HHsearch alignment for GI: 254780582 and conserved domain: pfam10294

>pfam10294 Methyltransf_16 Putative methyltransferase.
Probab=97.99  E-value=5.5e-05  Score=48.51  Aligned_cols=103  Identities=13%  Similarity=0.142  Sum_probs=64.2

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHCC--CCEEEEEECHHHHHHHH---HCC--CCCEEEECHHHC-------CCCCCCCCCH
Q ss_conf             048975999653881113553123--87488730589998323---116--862365333656-------7754720200
Q gi|254780582|r   34 DVTGCRLLGLGYAIPFFSCFHGKV--ERTLAFMPAGQGATNWP---DQY--FSSTALVSEGNL-------PLADSSVDCV   99 (242)
Q Consensus        34 ~~~g~~vLdiGcg~g~~~~~~~~~--~~~~~~~~~~~~~~~~~---~~~--~~~~~~~d~~~L-------Pf~~~sfD~V   99 (242)
T Consensus        42 ~~~~k~VLELGaG~GL~Gi~~a~~~~~~~V~lTD~~~~l~~l~~Nv~~N~~~~~~v~~~~LdWg~~~~~~~~~~~~fD~I  121 (171)
T pfam10294        42 NLSGKNVLELGSGCGLVGIAVALLLPGASVTITDLEEAIELMKKNIELNKALSSKVTAKVLDWGEELPDDVFDPHPVDLI  121 (171)
T ss_pred             HCCCCEEEEECCCCCHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHCCCCCCCEE
T ss_conf             40687678705665758999998579858996383789999999999705789966999811089884333146776789


Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             2202477522999999999984699988999733877
Q gi|254780582|r  100 LMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR  136 (242)
Q Consensus       100 i~~h~LE~~~dp~~~L~Ei~RvLkPgG~lii~~~n~~  136 (242)
T Consensus       122 l~sD~iY~~~~~~~L~~ti~~ll~~~g~~lla~~~R~  158 (171)
T pfam10294       122 LAADCVYNEDAFPLLVKTLKDLLGKETVILVAYKKRR  158 (171)
T ss_pred             EEECEEECHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             9712133577799999999999589989999978206