HHsearch alignment for GI: 254780582 and conserved domain: pfam01170

>pfam01170 UPF0020 Putative RNA methylase family UPF0020. This domain is probably a methylase. It is associated with the THUMP domain that also occurs with RNA modification domains.
Probab=97.79  E-value=0.00015  Score=46.12  Aligned_cols=113  Identities=16%  Similarity=0.052  Sum_probs=71.8

Q ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHC---CCCEEEEEECHHHHHHHHHCC-------CCCEEEECHHHCCCC
Q ss_conf             9999999750104897599965388111355312---387488730589998323116-------862365333656775
Q gi|254780582|r   23 AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK---VERTLAFMPAGQGATNWPDQY-------FSSTALVSEGNLPLA   92 (242)
Q Consensus        23 ~~~~~l~~~l~~~~g~~vLdiGcg~g~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~d~~~LPf~   92 (242)
T Consensus        15 ~lAa~l~~la~~~~g~~vlDP~CGSGtilIEAa~~~~~~~~~G~Did~~~v~~A~~N~~~~g~~~~i~~~~~D~~~l~~~   94 (171)
T pfam01170        15 TLARAMVNLAGWKPGDPLLDPFCGSGTILIEAALMGANVALYGSDIDRRMVRGARINAEAAGVGDKIEFVQADAADLPLL   94 (171)
T ss_pred             HHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCHHHCCCC
T ss_conf             99999999858999997886899878999999996135895367587999999999999828998469997666538798


Q ss_pred             CCCCCCHHHH--------HHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCC
Q ss_conf             4720200220--------24775229999999999846999889997338774
Q gi|254780582|r   93 DSSVDCVLMV--------HYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG  137 (242)
Q Consensus        93 ~~sfD~Vi~~--------h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~s  137 (242)
T Consensus        95 ~~~~d~Iv~nPPYG~r~~~~~~~~~ly~~~~~~~~~~~~--g~~~~i~~~~~~  145 (171)
T pfam01170        95 NGSVDTIVTDPPYGIRIGSKGALEKLYPAFLDEAKRVLR--GRLVFATPEKKD  145 (171)
T ss_pred             CCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCC--CCEEEEEECCHH
T ss_conf             788318998898201136545699999999999998689--978999968689