HHsearch alignment for GI: 254780582 and conserved domain: pfam05148

>pfam05148 Methyltransf_8 Hypothetical methyltransferase. This family consists of several uncharacterized eukaryotic proteins which are related to methyltransferases pfam01209.
Probab=99.35  E-value=1.4e-11  Score=86.09  Aligned_cols=113  Identities=17%  Similarity=0.126  Sum_probs=90.0

Q ss_pred             CCCEEEEECCCCCHHHHHHHCCCCEEEEEECHHHHHHHHHCCCCCEEEECHHHCCCCCCCCCCHHHHHHHHHHCCHHHHH
Q ss_conf             89759996538811135531238748873058999832311686236533365677547202002202477522999999
Q gi|254780582|r   36 TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML  115 (242)
Q Consensus        36 ~g~~vLdiGcg~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~LPf~~~sfD~Vi~~h~LE~~~dp~~~L  115 (242)
T Consensus        67 ~~~vIaD~GCGdA~lA~~~~~~~kV~SfDLv---------a~n~~Vt~cDi~~~PL~d~svDvaVfCLSLMGT-N~~~fi  136 (214)
T pfam05148        67 GNGVIADLGCGEARIAFRKREFENVHSFDLV---------AVNKRVIPCDMARVPLEDESVDVAVFCLSLMGT-NIADFL  136 (214)
T ss_pred             CCEEEEECCCCHHHHHHHCCCCCEEEEEECC---------CCCCCCCCCCCCCCCCCCCCEEEEEEEHHHHCC-CHHHHH
T ss_conf             9718997588657999864678738851325---------689883513533687887726368775876288-779999


Q ss_pred             HHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             9999846999889997338774034565327665655788899999996287621257
Q gi|254780582|r  116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS  173 (242)
Q Consensus       116 ~Ei~RvLkPgG~lii~~~n~~s~w~~~~~~~~~~~r~~~~~~l~~~l~~~gf~~~~~~  173 (242)
T Consensus       137 ~EA~RvLk~~G~L~IAEV~S---------------Rf~~~~~Fv~~~~~~GF~~~~~d  179 (214)
T pfam05148       137 KEANRILKNGGLLKIAEVRS---------------RFPSVGLFERAFTKLGFEVEHVD  179 (214)
T ss_pred             HHHHHHCCCCCEEEEEEEEC---------------CCCCHHHHHHHHHHCCCEEEEEE
T ss_conf             99876031087899999740---------------16898999999997597677530