  Sum_probs=104.6

Q ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHH-HHHHC-CCCEEEEEECHHHHHHHH-----HCCCCCEEE--ECHHHC-CCCCCC
Q ss_conf             99997501048975999653881113-55312-387488730589998323-----116862365--333656-775472
Q gi|254780582|r   26 KVLSTTWDDVTGCRLLGLGYAIPFFS-CFHGK-VERTLAFMPAGQGATNWP-----DQYFSSTAL--VSEGNL-PLADSS   95 (242)
Q Consensus        26 ~~l~~~l~~~~g~~vLdiGcg~g~~~-~~~~~-~~~~~~~~~~~~~~~~~~-----~~~~~~~~~--~d~~~L-Pf~~~s   95 (242)
T Consensus       111 DR~l~~~~pL~~~~i~DVGC~~GY~~~~M~~~Gak~~VG~DP~~L~~~QFE~~~~ll~~~~~~~l~~LGiE~l~~~~pnA  190 (316)
T TIGR00452       111 DRVLPHLSPLKGRTILDVGCGSGYHLWRMLGEGAKLLVGIDPTELFLCQFEAVRKLLDNDKRAILLPLGIEQLQELKPNA  190 (316)
T ss_pred             HHHCCCCCCCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHCCCCC
T ss_conf             54312466545777898336870688977620782787436578999999999987242355754036702223207641


Q ss_pred             CCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHH-----HHCCCCCCC-CCCHHHHHHHHHHCCCCC
Q ss_conf             02002202477522999999999984699988999733877403456-----532766565-578889999999628762
Q gi|254780582|r   96 VDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM-----EHTPFGSGQ-PYSWYQMISLLREANFTL  169 (242)
Q Consensus        96 fD~Vi~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~-----~~~~~~~~r-~~~~~~l~~~l~~~gf~~  169 (242)
T Consensus       191 FD~vFs~GVLYHRkSPLe~L~~L~~~L~~~GELVL~TLviD~d~~~~LvP~~~YAkMkNVYFIPSv~aL~~Wl~kvGF~~  270 (316)
T TIGR00452       191 FDTVFSLGVLYHRKSPLEHLKQLKDQLVKKGELVLETLVIDGDLNTVLVPKDRYAKMKNVYFIPSVSALKNWLEKVGFEN  270 (316)
T ss_pred             CEEEEECCHHHCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCEEECCCCCCCCEEEEEEHHHHHHHHHHHHHCCCCE
T ss_conf             20312202021155708999999999875793586534660776758647544422000142023899988887449531


Q ss_pred             EEEEEEEEECC
Q ss_conf             12578983086
Q gi|254780582|r  170 SITSRSLFFPP  180 (242)
Q Consensus       170 ~~~~~~~~~pp  180 (242)
T Consensus       271 ~~i~~V~~TT~  281 (316)
T TIGR00452       271 VRILDVLKTTL  281 (316)
T ss_pred             EEEEEEECCCH
T ss_conf             47875100372