HHsearch alignment for GI: 254780582 and conserved domain: TIGR02081

>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins. Biosynthesis of methionine from homoserine in Pseudomonas putida takes place in three steps. The first step is the acylation of homoserine to yield an acyl-L-homoserine. This reaction is catalysed by the products of the metXW genes and is equivalent to the first step in enterobacteria, Gram-positive bacteria and fungi, except that in these microorganisms the reaction is catalysed by a single polypeptide (the product of the metA gene in Escherichia coli and the met5 gene product in Neurospora crassa). In Pseudomonas putida, as in Gram-positive bacteria and certain fungi, the second and third steps are a direct sulphydrylation that converts the O-acyl-L-homoserine into homocysteine and further methylation to yield methionine. The latter reaction can be mediated by either of the two methionine synthetases present in the cells . .
Probab=99.62  E-value=2.4e-15  Score=107.66  Aligned_cols=142  Identities=21%  Similarity=0.210  Sum_probs=105.5

Q ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHHHHHHCCC--CE--------EEEEECHHHHHHHHHCCCCCEEEECHH-HC-CCCC
Q ss_conf             999975010489759996538811135531238--74--------887305899983231168623653336-56-7754
Q gi|254780582|r   26 KVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE--RT--------LAFMPAGQGATNWPDQYFSSTALVSEG-NL-PLAD   93 (242)
Q Consensus        26 ~~l~~~l~~~~g~~vLdiGcg~g~~~~~~~~~~--~~--------~~~~~~~~~~~~~~~~~~~~~~~~d~~-~L-Pf~~   93 (242)
T Consensus         5 ~~I~~~Ip--~GSRVLDLGCGdG~LL~~L~d~k~v~GPPttehRL~G~Eid~~~v~Ac-~~RGv~VIq~Dld~GL~~F~D   81 (205)
T TIGR02081         5 ELILDLIP--PGSRVLDLGCGDGELLALLRDEKQVRGPPTTEHRLYGIEIDQDGVLAC-VARGVSVIQGDLDEGLEAFPD   81 (205)
T ss_pred             HHHHHHCC--CCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCEEEEEEECHHHHHHH-HHCCCCEECCCCCCCCCCCCC
T ss_conf             88986168--887364101688789999997437898887120001023454459999-862520130060034011678


Q ss_pred             CCCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH------HCC-C-------C----CCCCCCH
Q ss_conf             72020022024775229999999999846999889997338774034565------327-6-------6----5655788
Q gi|254780582|r   94 SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME------HTP-F-------G----SGQPYSW  155 (242)
Q Consensus        94 ~sfD~Vi~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~~------~~~-~-------~----~~r~~~~  155 (242)
T Consensus        82 ~~FD~ViLsQTLQa~~Np~~iL~EmLRvg~---~aIVSFPNF-GyW~~R~~i~~~GRMPkVt~~lPY~WynTPNiHfcT~  157 (205)
T TIGR02081        82 KSFDYVILSQTLQATRNPEEILDEMLRVGR---RAIVSFPNF-GYWRVRWSILTGGRMPKVTDELPYEWYNTPNIHFCTL  157 (205)
T ss_pred             CCCCEEEECHHHHHHHCHHHHHHHHHHHCC---EEEEECCCC-CCHHCHHHEECCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             876625421356642256899988776738---515605887-7110103111078588788787888888887532337


Q ss_pred             HHHHHHHHHCCCCCEEEEE
Q ss_conf             8999999962876212578
Q gi|254780582|r  156 YQMISLLREANFTLSITSR  174 (242)
Q Consensus       156 ~~l~~~l~~~gf~~~~~~~  174 (242)
T Consensus       158 ~DF~~L~~~~~~~i~~r~~  176 (205)
T TIGR02081       158 ADFEELCEELNLRILDRAA  176 (205)
T ss_pred             HHHHHHHHHCCCEEHHHHH
T ss_conf             7899999871965137788