HHsearch alignment for GI: 254780582 and conserved domain: TIGR03534

>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific. Members of this protein family are HemK, a protein once thought to be involved in heme biosynthesis but now recognized to be a protein-glutamine methyltransferase that modifies the peptide chain release factors. All members of the seed alignment are encoded next to the release factor 1 gene (prfA) and confirmed by phylogenetic analysis. However, the family is diverse enough that even many members of the seed alignment do not score above the seed alignment, which was set high enough to exclude all instances of PrmB.
Probab=97.93  E-value=7.5e-05  Score=47.75  Aligned_cols=119  Identities=14%  Similarity=0.025  Sum_probs=71.3

Q ss_pred             CCCEEEEECCCCCHHHHHHHC---CCCEEEEEECHHHHHHHHHC---CC---CCEEEECHHHCCCCCCCCCCHHHH----
Q ss_conf             897599965388111355312---38748873058999832311---68---623653336567754720200220----
Q gi|254780582|r   36 TGCRLLGLGYAIPFFSCFHGK---VERTLAFMPAGQGATNWPDQ---YF---SSTALVSEGNLPLADSSVDCVLMV----  102 (242)
Q Consensus        36 ~g~~vLdiGcg~g~~~~~~~~---~~~~~~~~~~~~~~~~~~~~---~~---~~~~~~d~~~LPf~~~sfD~Vi~~----  102 (242)
T Consensus        87 ~~~~ilDlgtGSG~I~i~la~~~~~~~v~~~Dis~~Al~~A~~N~~~~~~~~v~~~~~d~~~-~~~~~~fDlIvsNPPYI  165 (251)
T TIGR03534        87 GPLKVLDLGTGSGAIALALAKERPDARVTAVDISPEALAVARKNAKRLGLENVRFLKSDWFE-PLPGGKFDLIVSNPPYI  165 (251)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHH-CCCCCCCCEEEECCCCC
T ss_conf             89869995567169999999967997899998987999999999998099826865131432-15689866899789988


Q ss_pred             ----------HHHHHHC------------CHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             ----------2477522------------999999999984699988999733877403456532766565578889999
Q gi|254780582|r  103 ----------HYLEFAE------------DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMIS  160 (242)
Q Consensus       103 ----------h~LE~~~------------dp~~~L~Ei~RvLkPgG~lii~~~n~~s~w~~~~~~~~~~~r~~~~~~l~~  160 (242)
T Consensus       166 ~~~e~~~l~~eV~~~EP~~AL~gg~dGl~~~~~ii~~a~~~L~~~G~l~~Eig~~------------------q~~~v~~  227 (251)
T TIGR03534       166 PEADIHLLDPEVRFHEPKLALFAGEDGLDFYRRIIAQAPRYLKPGGWLLLEIGYD------------------QGEAVRA  227 (251)
T ss_pred             CHHHHHHCCCHHCCCCHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHH------------------HHHHHHH
T ss_conf             7456663286010267299971798469999999999998536798899996837------------------8999999


Q ss_pred             HHHHCCCCCEEEE
Q ss_conf             9996287621257
Q gi|254780582|r  161 LLREANFTLSITS  173 (242)
Q Consensus       161 ~l~~~gf~~~~~~  173 (242)
T Consensus       228 l~~~~gf~~i~~~  240 (251)
T TIGR03534       228 LFEAAGFADVETR  240 (251)
T ss_pred             HHHHCCCCEEEEE
T ss_conf             9996899706885