BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780582|ref|YP_003064995.1| Methyltransferase type 11
[Candidatus Liberibacter asiaticus str. psy62]
         (242 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780582|ref|YP_003064995.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040259|gb|ACT57055.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 242

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT
Sbjct: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR
Sbjct: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP
Sbjct: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV
Sbjct: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240

Query: 241 ST 242
           ST
Sbjct: 241 ST 242


>gi|315121774|ref|YP_004062263.1| Methyltransferase type 11 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495176|gb|ADR51775.1| Methyltransferase type 11 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 246

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/242 (79%), Positives = 215/242 (88%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRVDI+ LRQFYSSFLG+   DAISKVLSTTWDD+TG RLLGLGYA+PFF CF GK E  
Sbjct: 1   MRVDIIVLRQFYSSFLGRYVRDAISKVLSTTWDDITGYRLLGLGYAVPFFPCFDGKTECN 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPAGQGATNWPDQ  SSTAL+SEG LPL DSSVDCVLM HYLEFAEDP +ML E+WR
Sbjct: 61  LAFMPAGQGATNWPDQNLSSTALISEGQLPLLDSSVDCVLMAHYLEFAEDPSVMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+SGGRMI++VPN+RG+WARME+TPFGSGQPYSW QMISLLRE+NFTLS TSR+LFFPP
Sbjct: 121 VLSSGGRMIIIVPNRRGVWARMENTPFGSGQPYSWTQMISLLRESNFTLSSTSRALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T+K CILKLWS+FEKIGNIF PGFAGIY IEARKILY+G+PI ES KK+IS P+LVP  +
Sbjct: 181 TNKMCILKLWSIFEKIGNIFWPGFAGIYAIEARKILYEGIPIVESSKKNISVPVLVPQAI 240

Query: 241 ST 242
           ST
Sbjct: 241 ST 242


>gi|241206560|ref|YP_002977656.1| methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860450|gb|ACS58117.1| Methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 246

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 168/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSELGRLAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+TALV +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSTTALVFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTNLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRTILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|209551157|ref|YP_002283074.1| methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536913|gb|ACI56848.1| Methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 258

 Score =  285 bits (729), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 13  MHADIVDLRQFYHSELGRLAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 72

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST LV +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 73  FAFMPAGQGAVNWPMGSLSSTTLVFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 132

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 133 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGATAEALFFPP 192

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 193 SKLRTILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 252

Query: 241 ST 242
            T
Sbjct: 253 PT 254


>gi|116254074|ref|YP_769912.1| hypothetical protein RL4339 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258722|emb|CAK09827.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 258

 Score =  285 bits (729), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I   LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSELGRLAEQSIGMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+TALV +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSTTALVFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTNLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRTILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|222149970|ref|YP_002550927.1| hypothetical protein Avi_4035 [Agrobacterium vitis S4]
 gi|221736952|gb|ACM37915.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 253

 Score =  283 bits (724), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 170/242 (70%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VDIV+LRQFY + LG     +I+  LS+ W  +   RL+GLGY++P+   F    ERT
Sbjct: 1   MHVDIVDLRQFYHTMLGHAAEQSITMALSSLWARLPEERLVGLGYSVPYLDRFRADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+T+LV +  LPL DSS+D VLMVH LEFAE+P   L EIWR
Sbjct: 61  FAFMPAGQGAVNWPPGELSATSLVFDEELPLPDSSIDRVLMVHSLEFAENPRETLKEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   ++ +LFFPP
Sbjct: 121 VLAPGGRLVMVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASTEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + +LK+ S FE+ G +  P FAG+ V+EA+K LYQGLP+     + + +P+L P  V
Sbjct: 181 SKLRTMLKMHSAFERFGRMLSPAFAGVIVVEAQKRLYQGLPVAMRASRRVFAPVLSPQGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|227823239|ref|YP_002827211.1| putative methyltransferase [Sinorhizobium fredii NGR234]
 gi|227342240|gb|ACP26458.1| putative methyltransferase [Sinorhizobium fredii NGR234]
          Length = 254

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    A+S  LS+ W  +   RL+GLGYA+P+   F    ERT
Sbjct: 4   MHTDIVDLRQFYHSELGRMAEQAVSMALSSVWARMPEERLVGLGYAVPYLERFRADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL D+S+D VLMVH LEFAE P   + EIWR
Sbjct: 64  FAFMPAGQGAVNWPVAELSSTALVFDEELPLPDASIDRVLMVHALEFAESPRETMKEIWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   +S +LFFPP
Sbjct: 124 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASSEALFFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +K IL+L    E+ G    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 184 SRRKMILRLRHGLERFGRSVWPVFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 243

Query: 241 ST 242
            +
Sbjct: 244 PS 245


>gi|190893648|ref|YP_001980190.1| methyltransferase [Rhizobium etli CIAT 652]
 gi|218517123|ref|ZP_03513963.1| putative methyltransferase protein [Rhizobium etli 8C-3]
 gi|190698927|gb|ACE93012.1| putative methyltransferase protein [Rhizobium etli CIAT 652]
          Length = 246

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 132/242 (54%), Positives = 166/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSDLGRFAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST L+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSSTTLIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRGILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|159185822|ref|NP_356998.2| hypothetical protein Atu3613 [Agrobacterium tumefaciens str. C58]
 gi|159140956|gb|AAK89783.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 253

 Score =  281 bits (719), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR+FY S LG+    AI+  LST W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MNTDIVDLREFYHSPLGRSAEQAITMALSTLWPPLPEERLVGLGYAVPFLERFRHDTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL DSS+D VLMVH LEFAE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPAGELSSTALVFDEELPLPDSSIDRVLMVHALEFAENPRESLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   ++ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T  + +LK     E+ G    P F+G+ V+EA+K LYQGLP+T+   + +  P+L P  V
Sbjct: 181 TTSRPVLKFRRYLERTGRRLWPLFSGVIVVEAQKRLYQGLPVTQRASRRVFVPVLAPQGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|327193568|gb|EGE60458.1| putative methyltransferase protein [Rhizobium etli CNPAF512]
          Length = 246

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 166/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  L++ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSDLGRFAEQSIAMALASLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST L+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSSTTLIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRGILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|222087364|ref|YP_002545901.1| SAM-dependent methyltransferase protein [Agrobacterium radiobacter
           K84]
 gi|221724812|gb|ACM27968.1| SAM-dependent methyltransferase protein [Agrobacterium radiobacter
           K84]
          Length = 247

 Score =  278 bits (710), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 128/242 (52%), Positives = 165/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+P+   F    ERT
Sbjct: 1   MHADIVDLRQFYHSELGRLAEQSITMALSSIWARLPEERLVGLGYAVPYLDRFRADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTAL+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMDSASSTALIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ SLLRE NFT   T+ +L FPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTSLLRETNFTPGATAEALLFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + +L L   FE++G    P F+G+ ++EA+K LYQGLP+     + +  P+L P  +
Sbjct: 181 SKLRTVLSLRRAFERVGRTLWPAFSGVIIVEAQKRLYQGLPVAVRASRRVFVPVLAPRGI 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|332716403|ref|YP_004443869.1| methyltransferase [Agrobacterium sp. H13-3]
 gi|325063088|gb|ADY66778.1| methyltransferase [Agrobacterium sp. H13-3]
          Length = 253

 Score =  278 bits (710), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 132/242 (54%), Positives = 166/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR+FY S LG+    AI+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MNTDIVDLREFYHSPLGRSAEQAITMALSSLWPPLPEERLVGLGYAVPFLERFRHDTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL DSS+D VLMVH LEFAE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPAGELSSTALVFDEELPLPDSSIDRVLMVHALEFAENPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   ++ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T  + +LK     E  G    P F+G+ V+EA+K LYQGLP+T+   + +  P+L P  V
Sbjct: 181 TTSRPVLKFRRYLELTGRRLWPLFSGVIVVEAQKRLYQGLPVTQRASRRVFVPVLAPQGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|150397749|ref|YP_001328216.1| type 11 methyltransferase [Sinorhizobium medicae WSM419]
 gi|150029264|gb|ABR61381.1| Methyltransferase type 11 [Sinorhizobium medicae WSM419]
          Length = 250

 Score =  277 bits (709), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 165/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    ++S  L++ W  +   RLLGLGYA+P+   F    ERT
Sbjct: 4   MHTDIVDLRQFYHSELGRMAEQSVSAALASIWARLPEERLLGLGYAVPYLERFRADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL DSS+D VLMVH LEFAE P   + EIWR
Sbjct: 64  FAFMPAGQGAVNWPVADLSSTALVFDEELPLPDSSIDRVLMVHSLEFAESPRETMKEIWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I+VVPN+RG+WA+MEHTPFGSG+PYS  Q+ +LLRE NFT   TS +LFFPP
Sbjct: 124 VLAPGGRLIIVVPNRRGVWAQMEHTPFGSGRPYSRGQLTALLRETNFTPGATSEALFFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +K  L+L    E+ G    P F+G+ ++EA+K LYQGLP+     + +  P+L P  +
Sbjct: 184 SKRKLALRLRHGLERFGRSLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPRGI 243

Query: 241 ST 242
            +
Sbjct: 244 PS 245


>gi|15966416|ref|NP_386769.1| hypothetical protein SMc00709 [Sinorhizobium meliloti 1021]
 gi|307300547|ref|ZP_07580327.1| Methyltransferase type 11 [Sinorhizobium meliloti BL225C]
 gi|307318412|ref|ZP_07597847.1| Methyltransferase type 11 [Sinorhizobium meliloti AK83]
 gi|15075687|emb|CAC47242.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896094|gb|EFN26845.1| Methyltransferase type 11 [Sinorhizobium meliloti AK83]
 gi|306904713|gb|EFN35297.1| Methyltransferase type 11 [Sinorhizobium meliloti BL225C]
          Length = 254

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 128/242 (52%), Positives = 165/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    ++S  L++ W  +   RLLGLGYA+P+   F    ERT
Sbjct: 4   MHTDIVDLRQFYHSELGRMAEQSVSSALASIWARLPEERLLGLGYAVPYLERFRADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL D+S+D VLMVH LEFAE P   + EIWR
Sbjct: 64  FAFMPAGQGAVNWPVADLSSTALVFDEELPLPDASIDRVLMVHSLEFAESPRETMKEIWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I+VVPN+RG+WA+MEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 124 VLAPGGRLIIVVPNRRGVWAQMEHTPFGSGRPYSRGQLTALLRETNFTPGATTEALFFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +K  L+L    E+ G    P F+G+ ++EA+K LYQGLP+     + +  P+L P  V
Sbjct: 184 SKRKLALRLRHGLERFGRSLWPVFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPRGV 243

Query: 241 ST 242
            +
Sbjct: 244 PS 245


>gi|163759933|ref|ZP_02167017.1| hypothetical protein HPDFL43_16921 [Hoeflea phototrophica DFL-43]
 gi|162282891|gb|EDQ33178.1| hypothetical protein HPDFL43_16921 [Hoeflea phototrophica DFL-43]
          Length = 248

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 124/239 (51%), Positives = 169/239 (70%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY + LG     +++  LS+ W ++ G RL+GLGYA P+   F    ERT
Sbjct: 1   MHADIVDLRQFYHTRLGLLAEQSVAMALSSIWANLPGERLMGLGYAAPYLDRFRPDAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+TALV +  LPLAD+S+D VLMVH LEFAE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPAGGPSATALVFDEELPLADASLDRVLMVHSLEFAENPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++V PN+RG+WAR EHTPFG+G+PYS  Q++ LLRE+NFT    + +LFFPP
Sbjct: 121 VLAPGGRLVIVAPNRRGVWARFEHTPFGAGRPYSRGQLVRLLRESNFTPGAFAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           + +  +++L S+FE++G    P F+G+ V+EA+K LYQGLP+ +   + +  P+L P T
Sbjct: 181 SQRVVVMRLRSIFERLGRRMWPVFSGVIVVEAQKRLYQGLPVAQRASRRVFVPVLSPQT 239


>gi|110635410|ref|YP_675618.1| methyltransferase type 11 [Mesorhizobium sp. BNC1]
 gi|110286394|gb|ABG64453.1| Methyltransferase type 11 [Chelativorans sp. BNC1]
          Length = 258

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 162/241 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FY+S LGK    +I+  L++ W  +   RL+GLGYAIP+   F    ER 
Sbjct: 7   MNTDIVDLRAFYASLLGKLAERSIAMALASLWCKLPDERLVGLGYAIPWLDRFGADAERV 66

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    S+TALV E  LPLAD++VD VL+VH LE AE+P  ML E+WR
Sbjct: 67  FAFMPARQGALRWPPGRASATALVFEEELPLADAAVDRVLVVHALEHAENPRQMLIELWR 126

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WAR EHTPFG+G PYS  Q++ LLREANFT    + +L FPP
Sbjct: 127 VLAPGGRIVIVVPNRRGVWARFEHTPFGTGLPYSRSQLVELLREANFTPGAWADTLHFPP 186

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++L  V E+ G  F P FAG+ V+EA K LYQG+P    +K+ +  P+L P   
Sbjct: 187 ARRRWLMRLHQVLERTGRRFWPLFAGVLVVEAEKRLYQGIPAKARRKRRVLVPVLSPQGA 246

Query: 241 S 241
           +
Sbjct: 247 T 247


>gi|239832990|ref|ZP_04681319.1| Methyltransferase domain protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825257|gb|EEQ96825.1| Methyltransferase domain protein [Ochrobactrum intermedium LMG
           3301]
          Length = 262

 Score =  258 bits (658), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     AI   L+  WD V G RL+G+GY++P+   F    ERT
Sbjct: 4   MHPDIIELRSFYDTTLGHLAERAIRMALAGLWDRVPGERLVGMGYSLPYLDRFSADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP     +TALV +  LPL DSS+D VLMVH LE+AE+P   L E+WR
Sbjct: 64  FAFMPAGQGAVAWPSVEKPATALVFDEELPLPDSSIDRVLMVHALEYAENPTETLKEMWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 124 VLAPNGRLVIVVPNRRGLWARFEHTPFGSGRPYSRTQLTTLLREANFTVSTVSDALHFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P F+G+ V+EA+K LYQGLP+ +   + +  P+L P 
Sbjct: 184 ATRRWMMRPCLALEGMGRRLWPVFSGVLVVEAQKRLYQGLPVAQRSSRRVFVPVLAPQ 241


>gi|86359394|ref|YP_471286.1| putative SAM-dependent methyltransferase protein [Rhizobium etli
           CFN 42]
 gi|86283496|gb|ABC92559.1| putative SAM-dependent methyltransferase protein [Rhizobium etli
           CFN 42]
          Length = 221

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 118/216 (54%), Positives = 149/216 (68%)

Query: 27  VLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSE 86
            LS+ W  +   RL+GLGYA+PF   F    ERT AFMPAGQGA NWP    SST L+ +
Sbjct: 2   ALSSLWVRLPQERLVGLGYAVPFLDRFQADTERTFAFMPAGQGAVNWPMGSLSSTTLIFD 61

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
             LPL DSS+D VLMVH LEFAE P   L E+WRVL  GGR+++VVPN+RG+WARMEHTP
Sbjct: 62  EELPLPDSSIDRVLMVHSLEFAESPRETLKELWRVLAPGGRLVIVVPNRRGVWARMEHTP 121

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
           FGSG+PYS  Q+  LLRE NFT   T+ +LFFPP+  + IL+L   FE++G    P F+G
Sbjct: 122 FGSGRPYSRGQLTHLLRETNFTPGATAEALFFPPSKLRTILRLRRAFERVGRTLWPAFSG 181

Query: 207 IYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           + ++EA+K LYQGLP+     + +  P+L PH V T
Sbjct: 182 VIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGVPT 217


>gi|254713602|ref|ZP_05175413.1| Methyltransferase domain protein [Brucella ceti M644/93/1]
 gi|254716044|ref|ZP_05177855.1| Methyltransferase domain protein [Brucella ceti M13/05/1]
 gi|261217812|ref|ZP_05932093.1| methyltransferase type 11 [Brucella ceti M13/05/1]
 gi|261321340|ref|ZP_05960537.1| methyltransferase type 11 [Brucella ceti M644/93/1]
 gi|260922901|gb|EEX89469.1| methyltransferase type 11 [Brucella ceti M13/05/1]
 gi|261294030|gb|EEX97526.1| methyltransferase type 11 [Brucella ceti M644/93/1]
          Length = 259

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLIGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|225628185|ref|ZP_03786220.1| Methyltransferase domain protein [Brucella ceti str. Cudo]
 gi|225617010|gb|EEH14057.1| Methyltransferase domain protein [Brucella ceti str. Cudo]
          Length = 311

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 4   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 64  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 124 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 184 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 241


>gi|23502834|ref|NP_698961.1| hypothetical protein BR1986 [Brucella suis 1330]
 gi|62290834|ref|YP_222627.1| hypothetical protein BruAb1_1962 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700746|ref|YP_415320.1| Generic methyltransferase [Brucella melitensis biovar Abortus 2308]
 gi|161619904|ref|YP_001593791.1| ATP synthase subunits region ORF 4 [Brucella canis ATCC 23365]
 gi|189025053|ref|YP_001935821.1| Generic methyltransferase [Brucella abortus S19]
 gi|225853422|ref|YP_002733655.1| methyltransferase domain-containing protein [Brucella melitensis
           ATCC 23457]
 gi|237816348|ref|ZP_04595341.1| methyltransferase domain protein [Brucella abortus str. 2308 A]
 gi|254690124|ref|ZP_05153378.1| Methyltransferase domain protein [Brucella abortus bv. 6 str. 870]
 gi|254694614|ref|ZP_05156442.1| Methyltransferase domain protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696239|ref|ZP_05158067.1| Methyltransferase domain protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700624|ref|ZP_05162452.1| Methyltransferase domain protein [Brucella suis bv. 5 str. 513]
 gi|254704994|ref|ZP_05166822.1| Methyltransferase domain protein [Brucella suis bv. 3 str. 686]
 gi|254707489|ref|ZP_05169317.1| Methyltransferase domain protein [Brucella pinnipedialis
           M163/99/10]
 gi|254708969|ref|ZP_05170780.1| Methyltransferase domain protein [Brucella pinnipedialis B2/94]
 gi|254731157|ref|ZP_05189735.1| Methyltransferase domain protein [Brucella abortus bv. 4 str. 292]
 gi|256030496|ref|ZP_05444110.1| Methyltransferase domain protein [Brucella pinnipedialis M292/94/1]
 gi|256045587|ref|ZP_05448467.1| Methyltransferase domain protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059958|ref|ZP_05450142.1| Methyltransferase domain protein [Brucella neotomae 5K33]
 gi|256112314|ref|ZP_05453235.1| Methyltransferase domain protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158482|ref|ZP_05456380.1| Methyltransferase domain protein [Brucella ceti M490/95/1]
 gi|256253901|ref|ZP_05459437.1| Methyltransferase domain protein [Brucella ceti B1/94]
 gi|256258378|ref|ZP_05463914.1| Methyltransferase domain protein [Brucella abortus bv. 9 str. C68]
 gi|256263098|ref|ZP_05465630.1| generic methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370388|ref|YP_003107899.1| hypothetical protein BMI_I2009 [Brucella microti CCM 4915]
 gi|260546101|ref|ZP_05821841.1| generic methyltransferase [Brucella abortus NCTC 8038]
 gi|260562898|ref|ZP_05833384.1| generic methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260567532|ref|ZP_05838002.1| generic methyltransferase [Brucella suis bv. 4 str. 40]
 gi|260755663|ref|ZP_05868011.1| methyltransferase type 11 [Brucella abortus bv. 6 str. 870]
 gi|260758888|ref|ZP_05871236.1| methyltransferase type 11 [Brucella abortus bv. 4 str. 292]
 gi|260760612|ref|ZP_05872955.1| methyltransferase type 11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884688|ref|ZP_05896302.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261214938|ref|ZP_05929219.1| methyltransferase type 11 [Brucella abortus bv. 3 str. Tulya]
 gi|261221038|ref|ZP_05935319.1| methyltransferase [Brucella ceti B1/94]
 gi|261314974|ref|ZP_05954171.1| methyltransferase type 11 [Brucella pinnipedialis M163/99/10]
 gi|261316468|ref|ZP_05955665.1| methyltransferase type 11 [Brucella pinnipedialis B2/94]
 gi|261323929|ref|ZP_05963126.1| methyltransferase [Brucella neotomae 5K33]
 gi|261751133|ref|ZP_05994842.1| methyltransferase type 11 [Brucella suis bv. 5 str. 513]
 gi|261755695|ref|ZP_05999404.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
 gi|265987538|ref|ZP_06100095.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265992011|ref|ZP_06104568.1| methyltransferase type 11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993747|ref|ZP_06106304.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265996998|ref|ZP_06109555.1| methyltransferase type 11 [Brucella ceti M490/95/1]
 gi|294851223|ref|ZP_06791896.1| methyltransferase [Brucella sp. NVSL 07-0026]
 gi|297247220|ref|ZP_06930938.1| methyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|306842879|ref|ZP_07475516.1| Methyltransferase domain protein [Brucella sp. BO2]
 gi|23348859|gb|AAN30876.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196966|gb|AAX75266.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616847|emb|CAJ11943.1| Generic methyltransferase [Brucella melitensis biovar Abortus 2308]
 gi|161336715|gb|ABX63020.1| ATP synthase subunits region ORF 4 [Brucella canis ATCC 23365]
 gi|189020625|gb|ACD73347.1| Generic methyltransferase [Brucella abortus S19]
 gi|225641787|gb|ACO01701.1| Methyltransferase domain protein [Brucella melitensis ATCC 23457]
 gi|237788415|gb|EEP62630.1| methyltransferase domain protein [Brucella abortus str. 2308 A]
 gi|256000551|gb|ACU48950.1| hypothetical protein BMI_I2009 [Brucella microti CCM 4915]
 gi|260096208|gb|EEW80084.1| generic methyltransferase [Brucella abortus NCTC 8038]
 gi|260152914|gb|EEW88006.1| generic methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260157050|gb|EEW92130.1| generic methyltransferase [Brucella suis bv. 4 str. 40]
 gi|260669206|gb|EEX56146.1| methyltransferase type 11 [Brucella abortus bv. 4 str. 292]
 gi|260671044|gb|EEX57865.1| methyltransferase type 11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675771|gb|EEX62592.1| methyltransferase type 11 [Brucella abortus bv. 6 str. 870]
 gi|260874216|gb|EEX81285.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916545|gb|EEX83406.1| methyltransferase type 11 [Brucella abortus bv. 3 str. Tulya]
 gi|260919622|gb|EEX86275.1| methyltransferase [Brucella ceti B1/94]
 gi|261295691|gb|EEX99187.1| methyltransferase type 11 [Brucella pinnipedialis B2/94]
 gi|261299909|gb|EEY03406.1| methyltransferase [Brucella neotomae 5K33]
 gi|261304000|gb|EEY07497.1| methyltransferase type 11 [Brucella pinnipedialis M163/99/10]
 gi|261740886|gb|EEY28812.1| methyltransferase type 11 [Brucella suis bv. 5 str. 513]
 gi|261745448|gb|EEY33374.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
 gi|262551466|gb|EEZ07456.1| methyltransferase type 11 [Brucella ceti M490/95/1]
 gi|262764728|gb|EEZ10649.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263003077|gb|EEZ15370.1| methyltransferase type 11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092999|gb|EEZ17149.1| generic methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659735|gb|EEZ29996.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|294819812|gb|EFG36811.1| methyltransferase [Brucella sp. NVSL 07-0026]
 gi|297174389|gb|EFH33736.1| methyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|306286966|gb|EFM58483.1| Methyltransferase domain protein [Brucella sp. BO2]
 gi|326409985|gb|ADZ67050.1| Generic methyltransferase [Brucella melitensis M28]
 gi|326539702|gb|ADZ87917.1| methyltransferase domain protein [Brucella melitensis M5-90]
          Length = 259

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|260169402|ref|ZP_05756213.1| methyltransferase [Brucella sp. F5/99]
 gi|261758925|ref|ZP_06002634.1| generic methyltransferase [Brucella sp. F5/99]
 gi|261738909|gb|EEY26905.1| generic methyltransferase [Brucella sp. F5/99]
          Length = 308

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|254718037|ref|ZP_05179848.1| Methyltransferase domain protein [Brucella sp. 83/13]
 gi|265982984|ref|ZP_06095719.1| methyltransferase type 11 [Brucella sp. 83/13]
 gi|306837597|ref|ZP_07470468.1| Methyltransferase domain protein [Brucella sp. NF 2653]
 gi|264661576|gb|EEZ31837.1| methyltransferase type 11 [Brucella sp. 83/13]
 gi|306407304|gb|EFM63512.1| Methyltransferase domain protein [Brucella sp. NF 2653]
          Length = 259

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFCADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVTWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|17986365|ref|NP_538999.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|17981954|gb|AAL51263.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
          Length = 308

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|153008329|ref|YP_001369544.1| type 11 methyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151560217|gb|ABS13715.1| Methyltransferase type 11 [Ochrobactrum anthropi ATCC 49188]
          Length = 259

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     AI   L+  W  V G RL+G+GY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAIRMALAGLWGHVPGERLVGMGYSLPYLDRFSADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    ++TALV +  LPL DSS+D VLMVH LE+AE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSVEKTATALVFDEELPLPDSSIDRVLMVHALEYAENPTETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLTTLLREANFTVSTVSDALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P F+G+ V+EA+K LYQGLP+ +   + +  P+L P 
Sbjct: 181 ATRRWMMRPCLALEGMGRRLWPVFSGVLVVEAQKRLYQGLPVAQRSSRRVFVPVLAPQ 238


>gi|306843423|ref|ZP_07476024.1| Methyltransferase domain protein [Brucella sp. BO1]
 gi|306276114|gb|EFM57814.1| Methyltransferase domain protein [Brucella sp. BO1]
          Length = 259

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 159/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFCADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRKQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|163844008|ref|YP_001628412.1| ATP synthase subunits region ORF 4 [Brucella suis ATCC 23445]
 gi|163674731|gb|ABY38842.1| ATP synthase subunits region ORF 4 [Brucella suis ATCC 23445]
          Length = 259

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 158/238 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WA  EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWAHFEHTPFGSGRPYSRTQLGTLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 238


>gi|319781261|ref|YP_004140737.1| methyltransferase type 11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167149|gb|ADV10687.1| Methyltransferase type 11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 260

 Score =  244 bits (623), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 114/238 (47%), Positives = 161/238 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FYS+ LG+    +I+  LS+ W  V   RL+GLGY +P+   F    ER 
Sbjct: 1   MHSDIVDLRSFYSTTLGRFAERSITMALSSIWAAVPNERLVGLGYTLPWLERFGSDAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    ++TALV +  LPL DS +D +L+VH LE  E+P   L+EIWR
Sbjct: 61  FAFMPATQGAVVWPATGPTATALVFDEELPLVDSCIDRMLLVHSLEHVENPRETLNEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+++VVPN+RG+WAR EHTPFG+G+P+S  Q+  LLREANFT +  S +LFFPP
Sbjct: 121 VLSPAGRVVIVVPNRRGVWARFEHTPFGNGRPFSRGQLTELLREANFTPAAWSDALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           + ++ +++  +V E+ G    P F+G+ V+EA+K LYQG+P+ +   + +  P+L PH
Sbjct: 181 SRRRFMMRFHNVLERAGRRLWPIFSGVIVVEAQKRLYQGVPVAQRASRRVFVPVLSPH 238


>gi|13473060|ref|NP_104627.1| hypothetical protein mll3545 [Mesorhizobium loti MAFF303099]
 gi|14023808|dbj|BAB50413.1| mll3545 [Mesorhizobium loti MAFF303099]
          Length = 262

 Score =  244 bits (622), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 114/238 (47%), Positives = 161/238 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FYS+ LG+    +I+  LS+ W  V   RL+GLGY +P+   F    ER 
Sbjct: 1   MHSDIVDLRSFYSTTLGRFAERSITMALSSIWAAVPNERLVGLGYTLPWLERFGSDAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    ++TALV +  LPL DS +D +L+VH LE  E+P   L+EIWR
Sbjct: 61  FAFMPATQGAVVWPATGPTATALVFDEELPLVDSCIDRMLLVHSLEHVENPRETLNEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+++VVPN+RG+WAR EHTPFG+G+P+S  Q+  LLREANFT +  S +LFFPP
Sbjct: 121 VLSPAGRVVIVVPNRRGVWARFEHTPFGNGRPFSRGQLTELLREANFTPAAWSDALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           + ++ +++  +V E+ G    P F+G+ V+EA+K LYQG+P+ +   + +  P+L PH
Sbjct: 181 SRRRFMMRFHNVLERAGRRLWPIFSGVIVVEAQKRLYQGVPVAQRASRRVFVPVLSPH 238


>gi|260466657|ref|ZP_05812844.1| Methyltransferase type 11 [Mesorhizobium opportunistum WSM2075]
 gi|259029520|gb|EEW30809.1| Methyltransferase type 11 [Mesorhizobium opportunistum WSM2075]
          Length = 291

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/238 (47%), Positives = 161/238 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FYS+ LG+    +I+  LS+ W  V   RL+GLGY +P+   F    ER 
Sbjct: 33  MHSDIVDLRSFYSTTLGRFAEHSITMALSSIWATVPNERLVGLGYTLPWLERFGSDAERV 92

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    ++TALV +  LPL DS +D +L+VH LE  E+P   L+EIWR
Sbjct: 93  FAFMPATQGAVVWPTTGPTATALVFDEELPLVDSCIDRMLLVHSLEHVENPRETLNEIWR 152

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+++VVPN+RG+WAR EHTPFG+G+P+S  Q+  LLREANFT +  S +LFFPP
Sbjct: 153 VLSPAGRVVIVVPNRRGVWARFEHTPFGNGRPFSRGQLTELLREANFTPAAWSDALFFPP 212

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           + ++ +++  +V E+ G    P F+G+ V+EA+K LYQG+P+ +   + +  P+L PH
Sbjct: 213 SRRRFMMRFHNVLERAGRRLWPIFSGVIVVEAQKRLYQGVPVAQRASRRVFVPVLSPH 270


>gi|304394184|ref|ZP_07376107.1| ATP synthase subunits region ORF 4 [Ahrensia sp. R2A130]
 gi|303293624|gb|EFL88001.1| ATP synthase subunits region ORF 4 [Ahrensia sp. R2A130]
          Length = 269

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/242 (47%), Positives = 160/242 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M++DIV+LRQFY++ LG     ++   L++ W  +T  RL+GLGYA P+   F    ERT
Sbjct: 1   MQMDIVDLRQFYATPLGAMARRSVQLALTSLWKPLTSERLVGLGYATPWLDAFRADAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MPA QGA +WP     +TALV + +LPLAD+S+D +L+VH LE  E+    L EIWR
Sbjct: 61  LALMPARQGAVHWPFGEDCATALVFDEDLPLADASIDRMLLVHALEHFENVDEALSEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GG++I+VVPN+RG+WARMEHTP+GSG+P+S  Q+  LLR   FT +  S +L FPP
Sbjct: 121 VLAPGGKLIIVVPNRRGVWARMEHTPYGSGRPWSGGQLSKLLRSHMFTPTSWSDALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + KK   +     E+ G  F P FAG+ V+EA K +YQGLP+ + + + +  P+L P   
Sbjct: 181 SSKKLASRFAPTMERFGRRFVPAFAGVLVVEATKQVYQGLPVRQRQSRRVFVPVLAPQGA 240

Query: 241 ST 242
           S+
Sbjct: 241 SS 242


>gi|148559357|ref|YP_001259803.1| hypothetical protein BOV_1911 [Brucella ovis ATCC 25840]
 gi|148370614|gb|ABQ60593.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 234

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 145/212 (68%)

Query: 27  VLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSE 86
            L+  W  V G RL+GLGY++P+   F    ERT AFMPAGQGA  WP    S+TALV +
Sbjct: 2   ALAGLWSHVPGERLVGLGYSLPYLDRFGADTERTFAFMPAGQGAIAWPSAEKSTTALVFD 61

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
             LPL DSS+D VLMVH LE+AE+    L E+WRVL   GR+++VVPN+RG+WAR EHTP
Sbjct: 62  EELPLPDSSIDRVLMVHALEYAENAQETLKEMWRVLAPNGRLVIVVPNRRGVWARFEHTP 121

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
           FGSG+PYS  Q+ +LLREANFT+S  S +L FPP  ++ +++     E +G    P FAG
Sbjct: 122 FGSGRPYSRTQLATLLREANFTVSTVSNALHFPPASRRWMMRPCLALESMGRRLWPLFAG 181

Query: 207 IYVIEARKILYQGLPITESKKKHISSPILVPH 238
           + +IEA+K LYQGLP+++   + +  P+L P 
Sbjct: 182 VLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPR 213


>gi|114706739|ref|ZP_01439639.1| hypothetical protein FP2506_18024 [Fulvimarina pelagi HTCC2506]
 gi|114537687|gb|EAU40811.1| hypothetical protein FP2506_18024 [Fulvimarina pelagi HTCC2506]
          Length = 307

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 151/237 (63%), Gaps = 2/237 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            DI++LR FY S LG     AI   L+  W  ++  RL+ +GY  P+   F G  ER LA
Sbjct: 57  ADIIDLRDFYHSPLGIQAARAIGLSLAPLWKPISDERLVSIGYGTPYLDRFAGDAERALA 116

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA  WP    S TALV   NLPL D+S+D VL+ H LEFAE P   L +IWR+L
Sbjct: 117 FMPAPQGAACWPHGGPSRTALVGPENLPLGDASIDRVLVSHALEFAESPEAFLEDIWRIL 176

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
             GGR+++VVPN+RG+WAR EHTPFGSG+P+S  Q+  LLR   FT +  S +LFFPP  
Sbjct: 177 APGGRLVIVVPNRRGVWARFEHTPFGSGRPWSRGQLQRLLRATMFTPATFSEALFFPPFR 236

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT--ESKKKHISSPILVP 237
           K+ +L      E+ G    P FAG+ V++A K LY+G+P+T  E  +K IS P+LVP
Sbjct: 237 KRSLLSASLPLERFGRRAWPVFAGVVVVDAVKQLYRGVPVTTREMARKRISKPVLVP 293


>gi|218661951|ref|ZP_03517881.1| putative methyltransferase protein [Rhizobium etli IE4771]
          Length = 181

 Score =  224 bits (572), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 129/181 (71%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSDLGRFAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST L+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSSTTLIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPP 180

Query: 181 T 181
           +
Sbjct: 181 S 181


>gi|254503546|ref|ZP_05115697.1| Methyltransferase domain family [Labrenzia alexandrii DFL-11]
 gi|222439617|gb|EEE46296.1| Methyltransferase domain family [Labrenzia alexandrii DFL-11]
          Length = 255

 Score =  218 bits (555), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 150/243 (61%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR FY   LG+     I   ++  W D+ G  LLGLGYA PF   +HG  ER 
Sbjct: 1   MYLDVVHLRAFYDLPLGQLLRGLIGAPVAQMWPDIQGQSLLGLGYAGPFMRRYHGSAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           ++ MPA QGA +WP ++ +S ALV +  LP +D++ D +++VH L+   DP  ML E+WR
Sbjct: 61  ISAMPAPQGAIHWPREHANSCALVEDEALPFSDATFDRIMLVHALDHCSDPSAMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+IVVVPN+RG+WAR E +PFG G+PYS  Q+  L++   F +   S +LF PP
Sbjct: 121 VLAPGGRVIVVVPNRRGLWARSELSPFGYGRPYSGSQLKELMKNCQFNVLSDSEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           +    I +    +E +G  F P FAGI ++EA K++++ LP+   K +  +  P+ +P  
Sbjct: 181 SRAVSIQRTARTWENLGRRFWPAFAGILILEAEKLVFRSLPVDGKKSRLRVLRPVFIPDG 240

Query: 240 VST 242
            +T
Sbjct: 241 AAT 243


>gi|209883260|ref|YP_002287117.1| methyltransferase type 11 [Oligotropha carboxidovorans OM5]
 gi|209871456|gb|ACI91252.1| methyltransferase type 11 [Oligotropha carboxidovorans OM5]
          Length = 247

 Score =  215 bits (547), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 147/243 (60%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VD+++LR FYS  +G      I + +   W D  G R+LG GY  P+   F    ER 
Sbjct: 1   MTVDVIDLRGFYSQRIGTVVRRMIWRGIQNHWPDAPGQRVLGFGYPTPYLGLFRDSCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG   WP    + + LV E +LPL D+++D +L+VH LE ++DP   + EIWR
Sbjct: 61  LAFMPATQGVLKWPTARPTLSTLVDELSLPLPDAALDRILLVHALEMSDDPENFMREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++VVVPN+RG+WAR ++TPFG GQPYS  Q+I LLR+  FT    S +LF PP
Sbjct: 121 VLAPSGRLMVVVPNRRGVWARGDNTPFGHGQPYSRTQLIQLLRQTWFTPVAWSEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
             K  +L+    +EK+G+     F G+ ++EA K +Y+GLP    + + I +  P LVP 
Sbjct: 181 VDKGWMLRSAPAWEKVGSALSSPFPGVLLVEATKQVYRGLPAKRERPRLIPALEPALVPR 240

Query: 239 TVS 241
            + 
Sbjct: 241 PLQ 243


>gi|39933686|ref|NP_945962.1| type 11 methyltransferase [Rhodopseudomonas palustris CGA009]
 gi|192289043|ref|YP_001989648.1| methyltransferase type 11 [Rhodopseudomonas palustris TIE-1]
 gi|39647532|emb|CAE26053.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192282792|gb|ACE99172.1| Methyltransferase type 11 [Rhodopseudomonas palustris TIE-1]
          Length = 259

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 150/239 (62%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR+FYSS LG      I++ + + W D  G R+LG GY  P+   F  + ER 
Sbjct: 4   MTIDVVDLREFYSSRLGIVARRLINRGIQSRWPDARGDRVLGFGYPTPYLGLFRDRCERC 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + ++LV E  LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 64  IAFMPAAQGVLKWPTARSTLSSLVDEHALPLPDAAVDRILLVHALEMSDDPERLLREVWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ +VPN+RG+WAR+++TPFG G+PYS  Q+  LLR   FT +  S +LF PP
Sbjct: 124 VLAPAGRLLAIVPNRRGVWARLDNTPFGHGRPYSRSQIADLLRRTWFTPTAWSEALFVPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVP 237
             +  +L+    +E+IG      FAG++V+EA K + +  P+   + + I S  P LVP
Sbjct: 184 LGQGWLLRSAPAWERIGASTSMPFAGVHVVEATKQVVRAQPVKRERIRLIPSLEPSLVP 242


>gi|27375332|ref|NP_766861.1| hypothetical protein bll0221 [Bradyrhizobium japonicum USDA 110]
 gi|27348468|dbj|BAC45486.1| bll0221 [Bradyrhizobium japonicum USDA 110]
          Length = 246

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 149/244 (61%), Gaps = 2/244 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR+FYS  LG      I++ +   W    G R+LG+GY  P+   F    ER 
Sbjct: 1   MSIDVVDLREFYSRRLGIVARQMINRGIRERWPRAEGQRVLGIGYPTPYLGLFREDAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG   WP    +  +LV E +LPL DS+VD +L+VH LE ++DP  +L E+WR
Sbjct: 61  LAFMPAAQGVLKWPTGRPALASLVDEFSLPLPDSAVDRILLVHALEMSDDPAALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+I V+PN+RG+W R ++TPFG G+PYS  Q+  LLR+  FT +    +LF PP
Sbjct: 121 VLSPSGRVIAVIPNRRGVWTRSDNTPFGHGRPYSRSQITDLLRQTWFTPTAWGEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
                +LK   ++E+ G      FAG++++EA K +Y+ +P    + + I S  P+LVP 
Sbjct: 181 YAGGWVLKSAQMWERAGAALSLPFAGVHIVEATKQVYRAIPAKRERARLIPSLKPVLVPS 240

Query: 239 TVST 242
           +  T
Sbjct: 241 STVT 244


>gi|23016510|ref|ZP_00056265.1| COG0500: SAM-dependent methyltransferases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 253

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 141/231 (61%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V+LR FYS  LG+     I + L   W DVTG R+LGLG+A P+   F  + ER 
Sbjct: 10  MWTDVVDLRDFYSGSLGQTAQRLIRRQLRALWPDVTGQRVLGLGFATPYLRIFLAEAERV 69

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP +    T LV E +LPL D S+D +L+VH LE  E    M+ E WR
Sbjct: 70  IAAMPASQGVLPWPSEGPGLTTLVDETDLPLPDRSIDRMLLVHALESTEQVRAMMREAWR 129

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++VV PN+RG+WAR+E TPFG+G+PY+  Q+  LLR+  FT    + +LF PP
Sbjct: 130 VLADGGRLVVVAPNRRGIWARLERTPFGNGRPYTMGQLNRLLRDNMFTPVNKASALFLPP 189

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
           T  + +L+     E+IG  +   F G+ ++EA K +Y G  + E+K K  S
Sbjct: 190 TTSRMLLRSAPAVEQIGQRWFETFGGVVMVEAAKQIYAGSAVREAKGKRRS 240


>gi|83313292|ref|YP_423556.1| SAM-dependent methyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82948133|dbj|BAE52997.1| SAM-dependent methyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 240

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 141/227 (62%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V+LR FY S LG+     I + +   W DVTG R+LGLG+A P+   F  + ER +A M
Sbjct: 1   MVDLRDFYGSSLGQTAQRLIRRQVRALWPDVTGQRVLGLGFATPYLRIFLAEAERVIAAM 60

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           PA QG   WP +    T LV E +LPL D S+D +L+VH LE AE    M+ E WRVL  
Sbjct: 61  PASQGVLPWPPEGPGLTTLVDETDLPLPDRSIDRLLLVHALESAEQVRAMMREAWRVLAD 120

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           GGR++VV PN+RG+WAR+E TPFG+G+PY+  Q+  LLR+  FT    + +LF PPT  +
Sbjct: 121 GGRLMVVAPNRRGIWARLERTPFGNGRPYTMGQLNRLLRDNMFTPINKASALFLPPTTSR 180

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
            +L+  S  EKIG  +   F G+ ++EA K +Y G  + E+K K  S
Sbjct: 181 MMLRSASAVEKIGQRWFETFGGVIMVEAAKQIYAGSAVREAKGKRRS 227


>gi|154252031|ref|YP_001412855.1| type 11 methyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154155981|gb|ABS63198.1| Methyltransferase type 11 [Parvibaculum lavamentivorans DS-1]
          Length = 252

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 144/227 (63%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FY   LG+     IS+ +   W DV G  +LGLG+A P+ + F  + +R 
Sbjct: 1   MNMDVIDLRDFYGRPLGRAAQYHISRRIRQIWPDVRGLNMLGLGFATPYLAPFLSEAQRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +  MPA QG  +WP +  S T LV E  LPL D S+D VL+VH LE +E    ML +IWR
Sbjct: 61  VGLMPARQGVLHWPPEGKSLTGLVDERELPLEDESMDRVLVVHGLEASESMRGMLRQIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WAR E TPFG GQP+S  Q+  LLRE+ F+ S    +LF PP
Sbjct: 121 VLAPGGRVLIVVPNRRGLWARREATPFGHGQPFSRVQLTQLLRESMFSPSAWEVALFAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
              + +L+  S +E+ G+I  P F+G+ ++EA K +Y   P+  S+K
Sbjct: 181 FDWRPLLRSASAWERAGHILWPRFSGVIIVEATKQIYAATPLPVSRK 227


>gi|239787494|emb|CAX83964.1| SAM-dependent methyltransferase [uncultured bacterium]
          Length = 247

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 150/242 (61%), Gaps = 1/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V+LR FY   LG+     I + +   W DVTG R+ GLG+A P+   F G+ ER 
Sbjct: 1   MWTDVVDLRDFYDGSLGQVARRMIRRRIRLIWPDVTGFRMAGLGFATPYLRSFKGEAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MP+ QGA +WP+       L  E +LPL D S+D +L++H LE  E    ++ E+WR
Sbjct: 61  LAVMPSSQGALSWPEGEPGLVVLAEETDLPLPDRSIDRLLLIHALESTEQVRALMREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++VVVP++RG+WA++E TPFG+G+PY+  Q+  LLREA FT   T  +LF PP
Sbjct: 121 VLADGGRLLVVVPSRRGLWAQVERTPFGAGRPYTASQIDVLLREAMFTPIRTESALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + ++K    +EKIG  + PGFAG+ ++EA K +Y   P+  +  ++  + +    TV
Sbjct: 181 SRSRMLMKSAPAWEKIGARWFPGFAGVLLVEAAKQIYAA-PLNRALSRNQRNAVSGSRTV 239

Query: 241 ST 242
            T
Sbjct: 240 IT 241


>gi|118591319|ref|ZP_01548717.1| hypothetical protein SIAM614_26768 [Stappia aggregata IAM 12614]
 gi|118435991|gb|EAV42634.1| hypothetical protein SIAM614_26768 [Stappia aggregata IAM 12614]
          Length = 258

 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 146/243 (60%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR FY   LG+     I   +   W D+TG  LLG+GYA PF   +   V+R 
Sbjct: 1   MYLDVVHLRAFYDLPLGRLLRSLIGGPIRKMWPDLTGQALLGIGYAGPFMRPYLDTVDRA 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QGA +WP +  S++ LV + +LP  D+  D V++VH L+   DP  +L E WR
Sbjct: 61  IAAMPAPQGAVHWPRERQSASTLVEDQDLPFPDAYFDRVMLVHALDHCSDPAAVLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I VVPN+RG+WA+ E +PFG G+PYS  Q+  LL+   F ++    +LF PP
Sbjct: 121 VLAPGGRLIAVVPNRRGLWAQSELSPFGYGRPYSGSQLKDLLKSCQFNVTDDKEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           +  + IL+    +E IG    P F G+ ++EA K+++Q LP+   K +  +  P+ +P  
Sbjct: 181 SRARTILRAARTWEGIGRRIWPAFGGVLIMEAEKVVFQSLPVDGKKSRFRVLRPVFIPEG 240

Query: 240 VST 242
           V+T
Sbjct: 241 VAT 243


>gi|299132856|ref|ZP_07026051.1| Methyltransferase type 11 [Afipia sp. 1NLS2]
 gi|298592993|gb|EFI53193.1| Methyltransferase type 11 [Afipia sp. 1NLS2]
          Length = 247

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/242 (41%), Positives = 146/242 (60%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  +G      IS+ ++  W D  G R+LGLGY+ P+   F    ER 
Sbjct: 1   MTIDVIDLRGFYSQRVGAVARRLISRGITRHWPDAEGQRVLGLGYSTPYLGLFRDNCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QG   WP    + + LV E +LPL D++VD +L+VH LE ++DP   + E+WR
Sbjct: 61  FAFMPAAQGVLKWPTARPTLSTLVDEFSLPLPDAAVDRILLVHALEMSDDPDSFMREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++V+PN+RG+WAR ++TPFG GQPYS  Q+  LLR   FT    S +LF PP
Sbjct: 121 VLAPSGRIMMVIPNRRGVWARGDNTPFGHGQPYSRSQITQLLRRTWFTPIAWSEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
                +L+    +EK+G      F G+ ++EA K +Y+G+P    + + I S  P LVP 
Sbjct: 181 IDSGWMLRSAMAWEKMGAALSSPFPGVLLVEATKQVYRGIPAKRERTRLIPSLEPALVPR 240

Query: 239 TV 240
            +
Sbjct: 241 PL 242


>gi|91974576|ref|YP_567235.1| methyltransferase type 11 [Rhodopseudomonas palustris BisB5]
 gi|91681032|gb|ABE37334.1| Methyltransferase type 11 [Rhodopseudomonas palustris BisB5]
          Length = 254

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 145/242 (59%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR FYS+ LG      I++ + T W D  G R+LGLGY  P+   F    ER 
Sbjct: 1   MTIDVVNLRDFYSNRLGLVARRLINRGIQTRWPDARGQRVLGLGYPTPYLGLFRDDCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + + LV E  LPL D++VD +L+VH LE +EDP  +L E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLVHSLEMSEDPDALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ VVPN+RG+WAR ++TPFG G+PYS  Q+  LLR   FT    S +LF PP
Sbjct: 121 VLAPSGRLLAVVPNRRGVWARSDNTPFGHGRPYSRSQISDLLRRTWFTPVGWSEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +  +L+    +E++G      FAG++V+EA K + +  PI   +++    P L P  V
Sbjct: 181 LEQSWLLRSAPAWERVGAAASLPFAGVHVVEATKQVVR--PIQAKRERTRLIPALGPSLV 238

Query: 241 ST 242
            +
Sbjct: 239 PS 240


>gi|86747197|ref|YP_483693.1| methyltransferase type 11 [Rhodopseudomonas palustris HaA2]
 gi|86570225|gb|ABD04782.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 145/239 (60%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR+FYS+ LG      I++ + T W D  G R+LGLGY  P+   F    ER 
Sbjct: 1   MTMDVVNLREFYSNRLGVVARRLINRGIQTRWPDARGQRVLGLGYPTPYLGLFRHNCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + + LV E  LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLVHSLEMSDDPDALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ VVPN+RG+WAR+++TPFG G+PYS  Q+  LLR   FT    S +LF PP
Sbjct: 121 VLAPSGRLLAVVPNRRGVWARIDNTPFGHGRPYSRSQISDLLRRTWFTPIGWSEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVP 237
             +  +L+    +E+IG       AG++V+EA K + + +     + + I S  P LVP
Sbjct: 181 LEQAWLLRWAPAWERIGAAISLPLAGVHVVEATKQVVRPIQAKRERTRLIPSLEPSLVP 239


>gi|90422033|ref|YP_530403.1| methyltransferase type 11 [Rhodopseudomonas palustris BisB18]
 gi|90104047|gb|ABD86084.1| Methyltransferase type 11 [Rhodopseudomonas palustris BisB18]
          Length = 257

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 146/239 (61%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+ ELR FYS  LG      I++ +   W D  G R+LG GY+ P+   F    ER 
Sbjct: 1   MTIDVTELRDFYSQRLGVMARRLINRGIQAHWRDARGQRVLGFGYSTPYLGLFRSDSERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + ++LV E +LPL D++VD +L+VH LE ++DP  ++ E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARPTLSSLVEEHSLPLPDAAVDRILLVHALEMSDDPDGLMRELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+I +VPN+RG+WAR + TPFG G+PYS  Q+  LLR + FT +  S +LF PP
Sbjct: 121 VLAPAGRLIAIVPNRRGVWARTDTTPFGHGRPYSRTQIAQLLRRSWFTPTAWSEALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVP 237
                +L+    +E++G      FAG++++EA K + + +P+   + + I +  P ++P
Sbjct: 181 IGHNWMLRSAPAWERLGAAMSLPFAGVHIVEATKQVARAIPVRRERTRLIPALQPAMLP 239


>gi|220920491|ref|YP_002495792.1| type 11 methyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219945097|gb|ACL55489.1| Methyltransferase type 11 [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 147/237 (62%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VD+ +LR FYS  LG  T   + + +      V G R+LGLGYA+P+        ERT
Sbjct: 1   MSVDVTDLRAFYSGPLGAVTQRLVGRTVHRFLGSVAGLRVLGLGYAVPYLGPVRHAAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S++ALV    +PL +++VD V++VH +E  E P  +L E+WR
Sbjct: 61  LAFMPAMQGVVNWPATGRSASALVDPTMMPLPEAAVDRVILVHAIEAVESPAELLQEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+++VVPN+RG+WAR + TPFG GQPYS  Q+  L+RE  F+    + +L+ PP
Sbjct: 121 VLTPGGRLVLVVPNRRGLWARRDATPFGHGQPYSRSQLGRLMRETLFSPEGWAETLYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                 L+  S +E++G      FAG++V++A K L++ + +   +   + +P+LVP
Sbjct: 181 VEGWITLRTASAWERVGTSLSLPFAGLHVVDAIKQLHRPVTVQARRAARLRAPVLVP 237


>gi|296448079|ref|ZP_06889981.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b]
 gi|296254393|gb|EFH01518.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b]
          Length = 245

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 95/218 (43%), Positives = 139/218 (63%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY+S LG+     + +VL   W+D    R+LG+GYA P+   F  + +R 
Sbjct: 1   MALDVVDLRNFYASPLGQVARRLVGRVLRAQWEDHAALRVLGVGYATPYLVDFQARAQRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  +WP    S++ALV    +PL DSS+D +L+VH LE  E+P  +L EIWR
Sbjct: 61  LAFMPAAQGVVHWPPGARSASALVEASMMPLPDSSIDRILVVHALEVGENPRDILEEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++++VP++ G+WAR++ TPFG G PYS  Q+ +LL+E  F       +L+ PP
Sbjct: 121 VLAPGGRVVIIVPSRSGLWARVDTTPFGHGHPYSRGQLQALLQETLFLPVFWGEALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ 218
             +  +L+    FE+I   F    AG++V+EA K LY+
Sbjct: 181 FGRASLLRSAPAFERIAGRFSLPGAGVHVVEATKQLYR 218


>gi|323136805|ref|ZP_08071886.1| Methyltransferase type 11 [Methylocystis sp. ATCC 49242]
 gi|322398122|gb|EFY00643.1| Methyltransferase type 11 [Methylocystis sp. ATCC 49242]
          Length = 248

 Score =  204 bits (520), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 143/234 (61%), Gaps = 2/234 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+VELR FY + LG+     +S++L   W+D  G R+LG+GYA P+   F  K +R 
Sbjct: 1   MSLDVVELRAFYETALGEVARRLVSRLLRARWEDHAGLRVLGMGYATPYLGEFREKAQRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  +WP    S+TALV     PL D+S+D +L+VH LE  E P  +L E+WR
Sbjct: 61  LAFMPATQGVVHWPLDGRSATALVEASMTPLPDASIDRILLVHSLEVEEHPQDLLEEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L  GGR+++V P++ G+WAR++ TPFG G PYS  Q+ SLL+ A F       +L+ PP
Sbjct: 121 ILAPGGRVVIVAPSRTGLWARVDTTPFGHGHPYSRGQLQSLLQGAQFLPVFWGEALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
             +  +L+    FE+I   F     G++++EA K LY+  P+     + ++ P+
Sbjct: 181 FQRASLLRSAPAFERIAGRFSLPGGGVHLVEAMKQLYR--PVLRRAVRRVALPV 232


>gi|170747349|ref|YP_001753609.1| methyltransferase type 11 [Methylobacterium radiotolerans JCM 2831]
 gi|170653871|gb|ACB22926.1| Methyltransferase type 11 [Methylobacterium radiotolerans JCM 2831]
          Length = 244

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/224 (43%), Positives = 139/224 (62%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+  LR FY+S LG+ T   + + L      V+G R+LG+GYA P+    H   ERT
Sbjct: 1   MRLDVNGLRAFYASPLGRTTHRVVGRALHDFLGSVSGLRVLGIGYATPYLGPVHCIAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S  AL     +PL ++++D V++VH LE  E P  +L E+WR
Sbjct: 61  LAFMPASQGVVNWPSTGRSCAALADPTMMPLPEAAIDRVILVHALESVESPTELLQEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            LT GGRMI+VVPN+RG+WAR E TPFG GQPYS  Q+  L+RE  F+    + +L+ PP
Sbjct: 121 TLTPGGRMILVVPNRRGVWARREATPFGHGQPYSRSQLGRLMRETLFSPVSWAETLYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
              + +L+    +E +G      FAG++V++A K LY+ + + +
Sbjct: 181 ARSRLMLRTGPAWEWLGTGLSLPFAGLHVVDATKQLYRPVAVQQ 224


>gi|163851932|ref|YP_001639975.1| methyltransferase type 11 [Methylobacterium extorquens PA1]
 gi|163663537|gb|ABY30904.1| Methyltransferase type 11 [Methylobacterium extorquens PA1]
          Length = 244

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 147/239 (61%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 1   MRLDVTDLRAFYASPLGVVTHRVVGRTIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S TAL     LPL +++VD V++VH LE  E P  +L E+WR
Sbjct: 61  LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEAAVDRVILVHGLEAVESPSELLSEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+VVPN+ G+WAR + TPFG GQPYS  Q+  L+R+  F+    + +L+ PP
Sbjct: 121 VLTPGGRLILVVPNRTGVWARRDATPFGHGQPYSRSQLSRLMRDTLFSPEGWAETLYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVP 237
              +  L+  + +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP
Sbjct: 181 IRSRFWLRTAAAWERFGTGLAMPFAGLHVVDATKQLYRPIAVRQVRRLESRVPARVLVP 239


>gi|218530683|ref|YP_002421499.1| methyltransferase type 11 [Methylobacterium chloromethanicum CM4]
 gi|240139056|ref|YP_002963531.1| hypothetical protein MexAM1_META1p2475 [Methylobacterium extorquens
           AM1]
 gi|254561650|ref|YP_003068745.1| hypothetical protein METDI3237 [Methylobacterium extorquens DM4]
 gi|218522986|gb|ACK83571.1| Methyltransferase type 11 [Methylobacterium chloromethanicum CM4]
 gi|240009028|gb|ACS40254.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
 gi|254268928|emb|CAX24889.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 250

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 147/239 (61%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 7   MRLDVTDLRAFYASPLGVVTHRVVGRTIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 66

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S TAL     LPL +++VD V++VH LE  E P  +L E+WR
Sbjct: 67  LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEAAVDRVILVHGLEAVESPSELLSEVWR 126

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+VVPN+ G+WAR + TPFG GQPYS  Q+  L+R+  F+    + +L+ PP
Sbjct: 127 VLTPGGRLILVVPNRTGVWARRDATPFGHGQPYSRSQLSRLMRDTLFSPEGWAETLYMPP 186

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVP 237
              +  L+  + +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP
Sbjct: 187 IRSRFWLRTAAAWERFGTGLAMPFAGLHVVDATKQLYRPIAVRQVRRLESRVPARVLVP 245


>gi|217978059|ref|YP_002362206.1| methyltransferase type 11 [Methylocella silvestris BL2]
 gi|217503435|gb|ACK50844.1| methyltransferase type 11 [Methylocella silvestris BL2]
          Length = 248

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 145/230 (63%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FY+S  G      I++++   + +  G  +LG GYA P+   F  +  R 
Sbjct: 1   MSLDVIDLRSFYASPAGDLARRLIARIVRERFSNCAGYSILGAGYATPYLGVFRDEAVRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  +WP     ++ALV    +PL DSS+D V+++H LE  E P  +L EIWR
Sbjct: 61  LAFMPAQQGVIHWPAASSCASALVETTAMPLPDSSIDRVILIHGLETTEHPRELLTEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+V P++ G+WAR++ TPFG GQP+S  Q+  L+R+  F+ +  + +L+ PP
Sbjct: 121 VLTPGGRVIIVAPSRSGLWARLDRTPFGHGQPFSRSQLRDLMRDTLFSPTHWTEALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
              K +L+   +FEKIG  FG   AG+ ++EA K LY+ +P T+  ++ +
Sbjct: 181 FRHKTLLRAGVIFEKIGAFFGLPGAGVLIVEATKQLYRPVPATQRAQEAL 230


>gi|188581689|ref|YP_001925134.1| methyltransferase type 11 [Methylobacterium populi BJ001]
 gi|179345187|gb|ACB80599.1| Methyltransferase type 11 [Methylobacterium populi BJ001]
          Length = 250

 Score =  201 bits (510), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 147/239 (61%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 7   MRLDVTDLRAFYASPLGVVTHRVVGRTIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 66

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S TAL     LPL +++VD V++VH LE  E P  +L E+WR
Sbjct: 67  LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEAAVDRVILVHGLEAVESPSELLAEVWR 126

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+VVPN+ G+WAR + TPFG GQPYS  Q+  L+R+  F+    + +L+ PP
Sbjct: 127 VLTPGGRLILVVPNRTGVWARRDATPFGHGQPYSRSQLSRLMRDTLFSPEGWAETLYMPP 186

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVP 237
              +  L+  + +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP
Sbjct: 187 IRSRFWLRTAAAWERFGTGLAMPFAGLHVVDATKQLYRPVAVRQVRRLESRVPARVLVP 245


>gi|115522193|ref|YP_779104.1| methyltransferase type 11 [Rhodopseudomonas palustris BisA53]
 gi|115516140|gb|ABJ04124.1| Methyltransferase type 11 [Rhodopseudomonas palustris BisA53]
          Length = 255

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 144/239 (60%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D++ELR FYS  LG      I++ +   W    G R+LG+GY+ P+   F    ER 
Sbjct: 2   MTIDVIELRDFYSKRLGVMARRLINRGIQLHWPGAHGLRVLGMGYSTPYLGLFRKDSERC 61

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG   WP    + + LV E +LPL D++VD +L+VH LE ++DP  ++ E+WR
Sbjct: 62  LAFMPAAQGVLKWPTARPTLSTLVEECSLPLPDAAVDRILLVHALEMSDDPDGLMRELWR 121

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ +VPN+RG+WAR ++TPFG G+PYS  Q+  L+R + FT    S +LF PP
Sbjct: 122 VLAPSGRLMAIVPNRRGVWARTDNTPFGHGRPYSRSQIADLMRRSWFTPVKFSEALFLPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVP 237
                +L+    +E+ G      FAG++++EA K + + +P    +   + S  P+LVP
Sbjct: 182 VGHDWMLQTAPAWERFGAATSLPFAGVHLVEATKEVVRAIPARRERTMLVPSLQPVLVP 240


>gi|49476267|ref|YP_034308.1| hypothetical protein BH16150 [Bartonella henselae str. Houston-1]
 gi|49239075|emb|CAF28378.1| hypothetical protein BH16150 [Bartonella henselae str. Houston-1]
          Length = 244

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 147/238 (61%), Gaps = 2/238 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LGK   + +   L+  W D+TG R++G GYA+P+ S    + ++ LA
Sbjct: 1   MDIVTLKDFYASVLGKRVQETLCGQLNLCWPDLTGKRVMGFGYALPYLSALRMRAQQCLA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPAGQGA  WP     +TALV E +LPL D+S+DC+L++H LE+ E+ F  L+EIWRVL
Sbjct: 61  FMPAGQGALPWPCADKVATALVFEEDLPLPDASIDCILLIHALEYTENSFETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G++IV+VPN+ G+WAR   TPFG G+PYS  Q++ L  + +F        + + P+ 
Sbjct: 121 VPNGQLIVIVPNRSGLWARNACTPFGYGEPYSRQQIVRLFEKTHFVSGSIQEVVHYMPSS 180

Query: 183 KKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
              + + +S F E +     P F G+ + +A+K +YQGL +   + + +  P L+P  
Sbjct: 181 GS-VSRFFSFFYEPVARHLLPYFGGLLICQAQKRVYQGLLLQRRQSRRVFMPALLPQA 237


>gi|83594599|ref|YP_428351.1| hypothetical protein Rru_A3269 [Rhodospirillum rubrum ATCC 11170]
 gi|83577513|gb|ABC24064.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 264

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 94/211 (44%), Positives = 130/211 (61%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           D+++LR FY++  G+ T   I + L   W +V GCR+LGLGYA+PF   F  + ER +A 
Sbjct: 8   DVIDLRDFYATSQGQLTRRLIGRSLRALWPEVRGCRVLGLGYAVPFLQPFADEAERVVAM 67

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           MPA  GA  WP       AL  E  LPL D S+D +L++H LEFA+    +L E WRVL 
Sbjct: 68  MPAPMGAVRWPSVGPVQGALADELELPLPDRSIDRLLLIHGLEFADHAHGLLRECWRVLA 127

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
             GR++VVVPN+R  WARME +PF +GQPYS  Q+  LLR+  FT   +S +LF PP+  
Sbjct: 128 DNGRLMVVVPNRRATWARMERSPFANGQPYSEGQLTRLLRDRLFTPIASSTALFMPPSRS 187

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           + ++   S+ E+IG    P F G+ V++  K
Sbjct: 188 RMVMGSASLLEQIGCRLFPAFGGVVVVDCAK 218


>gi|75674572|ref|YP_316993.1| hypothetical protein Nwi_0374 [Nitrobacter winogradskyi Nb-255]
 gi|74419442|gb|ABA03641.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 246

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 142/237 (59%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  LG      IS+ +   W ++ G  + GLGY  P+   F  + ER 
Sbjct: 1   MAIDVIDLRDFYSQRLGVVARRLISRAIHAHWPNMKGQCVAGLGYPTPYLGLFREECERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV E +LPL D+  D +L+VH LE ++DP  +L E+WR
Sbjct: 61  IALMPAAQGVLKWPTARPALATLVDEFSLPLRDAVADRILLVHALEMSDDPESLLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GRM+V+VPN+RG+W R + TPFG GQPYS  Q+  LLR+  FT S    +LF PP
Sbjct: 121 VLSPSGRMMVIVPNRRGIWTRTDVTPFGHGQPYSRSQITQLLRQTWFTPSAWGEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            +    L+  +V+E+IG      FAG++++EA K +Y+  PI   ++     P+L P
Sbjct: 181 INGGWFLRSAAVWERIGAALSLPFAGVHLVEATKQVYR--PIAAKREHSRLIPVLQP 235


>gi|85713815|ref|ZP_01044805.1| hypothetical protein NB311A_04724 [Nitrobacter sp. Nb-311A]
 gi|85699719|gb|EAQ37586.1| hypothetical protein NB311A_04724 [Nitrobacter sp. Nb-311A]
          Length = 249

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 143/237 (60%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  LG      I++ +   W  + G  ++GLGY  P+   F  + ER 
Sbjct: 4   MAIDVIDLRDFYSQRLGIVARRLINRAIHAHWPSLEGQCVVGLGYPTPYLGLFREECERC 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +  ALV E +LPL D+  D +L+VH LE ++DP  +L E+WR
Sbjct: 64  IALMPAAQGVLKWPTARPALAALVDEFSLPLQDAVADRILLVHALEVSDDPQSLLREVWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L+  GRM+VVVPN+RG+W R + TPFG GQPYS  Q+  LLR+  FT S    +LF PP
Sbjct: 124 ILSPSGRMMVVVPNRRGIWTRTDTTPFGHGQPYSRSQITQLLRQTWFTPSAWGEALFVPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            +    L+  +V+E+IG      FAG++++EA K +Y+  P+   ++     P+L P
Sbjct: 184 INGGWFLRSAAVWERIGAALSLPFAGVHLVEATKQVYR--PLAAKREHSRLMPVLPP 238


>gi|328541841|ref|YP_004301950.1| methyltransferase domain family [polymorphum gilvum SL003B-26A1]
 gi|326411592|gb|ADZ68655.1| Methyltransferase domain family [Polymorphum gilvum SL003B-26A1]
          Length = 275

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 142/243 (58%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+ +LR FY   LG+     +   +   W  + G  +LG+GYA PF   +  + ER 
Sbjct: 1   MYLDVADLRTFYDLPLGRLLRSLVGGRIRALWPSLKGQSMLGVGYAGPFLRPYLDEAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP  QG   WP +  ++  LV E +LP +D+  +  L+VH L+ + DP  ML E+WR
Sbjct: 61  VAAMPGPQGVVAWPRERDNAAVLVDEAHLPFSDALFERALVVHALDLSGDPAAMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+IVVVPN+RG+W++ E +PFG G+PYS  Q+  LL+   F ++    +LF PP
Sbjct: 121 VLAPGGRVIVVVPNRRGLWSQSETSPFGYGRPYSRGQIQGLLKTCQFDVTANEEALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           T  + +L+    +E  G    P FAG+ ++EA K +Y+GLP+ E  +   +  P+ +P  
Sbjct: 181 TRARMVLRSARTWEAAGRRLWPAFAGLLLVEAEKRIYRGLPVEEGPRVLRVLRPVFIPEG 240

Query: 240 VST 242
            +T
Sbjct: 241 AAT 243


>gi|144897516|emb|CAM74380.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 246

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 140/225 (62%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           D+V+LR FY S LG+ T   + + L   W D  G  +LGLG+A P    F  + ER +A 
Sbjct: 13  DVVDLRDFYDSGLGQTTKRLLRRHLRQLWPDTHGLCILGLGFATPLLRPFVTEAERVIAV 72

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           MPA QG  +WP +    T L  E +LPL DSS+D ++++H LE  E    M+ E+WRVL 
Sbjct: 73  MPANQGVLHWPPEGPGLTVLADESDLPLPDSSMDRIVLMHALESTEQVRAMMREVWRVLA 132

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
            GGR++++VPN+RG+WAR+E TPFG+G+PY+  Q+  LLR+  FT    S +LF PPT+ 
Sbjct: 133 DGGRLVIIVPNRRGIWARLERTPFGNGRPYTGGQLTRLLRDNMFTPVSLSGALFMPPTNS 192

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
           + +L+     E++G  +    AGI+++EA K +Y   P   SK++
Sbjct: 193 RVLLRSAPAMEELGRRWFHTIAGIHMVEATKQIYAATPSRTSKRR 237


>gi|316932078|ref|YP_004107060.1| type 11 methyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315599792|gb|ADU42327.1| Methyltransferase type 11 [Rhodopseudomonas palustris DX-1]
          Length = 259

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 143/239 (59%), Gaps = 2/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FYSS LG      I++ +   W D  G R+LG GY  P+   F    ER 
Sbjct: 4   MMMDVVDLRGFYSSRLGIVARRLINRSIQRRWPDARGDRVLGFGYPTPYLGLFRDSSERC 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + + LV E  LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 64  IAFMPAAQGVLKWPTARPTLSTLVDEHALPLPDAAVDRILLVHALEMSDDPERLLREVWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ +VPN+RG+WAR+++TPFG G+PYS  Q+  LLR   FT +    +LF PP
Sbjct: 124 VLAPAGRLLAIVPNRRGVWARLDNTPFGHGRPYSRPQIADLLRRTWFTPTGWGEALFVPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVP 237
             +  +L+    +E++G       AG++++EA K + +   +   + + I +  P LVP
Sbjct: 184 LAQGWLLRSAPAWERVGAAASLPLAGVHMVEATKQVVRPQTVKRERTRLIPALEPSLVP 242


>gi|158421849|ref|YP_001523141.1| hypothetical protein AZC_0225 [Azorhizobium caulinodans ORS 571]
 gi|158328738|dbj|BAF86223.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 248

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 141/240 (58%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY+  LG  T   I++ +   + DVTG  +LGLGYA P+   F  + ER 
Sbjct: 1   MFLDVVDLRSFYAQPLGLVTRRLIARSIRARFPDVTGLSILGLGYATPYLGVFREEAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +  AL  E  LPL  SS+D V+ VH LE   +   +L E+WR
Sbjct: 61  IAVMPAAQGVVRWPSTAPTLAALSDELELPLPTSSMDRVIAVHLLEMTPNAADVLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ +VPN+R +WAR++ TPFG+G P+S  Q++ LLREA FT      +L+ PP
Sbjct: 121 VLAPGGRLLAIVPNRRSVWARLDTTPFGNGSPFSRGQVVRLLREALFTPVGWGEALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              K +L+    +E+ G      FAG++V+EA K LY+  P+   +      P LVP  V
Sbjct: 181 VSSKWLLRTAIAWERAGGRLSLPFAGVHVVEATKQLYRPAPVKRVRLAPALEPGLVPVAV 240


>gi|146337700|ref|YP_001202748.1| putative SAM-dependent methyltransferase [Bradyrhizobium sp.
           ORS278]
 gi|146190506|emb|CAL74505.1| conserved hypothetical protein; putative SAM-dependent
           methyltransferase [Bradyrhizobium sp. ORS278]
          Length = 268

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 143/239 (59%), Gaps = 3/239 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  LG      I++ +   W    G R+LG+GY  P+   F    ER 
Sbjct: 2   MFMDVIDLRNFYSGRLGIVARLLINRGIRARWPSAAGQRVLGVGYPTPYLGLFREDSERC 61

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    +  +LV E +LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 62  IAFMPAAQGVLKWPTARPTLASLVDEFSLPLPDAAVDRILIVHALEMSDDPAGLLREMWR 121

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GRMI+V+PN+RG+W R ++TPFG G+PYS  Q+  LLR+  FT S    +LF PP
Sbjct: 122 VLAPAGRMIIVIPNRRGIWTRSDNTPFGHGRPYSRSQITQLLRQTWFTPSAWGEALFMPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS--SPILVP 237
                 LK    +E++G      FAG++++EA K +Y+ +P    + + I    P+L P
Sbjct: 182 V-GGWFLKSAMAWERVGAALSLPFAGVHIVEATKQVYRVIPARRERIRLIPRLEPVLAP 239


>gi|148258775|ref|YP_001243360.1| hypothetical protein BBta_7608 [Bradyrhizobium sp. BTAi1]
 gi|146410948|gb|ABQ39454.1| hypothetical protein BBta_7608 [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 142/237 (59%), Gaps = 3/237 (1%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +D+++LR FYS  LG      I++ +   W    G R+LG+GY  P+   F    ER +A
Sbjct: 1   MDVIDLRNFYSGRLGIVARLLINRGIRARWPSAAGQRVLGIGYPTPYLGLFREDSERCIA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QG   WP    +  +LV E +LPL DS+VD +L+VH LE ++DP  +L E+WRVL
Sbjct: 61  FMPAAQGVLKWPTARPTLASLVDEFSLPLPDSAVDRILIVHALEMSDDPAGLLREVWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+I+V+PN+RG+W R ++TPFG G+PYS  Q+  LLR+  FT S    +LF PP  
Sbjct: 121 APSGRLIIVIPNRRGVWTRTDNTPFGHGRPYSRSQITQLLRQTWFTPSAWGEALFMPPIG 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS--SPILVP 237
               LK    +E++G      FAG++++EA K +Y+ +P    + + I    P+L P
Sbjct: 181 -GWFLKSAMAWERVGAALSLPFAGVHIVEATKQVYRVIPARRERIRLIPRLEPVLAP 236


>gi|49474785|ref|YP_032827.1| hypothetical protein BQ13050 [Bartonella quintana str. Toulouse]
 gi|49240289|emb|CAF26764.1| hypothetical protein BQ13050 [Bartonella quintana str. Toulouse]
          Length = 254

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 143/243 (58%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           + +DIV L+ FY+S LGK   + +   L+  W D+ G R++G GYA+P+ S    + ++ 
Sbjct: 9   VELDIVTLKDFYASALGKRVQETLCDKLNLCWPDLNGKRVMGFGYALPYLSTVRARAQQC 68

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP     +TALV E NLPL D+S+DC+L++H LE+ E+ F  LHEIWR
Sbjct: 69  FAFMPACQGALPWPCADKVATALVFEENLPLPDASIDCILLIHALEYTENSFETLHEIWR 128

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   G +IV+VPN+ G WAR   TPFG G+PYS  QM  L  + +F        + + P
Sbjct: 129 VLAPNGHLIVIVPNRSGFWARNGCTPFGYGEPYSRQQMARLFEKTHFISGPVQEVVHYMP 188

Query: 181 THKKCILKLWS-VFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           +    + +L+S ++E       P F G+ + +ARK +YQGL +   + + +  P L P  
Sbjct: 189 SSGY-VSRLFSFLYEPFSRYLLPYFGGLLICQARKHVYQGLLVHRRQSRRVFMPALSPQA 247

Query: 240 VST 242
             +
Sbjct: 248 CES 250


>gi|170740306|ref|YP_001768961.1| methyltransferase type 11 [Methylobacterium sp. 4-46]
 gi|168194580|gb|ACA16527.1| Methyltransferase type 11 [Methylobacterium sp. 4-46]
          Length = 248

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 135/218 (61%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VD+ +LR FY   LG      + + +      V G R+LGLGYA+P+        ERT
Sbjct: 1   MSVDVTDLRAFYGGPLGAVAQRHVGRAVHRFLGSVAGLRVLGLGYAVPYLGPVRHAAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    +++ALV    +PL +++VD V+++H +E  E P  +L E+WR
Sbjct: 61  LAFMPATQGVVNWPTTGRTASALVDPTMMPLPEAAVDRVIVIHAIEAVESPAELLQEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+++VVPN+RG+WAR + TPFG GQPYS  Q+  L+RE  F+    + +L+ PP
Sbjct: 121 VLTPGGRLVLVVPNRRGLWARRDATPFGHGQPYSRSQLSRLMRETLFSAEGWAETLYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ 218
                 L+  S +E++G      FAG++V++A K L++
Sbjct: 181 VEGWVTLRTASAWERVGTGLSLPFAGLHVVDAIKQLHR 218


>gi|121601849|ref|YP_988396.1| putative SAM-dependent methyltransferase protein [Bartonella
           bacilliformis KC583]
 gi|120614026|gb|ABM44627.1| putative SAM-dependent methyltransferase protein [Bartonella
           bacilliformis KC583]
          Length = 244

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 145/238 (60%), Gaps = 2/238 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ LR FY+S LG      + + L+  W ++   R+LG GY++P+ +  H + ++  A
Sbjct: 1   MDIITLRDFYASPLGTRVQTTLCEQLNIKWPNLDDKRVLGFGYSLPYLAALHARAQQCFA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QG T WP     +TALV E +LPL D+SVDC+L++H LE++E+    L+EIWRVL
Sbjct: 61  FMPANQGVTPWPCADKVATALVFEEDLPLPDASVDCILLIHALEYSENARETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G +IV+VPN+ G+WAR + TPFG GQPYS  Q++ L  E NF +      + + P  
Sbjct: 121 APNGHLIVIVPNRCGLWARNDRTPFGYGQPYSRQQIVRLFEETNFIVRSVQEIVHYMPFS 180

Query: 183 KKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
            + + +L+S+F E +     P F G+ + + +K +YQGL +   + + +  P+L P  
Sbjct: 181 GR-VSRLFSLFYEPLARYLFPYFGGLLMCQVQKRVYQGLFVQRRQSRRVFIPVLSPQA 237


>gi|254472290|ref|ZP_05085690.1| methyltransferase type 11 [Pseudovibrio sp. JE062]
 gi|211958573|gb|EEA93773.1| methyltransferase type 11 [Pseudovibrio sp. JE062]
          Length = 266

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 145/242 (59%), Gaps = 6/242 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+  L++FY   LG+     +   +   W ++ G  LLG+GYA P+   +  K  R 
Sbjct: 1   MYLDVTHLKEFYDLPLGRMLRVLVGSRVKMLWPEMRGQSLLGIGYAAPYLRPYLKKTNRV 60

Query: 61  LAFMPAGQGATNWPDQYF--SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
            A MPA QG   WP +    +   L+ +G LP  DS +D +L+VH LE A  P  +L E+
Sbjct: 61  FAGMPAAQGVVKWPREVEVPNKAFLMEDGQLPFPDSCIDRILLVHSLEMAGQPGALLDEV 120

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSR--SL 176
           +RVL+ GGR+IV+VPN+RG WAR E +PFG G+PYS  Q+ + L  +N  LS+ SR  +L
Sbjct: 121 YRVLSPGGRVIVIVPNRRGAWARSEVSPFGYGRPYSRPQLDNFL--SNHHLSVVSREEAL 178

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
           F PPT+ K +LK    FE++G +  P FAG+ V EA K +Y+G+P+  S    +  P+ +
Sbjct: 179 FVPPTNSKLVLKNARSFERLGAVAWPAFAGLLVTEAEKQIYRGIPLKASHVTRVLRPVFL 238

Query: 237 PH 238
           P+
Sbjct: 239 PN 240


>gi|182677427|ref|YP_001831573.1| methyltransferase type 11 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633310|gb|ACB94084.1| Methyltransferase type 11 [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 257

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 146/248 (58%), Gaps = 6/248 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY++ LG      I +V+   + +  G  +LG+GYA P+   F     R 
Sbjct: 1   MPLDVVDLRSFYTTPLGSAARRFIGQVIRQRFANCCGQSILGVGYATPYLEPFRADSLRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    SS+ALVS   +PL D+ +D VL++H LE  E P  ++ EIWR
Sbjct: 61  LAFMPAEQGVVNWPSSGLSSSALVSPTMMPLPDACIDRVLLIHALELTEHPRELMAEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +LT GGR++ V P++ G+WAR++ TPFG GQPYS  Q+  L+R   F+ +  + +L+ PP
Sbjct: 121 ILTPGGRILAVTPSRTGLWARLDTTPFGHGQPYSRGQLRDLMRVTLFSPTRWTEALYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS------PI 234
              + +L+   + E+IG       AG+ ++EA K LY+ + + ++  + I        P+
Sbjct: 181 FQSRLVLRGAPMLERIGASLSLPGAGVQIVEATKQLYRPVILRQAMPQAIPQALPGLRPV 240

Query: 235 LVPHTVST 242
           LVP    T
Sbjct: 241 LVPQAART 248


>gi|319407827|emb|CBI81480.1| putative enzyme [Bartonella sp. 1-1C]
          Length = 246

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 146/240 (60%), Gaps = 2/240 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W D+   R++GLGY +P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGMRVQMTVCDQLNVCWPDLIDKRVMGLGYTLPYLSALRKRAKQCYA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA++WP     +TALV E +LPL D+S+DC+L++H LE+ ++ +  L+EIWRVL
Sbjct: 61  FMPASQGASSWPYPDKVATALVFEEDLPLPDASIDCILLIHALEYTKNSYETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+IV+VPN+ G+WAR + TPFG G+ YS  Q++ LLRE NF        + + P+ 
Sbjct: 121 IPNGRLIVIVPNRYGLWARNDRTPFGYGKSYSRQQIVRLLRETNFITESVKEIVHYMPS- 179

Query: 183 KKCILKLWSVFEK-IGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
             CI +L+S F K + +   P F G+ +  A K +YQG  +   + + I  P L P T +
Sbjct: 180 LSCISRLFSFFYKSLASHIFPYFGGLLMCSAEKHVYQGSFVQRHQSRRIFIPTLTPQTCT 239


>gi|298293431|ref|YP_003695370.1| methyltransferase type 11 [Starkeya novella DSM 506]
 gi|296929942|gb|ADH90751.1| Methyltransferase type 11 [Starkeya novella DSM 506]
          Length = 246

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/234 (39%), Positives = 136/234 (58%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           D+V LR FY+  LG  T   + + +   +D+V G  LLG+GYA P+   F  + ER+LAF
Sbjct: 4   DVVGLRSFYAQPLGVVTRRLVGRAIRARFDNVRGLSLLGIGYATPYLGMFREECERSLAF 63

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           MP  QG T WP    +  ALV E  LPL D  +D V+ VH LE   D   +L E+WRVL 
Sbjct: 64  MPGAQGVTRWPSAAPTLAALVDETELPLRDGMIDRVIAVHLLEMTPDAEEVLREVWRVLA 123

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
            GGR++ +VP++RG+WAR E+ PFG G+P+S  Q+  LLR A FT      +L+ PP  +
Sbjct: 124 PGGRLLCIVPSRRGIWARTENNPFGHGRPFSRTQITDLLRGALFTPVGWDEALYMPPVAR 183

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
              L+    +E++G      FAG++++EA K +Y+ +      +  +  P+L P
Sbjct: 184 NWFLRSAVAWERVGATLSLPFAGVHIVEATKQVYKPVATKRRSRLRVLKPVLEP 237


>gi|307943546|ref|ZP_07658890.1| ATP synthase subunits region ORF 4 [Roseibium sp. TrichSKD4]
 gi|307773176|gb|EFO32393.1| ATP synthase subunits region ORF 4 [Roseibium sp. TrichSKD4]
          Length = 263

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 143/239 (59%), Gaps = 1/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+ +LR FY   +G+     I + +   W D+   RL+G+GYA PF   + G  ER 
Sbjct: 1   MYLDVADLRTFYELPMGQLLRGLIGQHIRNFWPDLEKQRLIGIGYAGPFMRPYLGNAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QGA  WP +  ++++LV +G LP +D++ D  +MVH L+ ++D   +L E WR
Sbjct: 61  IAAMPAQQGAVPWPREADTASSLVLDGCLPFSDAAFDRAMMVHVLDHSKDAAEVLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+IV+VPN+RG+WAR E +PFG G+PYS  Q+  L++   F +     +LF PP
Sbjct: 121 VLAPGGRVIVIVPNRRGLWARSELSPFGYGRPYSRSQLKELMQTCQFEVLRDEEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPH 238
           T    IL+  + +E IG    P F G+ ++EA K +++ +PI   K    +  P+ VP 
Sbjct: 181 TRAGYILRSATTWEAIGRKLWPAFGGLLIMEAEKKVFRPVPIDGKKNPLRVLRPVFVPD 239


>gi|319404866|emb|CBI78467.1| putative enzyme [Bartonella rochalimae ATCC BAA-1498]
          Length = 246

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 144/240 (60%), Gaps = 2/240 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W D+   R++GLGY +P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGMRMQMTVYDQLNVCWPDLIDKRVMGLGYTLPYLSALRKRAKQCCA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+S+DC+L++H LE+ E+ +  L+EIWRVL
Sbjct: 61  FMPASQGASPWPYPDKVATALVFEEDLPLPDASIDCILLIHALEYTENSYETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+IV+VPN+ G+WAR + TPFG G+ YS  Q++ LL+E NF        + + P+ 
Sbjct: 121 IPNGRLIVIVPNRYGLWARNDRTPFGYGKSYSRQQIVRLLKETNFITESVQEIVHYMPS- 179

Query: 183 KKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
             CI +L S F E + +   P F G+ +  A K +YQG  +   + + I  P L P T +
Sbjct: 180 LNCISRLCSFFYESLASHIFPYFGGLLMCSAEKHVYQGSFVQRHQSRRIFIPTLTPQTCT 239


>gi|92116088|ref|YP_575817.1| hypothetical protein Nham_0467 [Nitrobacter hamburgensis X14]
 gi|91798982|gb|ABE61357.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 246

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 142/244 (58%), Gaps = 2/244 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FY+  LG      I++ +   W  + G  ++GLGY  P+   F    ER 
Sbjct: 1   MAIDVIDLRDFYAQRLGIVARRLINRGIHAHWPSMEGQCVVGLGYPTPYLGLFREDCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    +   LV E +LPL D+  D +L+VH LE ++DP  +L E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARPALATLVDELSLPLQDAVADRILLVHALEMSDDPESLLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GRM+V+VPN+RG+W R + TPFG G+PYS  Q+  LLR+  FT S    +LF PP
Sbjct: 121 VLSPSGRMMVIVPNRRGIWTRTDATPFGYGRPYSRSQITQLLRQTWFTPSAWGEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
            +    L+  + +E++G      FAG++++EA K +Y+ +       + I +  P L P 
Sbjct: 181 INGGWFLRSAAAWERVGAALSLPFAGVHIVEATKQVYRPIAAKRQHSRLIPALPPALAPS 240

Query: 239 TVST 242
           + S 
Sbjct: 241 SCSA 244


>gi|154245961|ref|YP_001416919.1| methyltransferase type 11 [Xanthobacter autotrophicus Py2]
 gi|154160046|gb|ABS67262.1| Methyltransferase type 11 [Xanthobacter autotrophicus Py2]
          Length = 255

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 144/235 (61%), Gaps = 2/235 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY+  LG  T   + + + + +D+VT  R+LGLGYA P+   F  + ER 
Sbjct: 1   MFLDVVDLRNFYAQPLGIMTRRLLGRAIRSRFDNVTNLRVLGLGYATPYLGVFREEAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MPA QG   WP    +   L  E  LP   +S+D V+ VH LE   +   ML E+WR
Sbjct: 61  LAVMPAAQGVVRWPSAAPTLATLADETLLPFPTASMDRVVAVHALEMTPNAAEMLSEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ VVPN+RG+WAR++ TPFG+G+P+S  Q+++LLR+A FT    + +L+ PP
Sbjct: 121 VLAPGGRLLAVVPNRRGVWARIDTTPFGNGRPFSRGQVVALLRQALFTPVGWNEALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
           +  +  L+    +E++G  F   F+G+ V+EA K LY+ +P  + +   +  P L
Sbjct: 181 S--RWFLRTAVAWERVGAQFSLPFSGVLVVEATKQLYRPIPARKPRLAPVLEPAL 233


>gi|319899470|ref|YP_004159567.1| enzyme [Bartonella clarridgeiae 73]
 gi|319403438|emb|CBI77006.1| putative enzyme [Bartonella clarridgeiae 73]
          Length = 244

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 146/238 (61%), Gaps = 2/238 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W ++   R++GLGYA+P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGMRVQMTLCDQLNAFWPNLIDKRIMGLGYALPYLSVLRKRAKQCYA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+S+DCVL+VH LE+ E+    L+EIWR+L
Sbjct: 61  FMPASQGASPWPCSDKVATALVFEEDLPLPDASIDCVLLVHALEYTENSRQTLNEIWRIL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+I++VPN+ G+WAR +HTPFG G+PYS  Q++ L +E NF +      + + P+ 
Sbjct: 121 IPNGRLIIIVPNRCGLWARNDHTPFGYGEPYSRQQVVRLFQETNFIIESVQEVVHYMPSS 180

Query: 183 KKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
              + +L+S F E + +   P F G+ +  A+K +YQ L +   + + +  P L P T
Sbjct: 181 SY-VSRLFSFFYESLASHIFPYFGGLLMCSAQKRVYQDLLVHCRQSRRVFIPTLTPQT 237


>gi|312115066|ref|YP_004012662.1| methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220195|gb|ADP71563.1| Methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
          Length = 263

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/235 (42%), Positives = 134/235 (57%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+  LR FY+S LG+     I+  +   WD+V+G  ++GLGYA P+   F G+   T
Sbjct: 1   MYDDVTHLRDFYASPLGQHARRIIAHRVRARWDNVSGLDVVGLGYAAPYLRIFSGEARTT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A MP  QGA  WP +     ALVS+  LP+ D SVDCVL+VH LE  +     L EIWR
Sbjct: 61  AALMPYRQGAVQWPSEGPFRAALVSDTELPMRDKSVDCVLVVHGLEHVDARHNYLREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+I+V PN+RG WAR E TPFG G+PYS  QM  LLR+A F     +  LF PP
Sbjct: 121 VLMPHGRLILVAPNRRGAWARFESTPFGHGRPYSLRQMEDLLRDALFEPVGVTPCLFAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
              + +    + +E+ G    P FAG+ ++EA K+ Y  + ++  K    S P L
Sbjct: 181 FRARYLPFAATAWERAGAGLWPAFAGVLIVEAVKLAYAEIRVSVKKPAFASMPAL 235


>gi|163793797|ref|ZP_02187771.1| SAM-dependent methyltransferase [alpha proteobacterium BAL199]
 gi|159180908|gb|EDP65425.1| SAM-dependent methyltransferase [alpha proteobacterium BAL199]
          Length = 250

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 135/217 (62%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D VELR FY+  LG      I + L   W ++ G  LLG+GYA+P+   + G+ ER 
Sbjct: 1   MYLDAVELRDFYNGPLGVLARRMIRRRLRELWPNLRGQSLLGIGYAVPYLRLYRGEAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG  +WP +  +++ LV E  LP  D+S+D +L+VH LE  E    M+ E WR
Sbjct: 61  IAAMPAQQGVLHWPPEGPNASLLVDEAELPFEDASIDRILLVHALETTEQRAAMMAEAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ V PN+RG+WAR +HTPFG GQPY+  Q+  +LR++ FT + T  +L+ PP
Sbjct: 121 VLAGNGRLLAVAPNRRGLWARFDHTPFGHGQPYTVSQLSRVLRDSRFTPTRTVHALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
                +++  S  E++G+ +   FAG  +IEA+K +Y
Sbjct: 181 YTSGLVIRSASALEQVGHRWFTTFAGAVMIEAQKEVY 217


>gi|209967191|ref|YP_002300106.1| hypothetical protein RC1_3952 [Rhodospirillum centenum SW]
 gi|209960657|gb|ACJ01294.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 251

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 127/217 (58%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V+LR+FY   LG+     I + +   W DVTG R+LG+GYA P+   F  + ER 
Sbjct: 1   MYSDVVDLREFYEGSLGQVVRRLIRRRVRELWPDVTGQRVLGIGYATPYLRPFRDEAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MPA QG   WP +      L  E  LPL D SVD VL++H LE+ E    ML E+WR
Sbjct: 61  LAMMPASQGVVFWPQEGPGLVTLTDEAELPLPDMSVDRVLLIHGLEYTEHLRPMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I +VPN+R +WAR + TPFG+G PYS  Q+   LR   F     S +LF PP
Sbjct: 121 VLAGGGRLIAIVPNRRSIWARSDRTPFGNGSPYSSSQLKKTLRANLFVPEKESCALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
              + +L     +E+IG  +   FAG+ V+EA K +Y
Sbjct: 181 ARSRFLLAGAGAWEEIGARWFKAFAGVIVVEASKQIY 217


>gi|90420228|ref|ZP_01228136.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335562|gb|EAS49312.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 204

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 124/193 (64%), Gaps = 2/193 (1%)

Query: 47  IPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLE 106
           +P+   F    ER LAFMP  QG   WP    S TAL+   +LPL D+SVD +L+VH LE
Sbjct: 1   MPYIDRFAADAERALAFMPGAQGGQVWPAGAASLTALIGIEDLPLGDASVDRILIVHALE 60

Query: 107 FAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREAN 166
           FAE P  ML E WRVL  GGR+++V P++RG+WAR EHTPFGSG+P+S  Q+  LLR   
Sbjct: 61  FAESPETMLAEAWRVLAPGGRIVIVAPHRRGIWARFEHTPFGSGRPWSRGQLTRLLRATM 120

Query: 167 FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE-- 224
           FT +  S++L FPP  ++ +L   +  E++G    P FAG  +IEA K LY+G+P+T   
Sbjct: 121 FTPTAWSQALLFPPFRRRSMLGFATPLERVGRDLWPVFAGAVIIEATKQLYRGVPVTSMA 180

Query: 225 SKKKHISSPILVP 237
            +++    P+LVP
Sbjct: 181 RERRRAIKPVLVP 193


>gi|297172498|gb|ADI23470.1| SAM-dependent methyltransferases [uncultured nuHF1 cluster
           bacterium HF0770_35I22]
          Length = 244

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 140/238 (58%), Gaps = 2/238 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+ +L+ FY S LGK     I + +   W +++   +LGLGY IP+ + F  +  R 
Sbjct: 2   MWTDVADLKNFYDSNLGKMACSLIQRQVRHLWPNLSREHVLGLGYPIPYLAHFIEEAYRV 61

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A MPA QG   WP    +   LV+E  +P +D+++D VL+VH  EF++     L EIWR
Sbjct: 62  TAAMPASQGTIKWPLHKPNLATLVNELEMPFSDNTIDKVLLVHGAEFSQQIRPFLREIWR 121

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L S G +I+VVPN+RG+WAR EHTPFG G PYS  Q+  LL+   FT + T  ++ FPP
Sbjct: 122 ILKSSGHVIIVVPNRRGLWARFEHTPFGRGLPYSAGQLSKLLQANMFTPTNTRWAICFPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
              + IL      EKI +     FAG+ ++EA K +Y G P++ S+++   S + VPH
Sbjct: 182 VRSQLILSAAPTIEKISSSVLSNFAGVIIVEAVKQIYAGQPLSTSQQRQ--SILAVPH 237


>gi|319406351|emb|CBI79990.1| putative enzyme [Bartonella sp. AR 15-3]
          Length = 244

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 142/238 (59%), Gaps = 2/238 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W D+T  +++GLGYA+P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGIRVQTIVCDQLNIFWPDLTDKQVMGLGYALPYLSVLRKRAKQCYA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+S+DCVL+VH LE+ ++    L+EIWRVL
Sbjct: 61  FMPASQGASPWPYPDKVATALVFEEDLPLPDASIDCVLLVHALEYTKNSHETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+IV+VPN+ G+WAR +HTPFG G  YS  Q++ L +E NF        L + P+ 
Sbjct: 121 IPNGRLIVIVPNRCGLWARNDHTPFGYGVSYSRQQIVRLFKETNFITGAVQEILHYTPSL 180

Query: 183 KKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
              + +L+S F E + +   P F G+ V  A K +YQG  +   + + +  P L P  
Sbjct: 181 SY-VSRLFSFFYESLASHIFPYFGGLLVCSAEKHVYQGSFVQRRQSRRVFIPTLTPQA 237


>gi|240851351|ref|YP_002972754.1| putative methyltransferase [Bartonella grahamii as4aup]
 gi|240268474|gb|ACS52062.1| putative methyltransferase [Bartonella grahamii as4aup]
          Length = 256

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 141/240 (58%), Gaps = 2/240 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           + +DIV L+ FY+S LG      +   L+  W D+T  R++GLGYA+P+ S    + ++ 
Sbjct: 9   VELDIVTLKDFYASALGLRVQKTLCDQLNLWWPDLTDKRIMGLGYALPYLSTLRERAQQC 68

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA+ WP     +TALV E +LPL D+SVDC+L+VH LE+ E+ F  L+EIWR
Sbjct: 69  FAFMPASQGASPWPCAEQVATALVFEEDLPLPDASVDCILLVHALEYTENSFETLNEIWR 128

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   G +IV+VPN+ G WAR   TPFG G+PYS  Q+  L  + NF        + + P
Sbjct: 129 VLAPNGHLIVIVPNRSGFWARNITTPFGYGEPYSRQQITRLFEKTNFVSGPIQEIVHYMP 188

Query: 181 THKKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           +    + +L+S F E       P F G+ + +A+K +YQGL +   + + +  P L P  
Sbjct: 189 S-TGYVSRLFSFFYEPFVRYLLPYFGGLLMCQAQKRVYQGLLVQRRQSRRVFIPALSPQV 247


>gi|163869280|ref|YP_001610536.1| hypothetical protein Btr_2589 [Bartonella tribocorum CIP 105476]
 gi|161018983|emb|CAK02541.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 256

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 142/238 (59%), Gaps = 2/238 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LG      +   L+  W ++T  R++GLGY +P+ S    + ++  A
Sbjct: 11  LDIVTLKDFYASALGLRVQKTLCDQLNLWWPNLTDKRVMGLGYTLPYLSALRERTQQCFA 70

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA++WP     +TALV E +LPL D+SVDC+L+VH LE+ E+ F  L+EIWRVL
Sbjct: 71  FMPARQGASSWPCVEQVATALVFEEDLPLPDASVDCILLVHALEYTENSFETLNEIWRVL 130

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G +IV+VPN+ G WAR   TPFG G+PY+  Q+  L  + NF        + + P+ 
Sbjct: 131 APNGHLIVIVPNRSGFWARNTTTPFGYGEPYTRQQIARLFEKTNFVSEPIEEIVHYMPS- 189

Query: 183 KKCILKLWSVF-EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
              + +L+S F E   +   P F G+ + +A+K +YQG+ +   + + I  P L P T
Sbjct: 190 TGYVSRLFSFFYEPFAHHLFPYFGGLLICQAQKRVYQGVLVQRRQSRRIFIPALSPQT 247


>gi|319409424|emb|CBI83070.1| putative enzyme [Bartonella schoenbuchensis R1]
          Length = 253

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 140/239 (58%), Gaps = 4/239 (1%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LG      I   L+  W ++   R++G GYA+P+ S    + +   A
Sbjct: 1   MDIVTLKDFYASTLGLRVQTTICDQLNFYWPNLADKRVMGFGYAVPYLSVLCTRAKHCFA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA  WP     +TALV E +LPL D+S+DCVL+VH LE+ E+    L EIWRVL
Sbjct: 61  FMPASQGALPWPCADRVATALVFEEDLPLPDASIDCVLLVHALEYTENSRETLKEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           T  G +IV+VPN+ G WAR + TPFG G+PYS  Q++ L  E NF        +++ P+ 
Sbjct: 121 TPNGHLIVIVPNRSGFWARNDRTPFGYGEPYSRQQIVRLFEETNFISGPVQEIVYYTPSL 180

Query: 183 KKCILKLWSVFEK--IGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                +L+S F +  + ++F P F G+ + +A K +YQG+ I   + + +  P L P  
Sbjct: 181 NY-TARLFSFFYRPFVRHLF-PYFGGLLMCQAHKRIYQGISIQRRQSRRVFIPTLSPQA 237


>gi|167644351|ref|YP_001682014.1| type 11 methyltransferase [Caulobacter sp. K31]
 gi|167346781|gb|ABZ69516.1| Methyltransferase type 11 [Caulobacter sp. K31]
          Length = 277

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 140/239 (58%), Gaps = 5/239 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY++ LG+   + + + +   W D  G  +LGLGYA PF      K  R 
Sbjct: 1   MRRDVLDLRAFYANPLGRAAREMLGRKVEEAWGDARGLDVLGLGYATPFLEAARAKARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    ++  LV E +LP  ++  D +L VH LE A+DP  +L EIWR
Sbjct: 61  VAAMPATQGVEVWPSGGANAATLVEETSLPFPNAMFDRILAVHALEEADDPAAVLREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+P+S +Q+ +LLREA+   +  +R+L+ PP
Sbjct: 121 VMAPSGRLIVAVASRDGLWAGAESTPFGHGRPFSRHQLEALLREADLEPAGWTRALYVPP 180

Query: 181 THKKCILKLWSV-FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVP 237
           T    ++  W+  FE++G    P FAG+ ++EA K  +   P     +  + +P +L P
Sbjct: 181 T---AVMSRWAEGFEQVGARLWPRFAGLILMEAVKQTFAVKPRGSRARVRVFAPGVLAP 236


>gi|288962844|ref|YP_003453138.1| SAM-dependent methyltransferase [Azospirillum sp. B510]
 gi|288915110|dbj|BAI76594.1| SAM-dependent methyltransferase [Azospirillum sp. B510]
          Length = 273

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 138/237 (58%), Gaps = 1/237 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR+FY S LG+     I + +   W D+    +LG+GY  P+   F G+ +R 
Sbjct: 1   MYTDIVDLREFYESGLGRTAQRMIRRRIRAIWPDLHDQIVLGIGYTTPYLRPFMGEADRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG + WP +     AL  E +LP  D+++D VL+VH LE  E    M+ EIWR
Sbjct: 61  VAVMPASQGVSFWPAEGPGMVALGDEADLPFGDNTIDRVLLVHGLEGTEQLRPMMREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ VVPN+RG+WAR + TPFG G PYS  Q+  +LR+  F    T  +LF PP
Sbjct: 121 VLAGGGRVLAVVPNRRGLWARADWTPFGHGFPYSSSQLKQVLRDTMFVPERTRHALFIPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                + K    +E++G  +   FAG+ +IEA K ++ G+    + ++ +   ++VP
Sbjct: 181 LRSHFLQKTAPAWEEVGGRWFKAFAGVTMIEASKQIFAGVS-RRAAQQPVKRRLIVP 236


>gi|221233491|ref|YP_002515927.1| methyltransferase [Caulobacter crescentus NA1000]
 gi|220962663|gb|ACL94019.1| methyltransferase [Caulobacter crescentus NA1000]
          Length = 268

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 134/239 (56%), Gaps = 5/239 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY+S LG+     +++ +   W D     +LG+GYA PF      K  R 
Sbjct: 1   MRRDVLDLRAFYASPLGRVARTMLTRKVEEAWGDTRDLDVLGVGYATPFLDAARAKARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV +  LPL ++  D VL VH LE A+DP  +L EI R
Sbjct: 61  VAAMPAQQGVEVWPQGGRNQACLVEDAALPLPNALFDRVLAVHALEEADDPAALLAEIGR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+PYS  Q+ SL+REA    +  +R+L+ PP
Sbjct: 121 VMAPTGRLIVAVSSRDGVWAGAERTPFGHGRPYSRSQLESLIREAELEPAGWTRALYVPP 180

Query: 181 THKKCILKLWSV-FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVP 237
                 +  W+  FE++G    P FAG+ ++EA K  +   P     +  + +P +L+P
Sbjct: 181 L---AAMSSWAEGFEQVGATLWPRFAGVILMEAIKQTFAVKPRGHRARARVFAPGVLLP 236


>gi|16124775|ref|NP_419339.1| hypothetical protein CC_0520 [Caulobacter crescentus CB15]
 gi|13421703|gb|AAK22507.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 284

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 134/239 (56%), Gaps = 5/239 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY+S LG+     +++ +   W D     +LG+GYA PF      K  R 
Sbjct: 17  MRRDVLDLRAFYASPLGRVARTMLTRKVEEAWGDTRDLDVLGVGYATPFLDAARAKARRV 76

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV +  LPL ++  D VL VH LE A+DP  +L EI R
Sbjct: 77  VAAMPAQQGVEVWPQGGRNQACLVEDAALPLPNALFDRVLAVHALEEADDPAALLAEIGR 136

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+PYS  Q+ SL+REA    +  +R+L+ PP
Sbjct: 137 VMAPTGRLIVAVSSRDGVWAGAERTPFGHGRPYSRSQLESLIREAELEPAGWTRALYVPP 196

Query: 181 THKKCILKLWSV-FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVP 237
                 +  W+  FE++G    P FAG+ ++EA K  +   P     +  + +P +L+P
Sbjct: 197 L---AAMSSWAEGFEQVGATLWPRFAGVILMEAIKQTFAVKPRGHRARARVFAPGVLLP 252


>gi|295687842|ref|YP_003591535.1| methyltransferase type 11 [Caulobacter segnis ATCC 21756]
 gi|295429745|gb|ADG08917.1| Methyltransferase type 11 [Caulobacter segnis ATCC 21756]
          Length = 259

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 134/239 (56%), Gaps = 5/239 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY++ LG+     +++ +   W D  G  +LGLGYA PF         R 
Sbjct: 1   MRRDVLDLRAFYAAPLGRAARTMLTRKVEEAWGDTRGLDVLGLGYATPFLDAARANARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV E  LPL ++  D VL VH LE A+DP  +L EI R
Sbjct: 61  VAAMPAQQGVEVWPHGGRNQACLVEETALPLPNALFDRVLAVHALEEADDPAALLAEIGR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+PYS  Q+ SL+REA    +  +R+L+ PP
Sbjct: 121 VMAPTGRLIVAVSSRDGVWAGAEGTPFGHGRPYSRSQLESLIREAGLEPAGWTRALYVPP 180

Query: 181 THKKCILKLWSV-FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVP 237
                 +  W+  FE++G    P FAG+ ++EA K  +   P     +  + +P +L+P
Sbjct: 181 F---AAMSGWAEGFEQVGARLWPRFAGVILMEAIKQTFAVKPQGRKARARVFAPGVLLP 236


>gi|254294709|ref|YP_003060732.1| methyltransferase type 11 [Hirschia baltica ATCC 49814]
 gi|254043240|gb|ACT60035.1| methyltransferase type 11 [Hirschia baltica ATCC 49814]
          Length = 259

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 128/233 (54%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRV++  L+ FY++ LGK   + I + +   W       +L  GY   F + +     R 
Sbjct: 1   MRVEVGRLKAFYNTPLGKAAYEMILRRIEAIWPHADDLDVLSFGYGQEFLNTYAQDTRRA 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +   PA QGA  WP    SST LV E  LP AD+  D +L++H LE A++P  ++ E+WR
Sbjct: 61  ICAAPAAQGAVCWPSSSNSSTTLVEEDKLPFADAVFDRILVIHGLEDADNPDRLMRELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V     R+++V  N+ G+W++ E TPFG G+PY+  Q+  LL+ A F  +  +R+L+ PP
Sbjct: 121 VAAPEARILMVAANRSGLWSQAESTPFGHGRPYTKKQLNGLLKTAMFQPTAWTRALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
              K +      +EK G I   GF G+ ++EA K LY    I  ++++ ++ P
Sbjct: 181 VSLKLVTSAADAWEKTGEIAWKGFGGVLMVEAVKQLYIDPQIPNAQQQRVNRP 233


>gi|300024272|ref|YP_003756883.1| methyltransferase type 11 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526093|gb|ADJ24562.1| Methyltransferase type 11 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 245

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 129/235 (54%), Gaps = 2/235 (0%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +D   LR FY S LG+     +S V+   W ++ G  + G G+A PF   F  +  R   
Sbjct: 1   MDATNLRDFYRSPLGRLARRQLSLVIRKRWKNLDGLSVAGAGFASPFLGAFRTEAARLAC 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            MP  QGA  WP      + LVSE   PL D+S+D +L +H LE AE    +L E+WRVL
Sbjct: 61  LMPERQGALVWPHSGQCHSVLVSEAQWPLPDNSIDRLLAIHCLEQAERTGPLLREMWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G M++VVPN+RG+W+R++ TPFG G P+S  Q+ + L +A F       +L+FPP  
Sbjct: 121 KPSGSMLIVVPNRRGLWSRIDATPFGYGLPFSRGQLETQLTDALFAPDRWGEALYFPPLS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            + +L++    E++G+    G AG+ ++EA K +    PI+   K   +  +L P
Sbjct: 181 NRLMLRMAPTLERMGSSMSVGVAGVIIVEAHKEIMA--PISGGVKAIPAKSVLKP 233


>gi|197103901|ref|YP_002129278.1| SAM-dependent methyltransferase [Phenylobacterium zucineum HLK1]
 gi|196477321|gb|ACG76849.1| SAM-dependent methyltransferase [Phenylobacterium zucineum HLK1]
          Length = 266

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 127/237 (53%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D++ELR+FY+S LG      + + L   W D  G  +L +GY  PF   F     R 
Sbjct: 1   MRRDVLELRRFYASDLGGAARTMVQRKLVEAWGDARGLDVLAVGYGTPFVGTFRPAARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A MPA QG   WP    +   L  E  LP A++  D +L+VH +E + DP  +L E+WR
Sbjct: 61  AAAMPAQQGVEVWPAGGRNLATLTPEDALPFANALFDRILVVHAIEESADPVALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+IV V ++ GMWA  E TPFG G+PYS  Q+  LLREA    S  +R+L+ PP
Sbjct: 121 VLAPSGRVIVTVASRNGMWANTEKTPFGHGRPYSRAQLAELLREAELEPSGWTRALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                + +    FE+ G+   PGFAG+ ++EA K  +   P     K     P+L P
Sbjct: 181 VG--WMARWAEGFEQAGSRLWPGFAGLLLMEAVKQTFAVKPKGARAKAKAVRPVLAP 235


>gi|326403971|ref|YP_004284053.1| putative methyltransferase [Acidiphilium multivorum AIU301]
 gi|325050833|dbj|BAJ81171.1| putative methyltransferase [Acidiphilium multivorum AIU301]
          Length = 235

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 122/230 (53%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D   +  FY++  G  T   I   L   W +  GC +LGLGY  P+   +  +  R 
Sbjct: 1   MRLDAPSIADFYATPRGAATARLIRARLREFWPEARGCEMLGLGYPGPYLRLWRDQAARC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A +PA  GA  WP      + LV E  LP AD SVD +L++H LE AE    +L E WR
Sbjct: 61  IAAVPAQIGAAPWPVSRPGLSVLVEEDALPFADVSVDRLLLIHGLEHAETARRLLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GRMIVVVPN+   WA +E TPFG GQPYS  Q+  +L ++ F +     +LF PP
Sbjct: 121 VLRPEGRMIVVVPNRASPWAYLERTPFGHGQPYSPSQLGRMLADSLFRVERRDAALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
              + IL+   + E+ G        GI + EA K +   +P+   +++ +
Sbjct: 181 LGGRAILRAAPLVERAGRRIAAQAGGIILTEATKDVAGVIPLRAGRRRRL 230


>gi|148260772|ref|YP_001234899.1| methyltransferase type 11 [Acidiphilium cryptum JF-5]
 gi|146402453|gb|ABQ30980.1| Methyltransferase type 11 [Acidiphilium cryptum JF-5]
          Length = 235

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 122/230 (53%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D   +  FY++  G  T   I   L   W +  GC +LGLGY  P+   +  +  R 
Sbjct: 1   MRLDAPSIADFYATPRGAATARLIRARLREFWPEARGCEVLGLGYPGPYLRLWRDQAARC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A +PA  GA  WP      + LV E  LP AD SVD +L++H LE AE    +L E WR
Sbjct: 61  IAAVPAQIGAAPWPVSRPGLSVLVEEDALPFADVSVDRLLLIHGLEHAETARRLLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GRMIVVVPN+   WA +E TPFG GQPYS  Q+  +L ++ F +     +LF PP
Sbjct: 121 VLRPEGRMIVVVPNRASPWAYLERTPFGHGQPYSPSQLGRMLADSLFRVERRDAALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
              + IL+   + E+ G        GI + EA K +   +P+   +++ +
Sbjct: 181 LGGRAILRAAPLVERAGRRIAAQAGGIILTEATKDVAGVIPLRAGRRRRL 230


>gi|302381932|ref|YP_003817755.1| methyltransferase type 11 [Brevundimonas subvibrioides ATCC 15264]
 gi|302192560|gb|ADL00132.1| Methyltransferase type 11 [Brevundimonas subvibrioides ATCC 15264]
          Length = 254

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 131/242 (54%), Gaps = 4/242 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  I +LR FY    G      ++K L   W +  GC +LG+GYA P+   F G   R 
Sbjct: 1   MRRAIEDLRTFYGEPTGALVRRLLAKRLDDAWGEAIGCDVLGIGYATPWLDAFVG-ARRV 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP+GQG   WP    + T LV +  LP A  S D VL+VH LE A+DP L+L E  R
Sbjct: 60  IAAMPSGQGVELWPAAGRNRTLLVDDRRLPFAAGSFDRVLLVHALEEADDPALLLSEAVR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            L   GR+I+    + G+WAR E TPFG G+P++  Q+  L+R A    +  S++L+ PP
Sbjct: 120 ALAPTGRIILAAAARGGLWARAEATPFGHGRPFTRGQLERLVRAAGLEPTAWSQTLYVPP 179

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL-PITESKKKHISSPILVPHT 239
                +L L   FE++G    PGFAG+ ++EA +  Y  + P   +++    +  L P +
Sbjct: 180 WPP--LLGLADGFEQVGRRIAPGFAGVILLEATRQAYARIRPTGVAQRVRAEARGLQPQS 237

Query: 240 VS 241
            +
Sbjct: 238 AT 239


>gi|83859177|ref|ZP_00952698.1| hypothetical protein OA2633_12270 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852624|gb|EAP90477.1| hypothetical protein OA2633_12270 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 261

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 129/251 (51%), Gaps = 9/251 (3%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D +++ +FY +  G+   D + + +   W DV G  +LG GYA P+   F G+  RT
Sbjct: 1   MRTDALDIARFYRTPPGRAARDMVQRRILALWPDVDGLDMLGFGYAPPYLEPFRGRARRT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALV---SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
           +AFMPA QGA  WP        L     E      ++  D V++VH LE A DP  +L E
Sbjct: 61  IAFMPAAQGAVPWPAPGVGKGGLSMLGDEQRFAFKEALFDRVILVHALEEAADPARLLRE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           +WRV+   GR++V+  ++ G+W+R + TPFG G+P++  Q+  LL ++ F     SR+LF
Sbjct: 121 VWRVMAPEGRLLVIAAHRTGLWSRADSTPFGHGRPFTRSQLTGLLSDSLFEPIAWSRALF 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK---ILYQGLPITESKKKH---IS 231
            PP    C  K    FE  G    P F G+ + EA K    +  G      ++K    ++
Sbjct: 181 TPPWRFTCGPKTARAFESAGERLWPAFGGLILSEAVKHVGAVRAGGATQRVRRKALEGVT 240

Query: 232 SPILVPHTVST 242
            P L P +  T
Sbjct: 241 RPALSPRSDRT 251


>gi|296532383|ref|ZP_06895114.1| type 11 methyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296267294|gb|EFH13188.1| type 11 methyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 259

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 125/232 (53%), Gaps = 1/232 (0%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R FY+S LG      + + L+  W D++G  +LGLG+A P+   +  +  R LA      
Sbjct: 13  RDFYASPLGLVAARLLRERLARLWPDLSGRAVLGLGHAAPYLRLWREQASRILAASLPET 72

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
               WP    S TA V +  LP  D S D VL+VH LE AE+    L E+WRVL   GR+
Sbjct: 73  DTVPWPPGGASLTARVEDAALPFPDLSFDRVLLVHGLEGAENDRRALREVWRVLKDDGRV 132

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           ++V PN+RG+WA  + TPFG G+PYS  Q+  LL    FT      +LF PP   + +L+
Sbjct: 133 LIVAPNRRGLWAHRDSTPFGQGRPYSTGQLSRLLERNMFTAERRDTALFTPPFQARLLLR 192

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              ++E  G    P FAG+ ++EARK +Y  LP   ++ +     +LVP  V
Sbjct: 193 AAGLWEGAGRSLAPRFAGLVIVEARKSIYGVLPAHGARLR-PGRRVLVPEAV 243


>gi|114769422|ref|ZP_01447048.1| hypothetical protein OM2255_06810 [alpha proteobacterium HTCC2255]
 gi|114550339|gb|EAU53220.1| hypothetical protein OM2255_06810 [alpha proteobacterium HTCC2255]
          Length = 258

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 125/219 (57%), Gaps = 2/219 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++LR+FY  + LG+    A+   +   + D  G  +LG G+A P    F     R
Sbjct: 1   MHLDVIDLRKFYYRTKLGRIVQRALRDKVERLFGDTKGQTVLGYGFAAPMLRPFLKSSRR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP+   + + L  E + PLA   VD ++++H LE + +   +L EIW
Sbjct: 61  VICLMPGQQGVMPWPEGQLNRSVLTPEISWPLATGIVDKMVILHGLETSNNQNGLLEEIW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR++++VPN+ G+WAR E TPFG GQPYS  Q+ + LR   F++     ++FFP
Sbjct: 121 RVLGPGGRVLIIVPNRSGLWARSEKTPFGYGQPYSISQLETQLRIHKFSVERHMSAMFFP 180

Query: 180 PTHKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARKILY 217
           P+HK   L++    E +G     P  +G+ ++EA K +Y
Sbjct: 181 PSHKPFWLRVSKYLEGVGLKGVIPLASGVVIVEATKQIY 219


>gi|254418305|ref|ZP_05032029.1| Methyltransferase domain family [Brevundimonas sp. BAL3]
 gi|196184482|gb|EDX79458.1| Methyltransferase domain family [Brevundimonas sp. BAL3]
          Length = 249

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/242 (35%), Positives = 130/242 (53%), Gaps = 3/242 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  I ELR FY    G      +++ L   W +   C +LG+GYA P+   F G   R 
Sbjct: 1   MRRSIDELRTFYGEPTGALVRRLLARRLDDAWGEAPDCDVLGVGYATPWLDAFVG-ARRV 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP+GQG  +WP    + T LV +  LP A  S D +L+VH LE A+DP  +L E  R
Sbjct: 60  VAAMPSGQGVEHWPSVGRNRTLLVDDRRLPFAAGSFDRILLVHALEEADDPAALLLEAVR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            L   GR+I+    + G+WAR E+TPFG G+P++  Q+  L+REA    +  S++L+ PP
Sbjct: 120 ALAPTGRIILAAAARGGLWARAENTPFGHGRPFTRGQLERLVREAGLEPAAWSQTLYVPP 179

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                +L L   FE++G    P  AG+ ++EA +  Y  +  +   ++  + P L P   
Sbjct: 180 W--TPLLPLADGFEQVGRRIAPNTAGVILLEASRQAYARIRPSGLAQRVPARPALTPQPA 237

Query: 241 ST 242
           ++
Sbjct: 238 AS 239


>gi|146278241|ref|YP_001168400.1| hypothetical protein Rsph17025_2205 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556482|gb|ABP71095.1| hypothetical protein Rsph17025_2205 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 262

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 130/236 (55%), Gaps = 4/236 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++L  FY  + LG+    A+   +   W D  G  + G G+++P    +  +  R
Sbjct: 1   MHLDVLDLHSFYYRTPLGRVAQRAVRDQVQKLWPDAKGQTVAGFGFSVPLLRPYLEQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  EG+ PL+   VD ++M+H LE +E P  +L E W
Sbjct: 61  VIALMPGPQGVMPWPVGMGNVSVLCDEGSWPLSTGMVDKLVMLHGLETSEHPSEVLAEAW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG+ + +VP++ G+WAR + TPFG G+PYS+ Q+ + L+  +FT   T  +LF P
Sbjct: 121 RVLGPGGKALFIVPSRSGLWARRDGTPFGFGRPYSFNQLETQLKRHDFTPERTLAALFAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPI 234
           P H++  LK    +E  G  F P    G+ ++EA K +Y   P     K  +++P+
Sbjct: 181 PLHQRFWLKTADFWETGGRRFAPWLVGGVLIVEASKQMYA--PTRSGLKSVVTNPL 234


>gi|77462846|ref|YP_352350.1| hypothetical protein RSP_2295 [Rhodobacter sphaeroides 2.4.1]
 gi|126461739|ref|YP_001042853.1| hypothetical protein Rsph17029_0970 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638715|ref|YP_002524977.1| hypothetical protein RSKD131_0616 [Rhodobacter sphaeroides KD131]
 gi|332557737|ref|ZP_08412059.1| hypothetical protein RSWS8N_01760 [Rhodobacter sphaeroides WS8N]
 gi|77387264|gb|ABA78449.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126103403|gb|ABN76081.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221159496|gb|ACM00476.1| Hypothetical Protein RSKD131_0616 [Rhodobacter sphaeroides KD131]
 gi|332275449|gb|EGJ20764.1| hypothetical protein RSWS8N_01760 [Rhodobacter sphaeroides WS8N]
          Length = 262

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 83/238 (34%), Positives = 127/238 (53%), Gaps = 4/238 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++L  FY  + LG+    A+   +   W D  G  + G G+++P    +  +  R
Sbjct: 1   MHLDVLDLHNFYYRTPLGRVAQRAVRDQVQKLWPDAQGQTVAGFGFSVPLLRPYLEQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  EG  PL+   VD ++M+H LE +E P  +L E W
Sbjct: 61  LIALMPGPQGVMPWPVGMGNVSVLCEEGAWPLSTGMVDKLVMLHGLETSEHPSEVLSEAW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VP++ G+WAR + TPFG G+PYS  Q+ + L+  +FT      +LF P
Sbjct: 121 RVLGPGGRALFIVPSRSGLWARRDGTPFGFGRPYSLNQLEAQLKRHDFTPERALAALFAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILV 236
           P H++  LK    +E  G  F P    G+ ++EA K +Y   P     K  +S P+ V
Sbjct: 181 PLHQRFWLKTADFWETGGRRFAPWLVGGVLIVEASKQVYA--PTRTGLKAAVSKPLRV 236


>gi|159045478|ref|YP_001534272.1| hypothetical protein Dshi_2938 [Dinoroseobacter shibae DFL 12]
 gi|157913238|gb|ABV94671.1| conserved hypohtetical protein [Dinoroseobacter shibae DFL 12]
          Length = 256

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 130/236 (55%), Gaps = 4/236 (1%)

Query: 3   VDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           +D+++LRQFY  + LG+    AI   L   W D  G  ++G G+A+P    +     R +
Sbjct: 11  LDVLDLRQFYYRTRLGRVAQGAIRDALLYHWPDAEGQTVVGFGFAVPLLRPYLTDARRVI 70

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
             MP  QG  +WP    + + L  E + PL    VD ++++H LE +E P  +L E WRV
Sbjct: 71  GLMPGPQGVMHWPAGMPNISVLCDERSWPLETGGVDKLVLLHGLETSETPTDLLEECWRV 130

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           L+ GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + L +  F     + +LF PP+
Sbjct: 131 LSPGGRAMFIVPNRAGLWARKDGTPFGYGRPYSLGQLEAQLTKHGFVNERHASALFTPPS 190

Query: 182 HKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
            K+  L+   + EK G N+      G++++E  K +++  P+   + K +  P+ V
Sbjct: 191 EKRFWLRSTRMVEKTGQNLSAVLGGGVFLVEVSKQVFE--PLKADRSKGLRRPLRV 244


>gi|126734142|ref|ZP_01749889.1| hypothetical protein RCCS2_08284 [Roseobacter sp. CCS2]
 gi|126717008|gb|EBA13872.1| hypothetical protein RCCS2_08284 [Roseobacter sp. CCS2]
          Length = 269

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 115/216 (53%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++LR FY  S LG+     I   L T W +  G  ++G G+A+P    F     R
Sbjct: 13  MHLDVLDLRNFYYRSALGRAAQKVIRDELCTMWPEAKGQMVVGFGFALPLLRPFLKDARR 72

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  +   P+    VD ++M+H LE  E P L+L E W
Sbjct: 73  VIGLMPGPQGVMPWPADGQNVSVLCEDTLWPIETGHVDKLVMLHGLETTEQPSLLLDEAW 132

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PYS  Q+ + LR   F    T  +L+ P
Sbjct: 133 RVLGPGGRAVFIVPNRAGLWSRSDATPFGYGRPYSLSQLDAQLRRHQFVTERTMSALYQP 192

Query: 180 PTHKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARK 214
           P+ +K   K  S  EKIG N+      G+ ++E  K
Sbjct: 193 PSARKIWRKSASFLEKIGHNVPVVAAGGVLIVEVSK 228


>gi|114800073|ref|YP_762080.1| hypothetical protein HNE_3407 [Hyphomonas neptunium ATCC 15444]
 gi|114740247|gb|ABI78372.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 247

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 121/232 (52%), Gaps = 9/232 (3%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D V L +FY+S LGK     ++  L+  W +  G  +LGLGYA+P    F     R 
Sbjct: 1   MRQDAVTLERFYASDLGKAAAGILAGKLTDLWGESKGLSVLGLGYALPVLDAFATGPRRI 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGN--LPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           +A +P   G   W D      A V+ G+  LP +D   D V+++H LE   DP   L EI
Sbjct: 61  IAAVPHEHGPVRW-DYSGRGNAAVAVGDPRLPFSDGLFDRVIILHGLEETGDPRAYLREI 119

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           WRV    GR+++   N+ G+W+R   TPFG G+P++  Q+ +LL    F ++ +S +L+ 
Sbjct: 120 WRVTAPEGRIVLAAANRAGLWSRATRTPFGHGRPWTRSQLSNLLSTGLFQVTASSSALYM 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ------GLPITE 224
           PP     +      +E +G +  PG  G+ +IEA K LY       G P+T+
Sbjct: 180 PPAALGLVTSAAEGWEAMGRVIAPGMGGVVLIEAVKRLYAPPKSGTGAPVTD 231


>gi|315497875|ref|YP_004086679.1| methyltransferase type 11 [Asticcacaulis excentricus CB 48]
 gi|315415887|gb|ADU12528.1| Methyltransferase type 11 [Asticcacaulis excentricus CB 48]
          Length = 246

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 119/214 (55%), Gaps = 2/214 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  + EL +FY++  G  T   +++ L+  W DVTG  +LGLGY  P+   F+G   R 
Sbjct: 1   MRRIVSELSRFYATPEGAVTRRMVTQKLAEAWPDVTGSDVLGLGYTTPYLDAFNGTARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP+ QGA  WP+   S + LV E ++P   +  D + ++H LE A +P  +L E  R
Sbjct: 61  IAAMPSAQGAEIWPEGLKSRSTLVDEQHMPFPSALFDRIFLMHALEEAPNPEALLVEASR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            LT+ GR+I+ V  + G+W   E TPFG GQP+S  Q+ +LLR A       S +L+ PP
Sbjct: 121 CLTTNGRLILAVVARGGLWTHAEKTPFGHGQPFSRTQLETLLRAAELEPIAWSYALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
              + +L+    FE+      P   G+ ++EA K
Sbjct: 181 L--RSLLRWAQTFEEWAPRVWPYRGGLILMEAGK 212


>gi|254465111|ref|ZP_05078522.1| ATP synthase subunits region ORF 4 [Rhodobacterales bacterium Y4I]
 gi|206686019|gb|EDZ46501.1| ATP synthase subunits region ORF 4 [Rhodobacterales bacterium Y4I]
          Length = 248

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 2/219 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W +  G  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLLELWPEAEGLTVAGFGFAAPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    +D ++++H LE +E P  +L E W
Sbjct: 61  VMALMPGPQGVMQWPAGMPNVSVLCEETSWPVDTGRIDRLVLLHGLETSERPSRLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I +VPN+ G WAR + TPFG G+PY+  Q+   LRE  F +   + +L+  
Sbjct: 121 RVLGPGGRAIFIVPNRAGFWARSDLTPFGYGRPYTLRQLEGQLREHQFAIEQHTAALYRL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY 217
           P+HK+  LK  ++ EK+G       A G++++E  K  Y
Sbjct: 181 PSHKRFWLKSGAMLEKMGRKLPAMLAGGVFMVEVSKQTY 219


>gi|255264086|ref|ZP_05343428.1| ATP synthase subunit [Thalassiobium sp. R2A62]
 gi|255106421|gb|EET49095.1| ATP synthase subunit [Thalassiobium sp. R2A62]
          Length = 259

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 113/199 (56%), Gaps = 1/199 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+V+LR FY  S LG+     +   L   W +  G  ++G G+A+P    F G+  R
Sbjct: 1   MHLDVVDLRSFYYRSTLGRAAQKTVRNHLREMWPETKGQSVVGFGFAVPLLRPFLGEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WPD   + + L  E   P+   +VD ++++H LE ++ P  +L E W
Sbjct: 61  VVGLMPGPQGVMAWPDGADNISVLCQEMLWPIETGTVDRLVVMHGLETSDYPAALLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+W+R + TP G G+PYS  Q+ + LR+  F    T  +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRAGLWSRRDQTPLGYGRPYSLGQLETQLRKHRFVTEHTLSTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGN 198
           P+H+K   K  + +E++G+
Sbjct: 181 PSHRKFWRKTAAFWERMGS 199


>gi|163742885|ref|ZP_02150269.1| hypothetical protein RG210_12225 [Phaeobacter gallaeciensis 2.10]
 gi|161383849|gb|EDQ08234.1| hypothetical protein RG210_12225 [Phaeobacter gallaeciensis 2.10]
          Length = 248

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 122/220 (55%), Gaps = 4/220 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W +  G  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLLELWPEAAGQTVAGFGFAAPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L +E   P+    VD ++++H LE ++ P  +L E W
Sbjct: 61  VIALMPGPQGVMQWPAGMPNVSVLCAETAWPIETGHVDRLVLLHGLETSDRPSHLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+   S +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRAGLWARSDVTPFGFGRPYTLSQVENQLRLYQFTVERHSAALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARKILY 217
           P+ ++  LK   VFE++G+   P     G+++IE  K ++
Sbjct: 181 PSQRRFWLKSGPVFERMGDRL-PAMLGGGVFLIEVSKQVH 219


>gi|114570930|ref|YP_757610.1| type 11 methyltransferase [Maricaulis maris MCS10]
 gi|114341392|gb|ABI66672.1| Methyltransferase type 11 [Maricaulis maris MCS10]
          Length = 255

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 129/219 (58%), Gaps = 11/219 (5%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           +R D++EL +FY S  G+     I++ LS+ W DVT   +LG+G+A P+   + GK  R 
Sbjct: 4   VRRDVLELDRFYRSRQGQAAHRMIARRLSSIWPDVTALDVLGIGFANPYLDVWQGKARRC 63

Query: 61  LAFMPAGQGA-TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
           ++  PA QGA  + P      TAL  E +LP  ++  D VL+VH LE  +   ++L E+W
Sbjct: 64  VSLTPAAQGAIVSGPSGV--PTALGDETHLPFQEALFDRVLLVHALEETDSLPVLLREVW 121

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL   GR+++V P++ G+WA ++ TPFG G+P++  Q+  LL +A    +  SR+L+ P
Sbjct: 122 RVLAPEGRLLIVSPSRAGIWAWLDSTPFGHGRPFTRGQLTRLLDDALLVPTAWSRALYAP 181

Query: 180 P----THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           P    TH++ +  LW   E++G    P   G+ ++EA K
Sbjct: 182 PWGWSTHRR-VANLW---EEVGEYAWPALGGLILVEAVK 216


>gi|126725794|ref|ZP_01741636.1| hypothetical protein RB2150_06298 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704998|gb|EBA04089.1| hypothetical protein RB2150_06298 [Rhodobacterales bacterium
           HTCC2150]
          Length = 250

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 133/246 (54%), Gaps = 4/246 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ EL++FY  + LG+    AI   +   W +  G  + G G+A P    + G+  R
Sbjct: 1   MHLDVRELQRFYYRTKLGRAAQKAIRDQVVAKWPEAKGLTVAGYGFAAPMLRPYLGQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            LA MP  QG  +WP    + + L  E   P+   S+D ++++H LE +E+P  +L E  
Sbjct: 61  LLALMPGPQGVMHWPVGVPNVSLLCEESFWPVTTGSLDRLIVLHGLETSENPDAILQECH 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GGR++ +VPN+ G+W+R + TPFG G+PYS  Q+   LR A FT       LF P
Sbjct: 121 RALGPGGRVLFIVPNRAGLWSRSDKTPFGYGRPYSPIQLDKQLRAAGFTPESHKTMLFSP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILY--QGLPITESKKKHISSPILV 236
           P++++  LK  +++E +G   G     G+ ++EA K +Y   G  + +  ++ ++    V
Sbjct: 181 PSNRRFWLKTANLWENVGRKLGFFSAGGVLMVEASKHVYAPSGTAVKDRVRRGLTILDGV 240

Query: 237 PHTVST 242
           P T  T
Sbjct: 241 PQTAPT 246


>gi|163737809|ref|ZP_02145226.1| hypothetical protein RGBS107_19798 [Phaeobacter gallaeciensis
           BS107]
 gi|161389335|gb|EDQ13687.1| hypothetical protein RGBS107_19798 [Phaeobacter gallaeciensis
           BS107]
          Length = 248

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 122/220 (55%), Gaps = 4/220 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W +  G  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLLELWPEAAGQTVAGFGFAAPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L +E   P+    VD ++++H LE ++ P  +L E W
Sbjct: 61  VIALMPGPQGVMQWPAGMPNVSVLCAETAWPIETGHVDRLVLLHGLETSDRPSHLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+   S +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRAGLWARSDVTPFGFGRPYTLSQVENQLRLHQFTVERHSAALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARKILY 217
           P+ ++  LK   +FE++G+   P     G++++E  K ++
Sbjct: 181 PSQRRFWLKSGPLFERMGDRL-PAMLGGGVFLVEVSKQVH 219


>gi|84514772|ref|ZP_01002135.1| hypothetical protein SKA53_11148 [Loktanella vestfoldensis SKA53]
 gi|84510931|gb|EAQ07385.1| hypothetical protein SKA53_11148 [Loktanella vestfoldensis SKA53]
          Length = 254

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 124/236 (52%), Gaps = 4/236 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++LR FY  S LG+     I   L T W +  G  + G G+A+P    +     R
Sbjct: 1   MHLDVLDLRNFYYRSALGRAAQQVIRNELVTLWPEAKGQVVAGFGFAVPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP +  + + L  +   P+    +D ++++H LE +E P  +L E+W
Sbjct: 61  VIGLMPGPQGVMPWPPEGRNVSILCEDTLWPIETGHIDKLVVMHGLETSEHPTALLDEMW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR +VVVPN+ G+W+R + TPFG G+PYS  Q+ + LR+  F    T  +LF P
Sbjct: 121 RVLGPGGRAVVVVPNRAGLWSRTDKTPFGYGRPYSLTQLDAQLRKHRFVTERTLSTLFQP 180

Query: 180 PTHKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
           P+  +   +  ++FE++G  I      G+ ++E  K      P     K+ +  P+
Sbjct: 181 PSRSRFWRRSAAMFERVGPKIPVIAAGGVLMVEVTK--QSAAPTRPGLKEAVRRPL 234


>gi|254475575|ref|ZP_05088961.1| ATP synthase subunits region ORF 4 [Ruegeria sp. R11]
 gi|214029818|gb|EEB70653.1| ATP synthase subunits region ORF 4 [Ruegeria sp. R11]
          Length = 248

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 118/217 (54%), Gaps = 4/217 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W + TG  + G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLRDLWPEATGQTVAGFGFAAPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE ++ P  +L E W
Sbjct: 61  VMALMPGPQGVMQWPAGMANVSVLCEETAWPIETGHVDRLVLLHGLETSDRPSHLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+     +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRSGLWARSDDTPFGFGRPYTLSQVENQLRLHQFTIERHLGALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARK 214
           P+ ++  L+   +FE++G+   P     G++++E  K
Sbjct: 181 PSQRRFWLRAGPLFERLGDRL-PAMLGGGVFLVEVSK 216


>gi|99081930|ref|YP_614084.1| hypothetical protein TM1040_2090 [Ruegeria sp. TM1040]
 gi|99038210|gb|ABF64822.1| hypothetical protein TM1040_2090 [Ruegeria sp. TM1040]
          Length = 248

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 133/248 (53%), Gaps = 12/248 (4%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W D TG  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGQLLRMWPDATGETIAGFGFAAPLLRPYLSEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    VD ++++H LE +E P  +L E W
Sbjct: 61  LMALMPGPQGVMQWPAGMPNVSVLCEETSWPVETGRVDRLVLLHGLETSEQPSALLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RV+   GR I +VPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+   + +L+  
Sbjct: 121 RVMGPRGRAIFIVPNRAGLWARSDETPFGYGRPYTLTQLENQLRAHQFTIEQHAAALYRL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARKILY-QGLPITESKKKH------- 229
           P+ ++  LK  ++ E++G    P    AG++++E  K  + Q   +T +++ +       
Sbjct: 181 PSSRRFWLKSGAMIERVGRRL-PAMMAAGVFLVEVSKQTHPQKGHMTRARRTNPIRVLEG 239

Query: 230 ISSPILVP 237
           +S+PI  P
Sbjct: 240 LSNPIAEP 247


>gi|260432835|ref|ZP_05786806.1| ATP synthase subunit [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416663|gb|EEX09922.1| ATP synthase subunit [Silicibacter lacuscaerulensis ITI-1157]
          Length = 244

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 122/236 (51%), Gaps = 4/236 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    AI   L   W +  G  + G G+A+P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQAAIRGRLVEFWPEAKGQTVAGFGFAVPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E   P+    VD ++++H LE +E P  +L E W
Sbjct: 61  VVGLMPGPQGVMPWPAGLPNVSVLTEETAWPIETGHVDKLVVMHGLETSERPSQLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I VVPN+ G+W+R + TPFG G PYS  Q+   LR  +F       +L+ P
Sbjct: 121 RVLGPGGRAIFVVPNRAGLWSRTDRTPFGYGHPYSATQLDKQLRAHHFVPEKHCSALYMP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY--QGLPITESKKKHISS 232
           P+ ++  L+  S+ EK G       A G+ ++EA K++    G  + + +K+ I +
Sbjct: 181 PSFRRFWLRSGSLIEKAGQRIPTVMAGGVLMVEASKLVRPPSGTVVKDREKRPIKA 236


>gi|83952818|ref|ZP_00961548.1| hypothetical protein ISM_11710 [Roseovarius nubinhibens ISM]
 gi|83835953|gb|EAP75252.1| hypothetical protein ISM_11710 [Roseovarius nubinhibens ISM]
          Length = 246

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 118/218 (54%), Gaps = 6/218 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+     + + L   W +  G  + G G+A+PF   +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQKTLRQELLKFWPEAKGQTVAGFGFAVPFLRPYLSEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  E + PL    +D +L+VH LE +E P  +L E W
Sbjct: 61  VVGLMPAQQGVIAWPQGMPNVSVLCEETSWPLETGRIDKLLLVHALEVSERPGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GG  I V+PN+ G+W+R + TPFG G+PYS  Q+ +LL+   F       +L+ P
Sbjct: 121 RALGPGGSAIFVLPNRAGLWSRSDRTPFGYGRPYSQGQLETLLKTKGFLPERHVTTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIG---NIFGPGFAGIYVIEARK 214
           P+ ++   K   ++E++G    I G G  G+ ++EA K
Sbjct: 181 PSERRFWRKTAGMWERLGGKIEIIGAG--GVLMVEASK 216


>gi|89053534|ref|YP_508985.1| hypothetical protein Jann_1043 [Jannaschia sp. CCS1]
 gi|88863083|gb|ABD53960.1| hypothetical protein Jann_1043 [Jannaschia sp. CCS1]
          Length = 253

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 118/216 (54%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+V+LRQFY  + LG+    A+ + +   W +  G  ++G G+A+P    +  +  R
Sbjct: 1   MHLDVVDLRQFYYRTPLGRIAQKAVRERVVEMWPNAKGETVVGFGFAVPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  EG  P+     D ++ +H LE +E P  +L E  
Sbjct: 61  VIGVMPAEQGVMPWPAGLDNVSLLCREGLWPIQTGQADKLICLHGLETSEHPASVLDECQ 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + L   +F     S +LF P
Sbjct: 121 RALAPGGRAMFIVPNRTGLWARRDGTPFGFGRPYSLGQLEAQLEAFDFIPERHSAALFAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARK 214
           P  K+  L+   + E++G  F P  A G+ +IEA K
Sbjct: 181 PFVKRFWLQSADMLERVGTKFSPSRAGGVIIIEASK 216


>gi|254441570|ref|ZP_05055063.1| hypothetical protein OA307_985 [Octadecabacter antarcticus 307]
 gi|198251648|gb|EDY75963.1| hypothetical protein OA307_985 [Octadecabacter antarcticus 307]
          Length = 266

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 117/222 (52%), Gaps = 6/222 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR+FY  S LG+     +   L   W +  G  + G G+A+P    +     R
Sbjct: 19  MHLDVHDLREFYYRSPLGRAAQKVVRDELVRLWPEAKGQTVAGFGFAVPLLRPYLADSRR 78

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WPD   + + L  +   PLA  SVD ++++H LE ++ P  +L E W
Sbjct: 79  VIALMPGPQGVMPWPDNKPNVSVLCEDTLWPLASGSVDKLVLLHGLETSDTPMALLDECW 138

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PYS  Q+   LR+       T  +L+ P
Sbjct: 139 RVLGPGGRAVFIVPNRTGLWSRSDATPFGFGRPYSLGQLEKQLRDVGLIPVNTLSTLYQP 198

Query: 180 PTHKKCILKLWSVFEKIGN---IFGPGFAGIYVIEARKILYQ 218
           P+ +K   +     E  G    +F  G  G+ ++EA K + Q
Sbjct: 199 PSARKIWRQFAKAMEGAGRHIPVFAAG--GVLMVEAAKQVPQ 238


>gi|310815411|ref|YP_003963375.1| hypothetical protein EIO_0927 [Ketogulonicigenium vulgare Y25]
 gi|308754146|gb|ADO42075.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 116/217 (53%), Gaps = 2/217 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +L+ FY  S LG+     +   L   W +  G  + G G+A+P    F  +  R
Sbjct: 1   MYLDVQDLKNFYYRSALGRAVQQVLRGRLRQMWPETKGMTIAGFGFALPLLRPFLPEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + T LV E   PL   SVD ++M+H LE ++DP  +L E  
Sbjct: 61  VIGLMPGPQGVMAWPPGLPNITTLVEEALWPLETGSVDRLVMLHGLEMSDDPGALLQEAR 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PY+  Q+   LR  +F     +  L+ P
Sbjct: 121 RVLGPGGRAVFIVPNRAGIWSRTDRTPFGYGKPYTIGQLEGALRLHDFAPERAATVLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKI 215
           P+ ++   +L  + E +G      +A G+ ++EA K+
Sbjct: 181 PSVRRTWRRLGPMLESVGTHLPAIYAGGVLMVEAVKV 217


>gi|254463048|ref|ZP_05076464.1| ATP synthase subunits region ORF 4 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679637|gb|EDZ44124.1| ATP synthase subunits region ORF 4 [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 273

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+   + T W +  G  + G G+A P    +     R
Sbjct: 20  MHLDVQDLRNFYYRSALGRAAQRAVRDRVVTLWPEAKGQTVAGFGFAAPLLRPYLKDARR 79

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE +E P  +L E W
Sbjct: 80  VMALMPGPQGVIPWPAGLPNVSVLCEEMLWPIETGRVDRLVVMHGLETSESPTTVLDECW 139

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PY+  Q+ + L+   F     + +L+ P
Sbjct: 140 RVLGPGGRALFIVPNRAGLWSRSDATPFGFGRPYTITQLETQLKRHGFLPERHAAALYQP 199

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILV 236
           P+ K+  +K   V E++G      F +G+ ++EA K ++   P+    +  + SP+ V
Sbjct: 200 PSAKRAWMKSGKVLERMGGKIPAIFPSGVLMVEASKRVHA--PLGPGSRLRVPSPMEV 255


>gi|260576488|ref|ZP_05844478.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021371|gb|EEW24677.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 254

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 116/216 (53%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  + LG+    AI + +   W +  G  + G G+A+P    +     R
Sbjct: 1   MHLDVQDLRNFYYRTQLGRVAQRAIRERMLEVWPEAKGQTVAGFGFAVPLLRPYLEAARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E   P++   VD ++++H LE +E+P  +L E +
Sbjct: 61  VIGLMPGPQGVMPWPAGMENVSVLCEETRWPISTGMVDRLVLLHGLETSENPGAVLEESY 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ GMWAR + TPFG G PYS  Q+ S L+   FT      +L+ P
Sbjct: 121 RVLGPGGRALFVVPNRSGMWARADGTPFGFGHPYSLGQLESQLKYYGFTPERHLSALYSP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARK 214
           P+ ++  L   + +E  G  F P   AG+ ++EA K
Sbjct: 181 PSERRFWLGTAAFWENAGQKFAPWLAAGVLMVEASK 216


>gi|254511707|ref|ZP_05123774.1| hypothetical protein RKLH11_2248 [Rhodobacteraceae bacterium KLH11]
 gi|221535418|gb|EEE38406.1| hypothetical protein RKLH11_2248 [Rhodobacteraceae bacterium KLH11]
          Length = 244

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 112/216 (51%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    AI   L   W +  G  ++G G+A+P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQAAIRGRLVDLWPEAKGQTVVGFGFAVPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E   PL    VD ++++H LE +  P  +L E W
Sbjct: 61  VIGLMPGPQGVMPWPAGMPNVSVLTEETMWPLETGHVDKLVVMHGLETSSRPTQLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+W+R + TPFG GQPYS  Q+   LR  +F       +L+ P
Sbjct: 121 RVLGPGGRALFVVPNRAGLWSRSDRTPFGFGQPYSATQLEKQLRAHHFVPENHCSALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARK 214
           P+ ++  LK  S+ EK G       A G+ ++E  K
Sbjct: 181 PSFRRFWLKSGSLIEKTGQRIPTVMAGGVLMVEVSK 216


>gi|163745696|ref|ZP_02153056.1| hypothetical protein OIHEL45_08895 [Oceanibulbus indolifex HEL-45]
 gi|161382514|gb|EDQ06923.1| hypothetical protein OIHEL45_08895 [Oceanibulbus indolifex HEL-45]
          Length = 248

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 126/238 (52%), Gaps = 10/238 (4%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   L   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQKSLRGRLLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+   +VD ++++H LE +E P  +L E W
Sbjct: 61  VMVLMPGPQGVMPWPAGMPNTSVLTEETLWPVETGAVDKLVLMHGLETSERPSELLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG+ + +VPN+ GMWAR + TPFG G+PYS  Q+ + LR+  F       +LF  
Sbjct: 121 RVLGPGGKALFIVPNRAGMWARRDRTPFGYGRPYSPGQLETQLRKHQFLPERHLGALFQF 180

Query: 180 PTHKKCILKLWSVFEKIGN----IFGPGFAGIYVIEARKILY--QGLPITESKKKHIS 231
           P+ ++  +K   +FEK+G     + G    G  ++EA K++Y  +G P   + ++ I 
Sbjct: 181 PSQQRIWMKSAPLFEKVGRQMPTMMG---GGAILVEATKLVYPPRGRPQRSTARRAIG 235


>gi|259415930|ref|ZP_05739850.1| ATP synthase subunit [Silicibacter sp. TrichCH4B]
 gi|259347369|gb|EEW59146.1| ATP synthase subunit [Silicibacter sp. TrichCH4B]
          Length = 248

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 118/217 (54%), Gaps = 4/217 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W D TG  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGQLLRMWPDATGETIAGFGFAAPLLRPYLSEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    VD ++++H LE +E P  +L E W
Sbjct: 61  IMALMPGPQGVMQWPAGQPNVSVLCEETSWPVETGRVDRLVLLHGLETSEQPSALLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RV+   GR I +VPN+ G+W R + TPFG G+PY+  Q+ + LR   FT+   + +L+  
Sbjct: 121 RVMAPRGRAIFIVPNRGGLWVRSDATPFGYGRPYTLTQLENQLRGHQFTIEQHAAALYRL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARK 214
           P+ ++  LK  ++ E++G    P    AG++++E  K
Sbjct: 181 PSPRRFWLKSGAMIERVGRRL-PAMMAAGVFLVEVSK 216


>gi|85704174|ref|ZP_01035277.1| hypothetical protein ROS217_14286 [Roseovarius sp. 217]
 gi|85671494|gb|EAQ26352.1| hypothetical protein ROS217_14286 [Roseovarius sp. 217]
          Length = 246

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 118/218 (54%), Gaps = 6/218 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+     +   ++  W +  G  ++G G+A+PF   +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAVQKTVRAQVAEFWPEAQGQTVVGYGFAVPFLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  E   PL    VD +L+VH LE +E P  +L E W
Sbjct: 61  VIGLMPAPQGVIGWPQGLPNISVLCEETFWPLETGHVDKLLVVHGLETSEQPSAVLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+W+R + TPFG G+PYS  Q+ S L+  NF     + +L+ P
Sbjct: 121 RVLGPGGSALFIVPNRAGLWSRSDRTPFGFGRPYSQTQLESQLKSHNFLPERHATTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIG---NIFGPGFAGIYVIEARK 214
           P+ +    K   ++E++G   ++   G  G+ ++EA K
Sbjct: 181 PSDRPFWRKTAGMWERMGAKLSVVAAG--GVLMVEATK 216


>gi|86136459|ref|ZP_01055038.1| hypothetical protein MED193_20089 [Roseobacter sp. MED193]
 gi|85827333|gb|EAQ47529.1| hypothetical protein MED193_20089 [Roseobacter sp. MED193]
          Length = 269

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 117/216 (54%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   L   W +  G  + G G+A P    +  +  R
Sbjct: 22  MHLDVQDLRNFYYRSTLGRAAQASVRNRLLEFWPEAAGQTVAGFGFAAPLMRPYLAEARR 81

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    VD ++++H LE +E P  +L E  
Sbjct: 82  VIALMPGPQGVMQWPAGMPNVSVLCEETSWPIETGRVDRLVVMHGLETSERPTQVLEECR 141

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I VVPN+ G WAR + TPFG G+PY+  Q+ + LR   FT+   + +L+  
Sbjct: 142 RVLGPGGRAIFVVPNRAGFWARSDQTPFGYGRPYTLIQLENQLRLHEFTIERHAAALYRL 201

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARK 214
           P+ ++  LK  ++FE+IG       A G++++E  K
Sbjct: 202 PSQRRFWLKSGALFERIGRQLPAMLAGGVFMVEVSK 237


>gi|294085429|ref|YP_003552189.1| hypothetical protein SAR116_1862 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665004|gb|ADE40105.1| hypothetical protein SAR116_1862 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 240

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 115/228 (50%), Gaps = 3/228 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D V+++ FY + LG   T  +   +   WD+         GY  PF +      +  
Sbjct: 1   MYRDTVQIQSFYDTPLGVTVTRLLDPYIRPFWDNRADAYNAVFGYGPPFLNMIDDAAKAK 60

Query: 61  LA-FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
               MPA  GA  WP      T L +  NLPL D  +D +++ H LEF +DP  +L E W
Sbjct: 61  AIALMPARHGAVIWPQTGQVRTILGNGHNLPLPDVQLDRLMLTHALEFDDDPAWLLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL   G+++V+VPN+RG+W   E TP G G+P+S  Q+ + L +  F ++   R +F P
Sbjct: 121 RVLDGAGKLLVMVPNRRGIWTHRETTPLGHGRPFSRRQLETALTQHGFEVNHVHRVVFIP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
           P  +  +L+  S  E+ G    P    I +IEA K+LY   P   ++K
Sbjct: 181 PMQRGPLLRFASTCEQFGQRCWPALGAILLIEATKMLYA--PAGNTRK 226


>gi|163732299|ref|ZP_02139745.1| hypothetical protein RLO149_02572 [Roseobacter litoralis Och 149]
 gi|161394597|gb|EDQ18920.1| hypothetical protein RLO149_02572 [Roseobacter litoralis Och 149]
          Length = 244

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 125/240 (52%), Gaps = 4/240 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQMSLRSRMMEIWPEAKGQTVVGFGFAAPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE +E    +L E W
Sbjct: 61  VMALMPGPQGVMPWPSGLPNVSVLTEEVAWPIETGHVDKLVLLHGLETSERASDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGLWARRDRTPFGYGRPYSTSQLETQLRKHQFLPERHLGALYQV 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           P+ ++  +K  +  EKIG    P F  +G +++EA K++Y      E K++     +L P
Sbjct: 181 PSSQRLWMKSGAALEKIGRRM-PTFIASGAFMVEATKLVYPPKGKVEPKRRVAPVSVLKP 239


>gi|149202405|ref|ZP_01879378.1| hypothetical protein RTM1035_13798 [Roseovarius sp. TM1035]
 gi|149144503|gb|EDM32534.1| hypothetical protein RTM1035_13798 [Roseovarius sp. TM1035]
          Length = 246

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 116/216 (53%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+     +   ++  W +  G  ++G G+A+PF   +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAVQKTLRAQVAEFWPEAQGQTVVGYGFAVPFLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  E   P+    VD +L+VH LE +E P  +L E W
Sbjct: 61  VIGLMPAPQGVIGWPQGMPNISVLCEETFWPVETGHVDKLLVVHGLETSEQPGAVLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+W+R + TPFG G+PYS  Q+ S L+  NF     + +L+ P
Sbjct: 121 RVLGPGGSALFIVPNRAGLWSRSDRTPFGFGRPYSQTQLESQLKSQNFLPERHATALYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARK 214
           P+ +    K   ++E++G       + G+ ++EA K
Sbjct: 181 PSERPFWRKTAGMWERMGGKLSVVVSGGVLMVEATK 216


>gi|149913691|ref|ZP_01902224.1| hypothetical protein RAZWK3B_10321 [Roseobacter sp. AzwK-3b]
 gi|149812811|gb|EDM72640.1| hypothetical protein RAZWK3B_10321 [Roseobacter sp. AzwK-3b]
          Length = 248

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 127/236 (53%), Gaps = 4/236 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+ K + + W +  G  + G G+A+PF   +     R
Sbjct: 1   MHLDVQDLRNFYYRSQLGRAAQAAVRKEVLSFWPEAQGQTVAGYGFAVPFLRPYLEDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E + PL    VD +L+VH LE +E+P  +L E W
Sbjct: 61  VIGLMPGPQGVIAWPQGLPNVSVLCEETSWPLETGHVDKLLVVHGLETSENPGALLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+W+R + TPFG G+PYS  Q+ S L+  NF     + +L+ P
Sbjct: 121 RVLGPGGSALFIVPNRAGLWSRSDRTPFGFGRPYSQSQLESQLKLNNFLPLRHATTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY--QGLPITESKKKHISS 232
           P+ ++   K    +E +G       + G+ ++EA K ++   G  + E+ +K + +
Sbjct: 181 PSERRIWRKTSMFWEALGVKMSVVLSGGVLLVEATKRVHAPSGPGLRETVRKPLEA 236


>gi|218682274|ref|ZP_03529875.1| putative methyltransferase protein [Rhizobium etli CIAT 894]
          Length = 120

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 83/116 (71%)

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
           R+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP+  + I
Sbjct: 1   RLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPPSKLRTI 60

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           L+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V T
Sbjct: 61  LRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGVPT 116


>gi|56697999|ref|YP_168370.1| hypothetical protein SPO3167 [Ruegeria pomeroyi DSS-3]
 gi|56679736|gb|AAV96402.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 250

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 116/216 (53%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+   L   W +  G  + G G+A+P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQAAVRGRLLEIWPEAKGQTVAGFGFAVPLLRPYLTQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG  +WP    + + L  E   P+    VD ++++H LE +E P  +L E W
Sbjct: 61  VIGLMPGPQGVMHWPAGMANVSVLCEETLWPIETGHVDRLVVMHGLETSEHPTQVLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I VVPN+ G+W+R + TPFG G+PY+  Q+ + LR+  F       +L+ P
Sbjct: 121 RVLGPGGRAIFVVPNRAGLWSRSDKTPFGFGRPYTLGQLETQLRKHQFLPEFHCSALYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARK 214
           P+ K+  LK  ++ E+ G       A G++++E  K
Sbjct: 181 PSFKRFWLKSGALIERTGTRLPTIMAGGVFMVEVSK 216


>gi|110680698|ref|YP_683705.1| hypothetical protein RD1_3538 [Roseobacter denitrificans OCh 114]
 gi|109456814|gb|ABG33019.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 244

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 125/240 (52%), Gaps = 4/240 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQMSLRSRMMEIWPEAKGQTVVGFGFAAPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE +E    +L E W
Sbjct: 61  VMALMPGPQGVMPWPSGLPNVSVLTEEVAWPIETGHVDKLVLLHGLETSERVSDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGLWARRDRTPFGYGRPYSTSQLETQLRKHQFLPERHLGALYQV 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           P+ ++  +K  +  EKIG    P F  +G +++EA K++Y      E K++     +L P
Sbjct: 181 PSSQRLWMKSGAALEKIGRRM-PTFIASGAFMVEATKLVYPPKGKVEPKRRVAPVGVLKP 239


>gi|119386521|ref|YP_917576.1| methyltransferase type 11 [Paracoccus denitrificans PD1222]
 gi|119377116|gb|ABL71880.1| Methyltransferase type 11 [Paracoccus denitrificans PD1222]
          Length = 260

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 125/240 (52%), Gaps = 6/240 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTW--DDVTGCRLLGLGYAIPFFSCFHGKV 57
           M  D+ ELR+FY +  LG+     +   L+  W  D   G  + G G+A P    +  + 
Sbjct: 1   MHHDVFELRKFYYTRALGRVVQRVLRDRLTGLWPPDQAQGMTVAGYGFAAPLLRPWLTRA 60

Query: 58  ERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
            R ++ MP  QG   WP    + + L  E   PL   SVD ++++H LE A+ P  ++ E
Sbjct: 61  RRVISLMPGPQGVMAWPAGLPNCSVLCEETAWPLDTGSVDRLVLLHALETADHPAALMDE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            WRVL  GGR++V+VPN+ G+WAR E TPFG G+ Y+  Q+    R A F    T  +L+
Sbjct: 121 AWRVLGPGGRLLVMVPNRAGLWARSETTPFGFGRSYTAGQLEVQARAAGFVTERTGAALY 180

Query: 178 FPPTHKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
            PP+ ++  LK   ++E+ G  I     AG+ + E  K +    P+   ++  + SP+ V
Sbjct: 181 IPPSDRRFWLKSAQMWERAGLRISQVLVAGVVLTEFSKQVQA--PVGPGRRVSVPSPLDV 238


>gi|254454124|ref|ZP_05067561.1| ATP synthase subunits region ORF 4 [Octadecabacter antarcticus 238]
 gi|198268530|gb|EDY92800.1| ATP synthase subunits region ORF 4 [Octadecabacter antarcticus 238]
          Length = 244

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 113/216 (52%), Gaps = 6/216 (2%)

Query: 7   ELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           +LR+FY  S +G+     +   L   W +  G  + G G+A+P    +     R +A MP
Sbjct: 3   DLREFYYRSPVGRAAQKVVRDQLVRMWPEAKGQTVAGFGFAVPLLRPYLADARRVIALMP 62

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
             QG   WPD   + + L  +   PLA  SVD ++++H LE ++ P  +L E WRVL  G
Sbjct: 63  GPQGVMPWPDNKPNVSVLCEDTLWPLASGSVDKLVLLHGLETSDTPMALLDECWRVLGPG 122

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           GR + +VPN+ G+W+R + TPFG G+PYS  Q+   LR+       T  +LF PP+ +  
Sbjct: 123 GRAVFIVPNRTGLWSRSDATPFGFGRPYSLSQLEKQLRDIGLIPVKTLSTLFQPPSTRAI 182

Query: 186 ILKLWSVFEKIGN---IFGPGFAGIYVIEARKILYQ 218
             +  +  E  G    +F  G  G+ ++EA K + Q
Sbjct: 183 WRQFANTIEAAGRHIPVFAAG--GVLMVEAAKQVPQ 216


>gi|89069068|ref|ZP_01156449.1| hypothetical protein OG2516_17316 [Oceanicola granulosus HTCC2516]
 gi|89045437|gb|EAR51502.1| hypothetical protein OG2516_17316 [Oceanicola granulosus HTCC2516]
          Length = 253

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 113/218 (51%), Gaps = 6/218 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY    LG+     I   L   W D  G  ++G G+A P    F     R
Sbjct: 1   MHLDVTDLRSFYYRKALGRAVQRVIRDELRRMWPDTKGQMVVGFGFAAPLLRPFLDDSRR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG  +WP    + + L  +   P+    VD ++M+H LE ++ P  +L E W
Sbjct: 61  VIALMPGPQGVMHWPAGQPNVSVLCEDTLWPIQTGQVDRLVMLHGLETSDHPGALLEEAW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+P+S  Q+ S LR   F +     +L+ P
Sbjct: 121 RVLGPGGRAVFIVPNRAGLWSRSDRTPFGYGRPFSRTQLESQLRRHRFQVDHVVSTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGN---IFGPGFAGIYVIEARK 214
           P+ ++   +     E +G    +F  G  G+ ++EA K
Sbjct: 181 PSDRRGWRRAAGWMEGVGRHVPVFKTG--GVLMVEASK 216


>gi|140222|sp|P05447|YAT4_RHOBL RecName: Full=ATP synthase subunits region ORF 4
 gi|45974|emb|CAA77310.1| URF 4 [Rhodobacter blasticus]
          Length = 255

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 112/218 (51%), Gaps = 1/218 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  + LG+    AI   +   W    G  + G G+A+P    +  +  R
Sbjct: 1   MHLDVQDLRDFYYRTRLGRVAQRAIRDQMLRLWPPAAGHTVAGFGFAVPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E N PL    VD + ++H LE +E+P  +L E  
Sbjct: 61  VVGLMPGPQGVMPWPAGMQNVSVLCEENNWPLPTGLVDRLAVMHGLETSENPSAVLDEAH 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+W+R + TPFG G+PYS  Q+ + LR   FT   +   L  P
Sbjct: 121 RVLGPGGRALFVVPNRAGLWSRRDATPFGFGRPYSNAQLEAQLRRHGFTPERSLTVLHAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
           P+     L+    +EK+G        G+ ++EA K +Y
Sbjct: 181 PSQTPFWLRTADAWEKLGRRLPWLSGGVLMVEASKQVY 218


>gi|294678494|ref|YP_003579109.1| hypothetical protein RCAP_rcc02975 [Rhodobacter capsulatus SB 1003]
 gi|1881513|emb|CAA67906.1| hypothetical protein [Rhodobacter capsulatus]
 gi|294477314|gb|ADE86702.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 252

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 122/223 (54%), Gaps = 6/223 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDD----VTGCRLLGLGYAIPFFSCFHG 55
           M +D+++LR FY  + LG+    AI   +   W D    + G  + G G+A+P    + G
Sbjct: 1   MHLDVLDLRDFYYRTQLGRTAQKAIRDKVVELWPDTQSGMAGLTVAGYGFAVPLLRPYLG 60

Query: 56  KVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
           +  R +  MPA QG   WP    + + L +E + PL    +D ++++H LE ++DP  ++
Sbjct: 61  RARRVIGLMPAQQGVMPWPAGEPNVSVLCAETSWPLETGMIDRLVVLHGLEVSDDPDALM 120

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
            E WR L  GGR + +VPN+ G+WA  E TPFG G+PY+  Q+ +  R   F     + +
Sbjct: 121 EECWRTLGPGGRALFIVPNRVGLWAPRETTPFGFGRPYTMGQLEAQARRVGFAPERQAAA 180

Query: 176 LFFPPTHKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARKILY 217
           L+ PP+ ++  L+   ++E++G    G   AG+ ++E  K ++
Sbjct: 181 LYIPPSQRRFWLRSSEMWERLGTRAAGYLAAGVVMLEVIKQVH 223


>gi|84500104|ref|ZP_00998370.1| hypothetical protein OB2597_09189 [Oceanicola batsensis HTCC2597]
 gi|84392038|gb|EAQ04306.1| hypothetical protein OB2597_09189 [Oceanicola batsensis HTCC2597]
          Length = 251

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 120/219 (54%), Gaps = 2/219 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S +G+     +   L   W +  G  + G G+A+P    +    +R
Sbjct: 1   MHLDVQDLRNFYYRSTVGRAAQTQVRAELLRLWPEAHGQTVAGFGFAVPLLRPYLADSKR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG  NWP    + + L  E   P+    VD ++++H LE +E+P  +L E +
Sbjct: 61  VIALMPGPQGVMNWPQGMPNISVLSEETRWPVETGHVDRLVVLHGLETSENPSDLLEECF 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG+ + +VP++ G+W+R + TPFG G+PYS  Q+ + L+  +F       +L+ P
Sbjct: 121 RVLGPGGKAVFIVPHRAGLWSRSDRTPFGYGRPYSQGQLEAQLKRHSFLPERHVHTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY 217
           P+HK+   K    +EK+G  F    + G+ ++EA K ++
Sbjct: 181 PSHKRFWRKTAPFWEKMGKSFSMILSGGVLMVEASKRVH 219


>gi|114327118|ref|YP_744275.1| methyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|114315292|gb|ABI61352.1| methyltransferase [Granulibacter bethesdensis CGDNIH1]
          Length = 269

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 117/234 (50%), Gaps = 3/234 (1%)

Query: 11  FYSSFLGKCTTDAISKVLSTTW--DDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           FY +  G+     +   L   W  ++  G  LLGLG+A P+  C+     R +       
Sbjct: 7   FYGTLAGEVVASLLRARLRLLWPGEECEGQTLLGLGHAAPYMRCWRSTAYRCVVGSLHPS 66

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
               WP    + +   +   LP  D S+D +++VH LE  +    +L E+WR+L   GR+
Sbjct: 67  AGQVWPPAGRTLSCDATPSALPFPDLSIDRIVLVHALEMTDHARALLREVWRILKDDGRL 126

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT-HKKCIL 187
           +VV PN+ G+WA ++  PFG GQP+S  Q+  LL  + F +     +L+ PP  H + +L
Sbjct: 127 MVVAPNRTGLWAHLDTNPFGQGQPFSHGQIERLLAASLFRVERRDAALYMPPVFHSRALL 186

Query: 188 KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           +   +FE  G    PG AG+ + EA K +Y G+P+  + +K +       H VS
Sbjct: 187 RAAWLFESTGRHLIPGLAGVTISEAVKDVYAGVPLRPTIRKRLMVQDAAEHLVS 240


>gi|254486521|ref|ZP_05099726.1| ATP synthase subunits region ORF 4 [Roseobacter sp. GAI101]
 gi|214043390|gb|EEB84028.1| ATP synthase subunits region ORF 4 [Roseobacter sp. GAI101]
          Length = 248

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 117/219 (53%), Gaps = 2/219 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQHALRSRMLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+    VD ++++H LE +E    +L E W
Sbjct: 61  VMTLMPGPQGVMPWPAGMANTSVLTEETLWPIETGHVDRLVLLHGLETSERQGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGLWARRDITPFGYGRPYSPGQLETQLRKHQFLPERQLGALYQM 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY 217
           P++++  ++   +FEKIG       A G +++E  K++Y
Sbjct: 181 PSNRRVWMRSGKLFEKIGRHMPTMMAGGAFMVEVTKLVY 219


>gi|84683663|ref|ZP_01011566.1| hypothetical protein 1099457000264_RB2654_19858 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668406|gb|EAQ14873.1| hypothetical protein RB2654_19858 [Rhodobacterales bacterium
           HTCC2654]
          Length = 260

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 124/237 (52%), Gaps = 8/237 (3%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSCFHGKVE 58
           M +D  +LR FY  S LG+     I   +   W     G  +LG G+A P    F     
Sbjct: 1   MHLDAQDLRAFYYRSALGRVAQKNIRDEVCRLWSGSAKGQTVLGYGFAAPLLRPFLADAR 60

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           R +A MPA QG   WP    + + L  E   P+     D ++M+H LE + +   +L E 
Sbjct: 61  RVIALMPAPQGVMAWPAGMPNVSVLCEEVLWPIDTGVADKLIMLHGLETSTNAPTLLDEA 120

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           +RVL  GGR + +VPN+ G+W+R ++TPFG G+PYS  Q+   LR+  F +   S +L+ 
Sbjct: 121 YRVLGPGGRALFIVPNRAGLWSRSDNTPFGYGRPYSTGQLEHQLRDHGFAIERHSAALYQ 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ----GLPITESKKKHIS 231
           PPTH++  LK   ++EK+G        G+ ++EA K +      GLP  E+ K+ +S
Sbjct: 181 PPTHRRFWLKTGPMWEKVGAGAPRMAGGVLLVEASKQVKAQHRPGLP--EAVKRPLS 235


>gi|260429161|ref|ZP_05783138.1| ATP synthase subunit [Citreicella sp. SE45]
 gi|260419784|gb|EEX13037.1| ATP synthase subunit [Citreicella sp. SE45]
          Length = 249

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 111/211 (52%), Gaps = 1/211 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ ++R FY  S LG+     +   +   W D  G  ++G G+A+P    +     R
Sbjct: 1   MHLDVHDMRDFYYRSALGRAAQRIVRDQVLQFWPDAHGHTMVGYGFAVPLLRPYLKGARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG  +WP    + T L  E   PL    VD ++M+H LE +E P  +L E +
Sbjct: 61  VVGLMPAPQGVMSWPAGQPNVTVLCEETLWPLETGHVDRLIMMHGLETSERPSELLDECY 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + VVPN+ G+WAR E TPFG G+PYS  Q+ + L+  +F        L+ P
Sbjct: 121 RVLGPGGEALFVVPNRSGLWARSEKTPFGYGRPYSLSQLDAQLKRHDFIRQSHVSVLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVI 210
           P+ ++  ++   V+E+IG       AG  +I
Sbjct: 181 PSSRRFWMRTGPVWERIGRAIPALVAGGVLI 211


>gi|126739848|ref|ZP_01755539.1| hypothetical protein RSK20926_14209 [Roseobacter sp. SK209-2-6]
 gi|126719080|gb|EBA15791.1| hypothetical protein RSK20926_14209 [Roseobacter sp. SK209-2-6]
          Length = 269

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 119/233 (51%), Gaps = 9/233 (3%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   L   W    G  + G G+A P    +     R
Sbjct: 22  MHLDVQDLRNFYYRSTLGRAAQASVRNRLLEFWPTAGGQTVAGFGFAAPLLRPYLKDARR 81

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    +D ++++H LE +E P  +L E W
Sbjct: 82  VIALMPGPQGVMQWPAGQPNVSVLCEETLWPIDTGRIDRLVVMHGLETSERPTRLLEECW 141

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GGR I VVPN+ G WAR + TPFG G+PY+  Q+ + LR   F +   + +L+  
Sbjct: 142 RCLGPGGRAIFVVPNRAGFWARSDKTPFGYGRPYTLVQLENQLRLHEFAIERHAAALYRL 201

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILYQGLPITESKKKHIS 231
           P+ ++  LK  ++FE+ G       A G++++E  K        T S+K H++
Sbjct: 202 PSSRRFWLKSGALFERFGRRIPAMLAGGVFMVEVSK-------QTHSQKGHMT 247


>gi|304320136|ref|YP_003853779.1| hypothetical protein PB2503_02807 [Parvularcula bermudensis
           HTCC2503]
 gi|303299039|gb|ADM08638.1| hypothetical protein PB2503_02807 [Parvularcula bermudensis
           HTCC2503]
          Length = 257

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 127/246 (51%), Gaps = 16/246 (6%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+ + EL +FY+  LG     +++      W      R+ G GYA P+   F  K ER 
Sbjct: 1   MRLAVSELERFYAGPLGPAVERSLTAKFYEAWGQGDRLRIAGYGYAQPYLRLFT-KAERL 59

Query: 61  LAFMPAGQGA-TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            A  PAG G     P        LV +   PL D+S+D +L+VH LE A D   +L E+W
Sbjct: 60  AALCPAGSGVRAGGP----VPAVLVDDYAWPLPDASIDRLLIVHGLEEATDTRRLLREVW 115

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVLT  G +I  V N+RG W+ +E +PF +G+P+S  Q+   L+ A F  +  + +L FP
Sbjct: 116 RVLTDDGLVIFAVANRRGPWSLVETSPFAAGRPFSRRQLDLALKAAMFAPTAYAAALHFP 175

Query: 180 PTHKKCILKLWSVFEKIGNIFG--------PGFAGIYVIEARKILYQGLPITESKKKHIS 231
           P   + +L+L  +++++G+           P  AG+ ++EARK     LPI  ++ + + 
Sbjct: 176 PIPNRGLLRLAPLWDRLGDSLDALSIGRLLPNIAGVNLVEARKT--TSLPIGSARAEVLR 233

Query: 232 SPILVP 237
             +  P
Sbjct: 234 PGLFAP 239


>gi|162149077|ref|YP_001603538.1| hypothetical protein GDI_3307 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161787654|emb|CAP57250.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 261

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 116/234 (49%), Gaps = 16/234 (6%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS--------- 51
           M+VDI    +FY+S  G+ T   + + L   W    G R+LGLGY +PF           
Sbjct: 1   MQVDIRAAARFYASRPGENTARLLRQRLQAFWPHTGGDRVLGLGYTLPFLPLWSRPDRGL 60

Query: 52  CFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDP 111
           C   +++  +      + A    D       LV EG LP  +   D V++VH LE    P
Sbjct: 61  CVSARLDTAVTREAPSERAAGIHD------CLVDEGRLPFPELHFDRVVLVHALEVTHRP 114

Query: 112 FLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSI 171
             ++  +W+V+   GR+++VVPN+ G WA  + TPFG G P+S  Q+   L  A      
Sbjct: 115 DDLIRSVWKVMKDDGRLLLVVPNRAGWWAHSDDTPFGQGTPFSPRQITRRLAHAFLRAER 174

Query: 172 TSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
              +LF PP     + +L +V E +G++  PG  G++VIEA K +Y G+P   +
Sbjct: 175 HDGALFLPPV-AAALRRLGAVTEAVGHMLLPGLGGVFVIEAVKDVYSGVPAAPA 227


>gi|209545179|ref|YP_002277408.1| hypothetical protein Gdia_3063 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532856|gb|ACI52793.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 261

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 116/234 (49%), Gaps = 16/234 (6%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS--------- 51
           M+VDI    +FY+S  G+ T   + + L   W    G R+LGLGY +PF           
Sbjct: 1   MQVDIRAAARFYASRPGENTARLLRQRLQAFWPHTGGDRVLGLGYTLPFLPLWSRPDRGL 60

Query: 52  CFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDP 111
           C   +++  +      + A    D       LV EG LP  +   D V++VH LE    P
Sbjct: 61  CVSARLDTAVTREAPSERAAGIHD------CLVDEGRLPFPELHFDRVVLVHALEVTHRP 114

Query: 112 FLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSI 171
             ++  +W+V+   GR+++VVPN+ G WA  + TPFG G P+S  Q+   L  A      
Sbjct: 115 DDLIRSVWKVMKDDGRLLLVVPNRAGWWAHSDDTPFGQGTPFSPRQITRRLAHAFLRAER 174

Query: 172 TSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
              +LF PP     + +L +V E +G++  PG  G++VIEA K +Y G+P   +
Sbjct: 175 HDGALFLPPV-AAALRRLGAVTEAVGHMLLPGLGGVFVIEAVKDVYSGVPAAPA 227


>gi|114762055|ref|ZP_01441523.1| hypothetical protein 1100011001331_R2601_13990 [Pelagibaca
           bermudensis HTCC2601]
 gi|114545079|gb|EAU48082.1| hypothetical protein R2601_13990 [Roseovarius sp. HTCC2601]
          Length = 249

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 110/216 (50%), Gaps = 2/216 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+  LR FY  S LG+    A+   +   W    G  ++G G+A+P    +     R
Sbjct: 1   MHLDVHNLRDFYYRSALGRAAQRAVRDQVQRYWPTGKGHTMVGYGFAVPLLRPYLPDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + T L  E   PL    VD ++M+H LE ++ P  +L E +
Sbjct: 61  VIGLMPGPQGVLPWPQGQLNVTVLCEETLWPLETGHVDRLVMMHGLETSDSPSELLDECY 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+WAR + TPFG G+PYS  Q+ S L+  +F        L+ P
Sbjct: 121 RVLGPGGEALFIVPNRSGLWARSDATPFGYGRPYSLSQLDSQLKRHDFIRQSHVSVLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARK 214
           P+ ++  ++    +E+IG       A G+ ++ A K
Sbjct: 181 PSSRRFWMRTGPAWERIGRAIPALVAGGVLIVRASK 216


>gi|126728274|ref|ZP_01744090.1| hypothetical protein SSE37_19827 [Sagittula stellata E-37]
 gi|126711239|gb|EBA10289.1| hypothetical protein SSE37_19827 [Sagittula stellata E-37]
          Length = 250

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 128/242 (52%), Gaps = 10/242 (4%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTW--DDVTGCRLLGLGYAIPFFSCFHGKV 57
           M +D+  LR FY  S LG+     +   +   W  +DV G  + G G+A+P    +  + 
Sbjct: 1   MHLDVQALRDFYYRSALGRAAQKIMRAEVLRGWSPEDVHGQTVAGYGFAVPMLRPYLKEA 60

Query: 58  ERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
            R +A MPA QG   WP    + + L  E + PL    VD ++++H LE +E P  +L E
Sbjct: 61  RRVVALMPAPQGVMPWPAGLPNVSVLSEEVSWPLETGHVDRLILMHGLETSERPSDLLDE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            +RVL  GGR + ++PN+ G+WAR + TPFG G+PYS  Q+ + L+  +F        L+
Sbjct: 121 AYRVLGPGGRALFILPNRSGLWARADWTPFGYGRPYSIGQLETQLKLHDFVPERHVSVLY 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES---KKKHISSPI 234
            PP+ ++  +K    +E++G +      G+ ++EA K      P T +   +KK + +P+
Sbjct: 181 QPPSARRFWMKTGPFWERLGRLIPFTAGGVMIVEASKR----HPPTRAGLGQKKRVPNPL 236

Query: 235 LV 236
            V
Sbjct: 237 EV 238


>gi|83941359|ref|ZP_00953821.1| hypothetical protein EE36_03983 [Sulfitobacter sp. EE-36]
 gi|83847179|gb|EAP85054.1| hypothetical protein EE36_03983 [Sulfitobacter sp. EE-36]
          Length = 256

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 114/219 (52%), Gaps = 2/219 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQHSLRTRMLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+    VD ++++H LE ++    +L E W
Sbjct: 61  VMTLMPGPQGVMPWPAGMPNTSVLTEETLWPIETGHVDRLVLMHGLETSDRQGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGFWARSDITPFGYGRPYSLGQLETQLRKHQFLPERQLGALYLM 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY 217
           P+ ++   +   +FEK+G       A G +++E  K++Y
Sbjct: 181 PSTRRTFRRAGPLFEKVGRHMPTIMAGGAFMVEVTKLVY 219


>gi|83854836|ref|ZP_00948366.1| hypothetical protein NAS141_08911 [Sulfitobacter sp. NAS-14.1]
 gi|83842679|gb|EAP81846.1| hypothetical protein NAS141_08911 [Sulfitobacter sp. NAS-14.1]
          Length = 248

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 114/219 (52%), Gaps = 2/219 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQHSLRTRMLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+    VD ++++H LE ++    +L E W
Sbjct: 61  VMTLMPGPQGVMPWPAGMPNTSVLTEETLWPIETGHVDRLVLMHGLETSDRQGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGFWARSDITPFGYGRPYSLGQLETQLRKHQFLPERQLGALYLL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILY 217
           P+ ++   +   +FEK+G       A G +++E  K++Y
Sbjct: 181 PSTRRTFRRAGPLFEKVGRHMPTIMAGGAFMVEVTKLVY 219


>gi|329849722|ref|ZP_08264568.1| methyltransferase domain protein [Asticcacaulis biprosthecum C19]
 gi|328841633|gb|EGF91203.1| methyltransferase domain protein [Asticcacaulis biprosthecum C19]
          Length = 246

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 94/180 (52%), Gaps = 1/180 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  + EL +FY++  G      ++  L   W DV G  +LG+GY  P+   F  +  R 
Sbjct: 1   MRRSVEELNRFYAAPEGVVARRLVTAKLCEAWPDVRGLDVLGIGYCTPYLDRFV-EARRV 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           L  MPA QGA  WP        LV E  LP   +  D +LMVH LE +  P  +L E  R
Sbjct: 60  LQAMPAAQGAEIWPADLKVRATLVEEEALPFPTALFDRILMVHALEESPTPHGLLCEASR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L+  GR+I+ V  + G WA  E TPFG GQPYS  Q+ + LR+A       S +L+ PP
Sbjct: 120 LLSPAGRLIIGVAARGGFWAHAEKTPFGYGQPYSRMQLENALRDAELEPLAWSYALYTPP 179


>gi|117924956|ref|YP_865573.1| methyltransferase type 11 [Magnetococcus sp. MC-1]
 gi|117608712|gb|ABK44167.1| Methyltransferase type 11 [Magnetococcus sp. MC-1]
          Length = 256

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 123/238 (51%), Gaps = 4/238 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M ++ + L+++Y+S  G C ++ + + L     +      L LGYA P+        +R 
Sbjct: 1   MNLEALSLQRWYASQQGYCVSNILGETLKAWLKNRPVETTLALGYAQPYLPELTSASKRL 60

Query: 61  LAFMPAGQGATNWP--DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           L   PA  G       D  +    L  +  LP+AD+S+D V+M H +E   D   +L E+
Sbjct: 61  LIGTPAEMGVVRRASCDGCYGQLILRPDA-LPVADASIDRVVMCHLMEGLGDTNGVLREV 119

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           WRVL  GGR++ VVPN+ G WAR + +PFG G+P+S  Q+   L +A F    TS +LF 
Sbjct: 120 WRVLKPGGRLLCVVPNRGGWWARRDGSPFGWGRPFSPRQLSEQLEDALFVTRQTSFALFM 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPIL 235
           PP     +++  S +EK G  +     G+   EA K++Y   P+  +S  + +S P +
Sbjct: 180 PPFSSPRLIRGASRWEKAGQRWFAPLGGVIFCEAEKLVYAMTPLKVKSFIRKVSVPAI 237


>gi|330993946|ref|ZP_08317876.1| ATP synthase subunit [Gluconacetobacter sp. SXCC-1]
 gi|329758892|gb|EGG75406.1| ATP synthase subunit [Gluconacetobacter sp. SXCC-1]
          Length = 250

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 18/220 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS--------CFHGKVERTL 61
            FY++  G+     + + ++  W + T  R LGLGYA+PF          CF  +++  +
Sbjct: 6   HFYATHRGRVAARLLGQRMTAFWPEGTQGRTLGLGYALPFLPLWEREDAPCFSARLDTHV 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                 + A  W  +   ++ L     LP  D   D +L++H LE +ED   +L ++W++
Sbjct: 66  T-----RAAPPWQGRDCMASGL----QLPFDDLKFDRILLIHALEVSEDKNSLLRQVWKI 116

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           L   GR+++VVPN+ G+WA  +++PFG G P+S  Q+   L +A F       +L+ PP 
Sbjct: 117 LRDDGRLLLVVPNRAGLWAHADNSPFGQGTPFSRRQISRWLADACFRAERHEDALYIPPA 176

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
              C      + E  G    P   G+ +IEA K +Y G+P
Sbjct: 177 -GPCPTAPVGMVEWTGRNLFPRLGGVCLIEAVKDIYAGVP 215


>gi|58038756|ref|YP_190720.1| putative methyltransferase [Gluconobacter oxydans 621H]
 gi|58001170|gb|AAW60064.1| Putative methyltransferase [Gluconobacter oxydans 621H]
          Length = 243

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 107/222 (48%), Gaps = 13/222 (5%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS-----CFHGKVERTLAFMP 65
           FY S  G+ T   ++  L +    + G R+LG+GY  P+          G+++      P
Sbjct: 16  FYESRQGQRTALLLNDRLQSIMPPMRGRRILGIGYTAPYLPESAEFAVSGRLQH-----P 70

Query: 66  AGQGATNWPDQYFS-STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
             Q  T    +    +  +VS G LP  D S++ VL+VH LEF       L  IWR L+ 
Sbjct: 71  QTQRTTRSQTRNIPWADCIVSSGRLPFDDLSMNAVLVVHGLEFTRFAPDFLRAIWRTLSD 130

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
            G + +VVPN+ G WA  + TPFG G PYS  Q+  LL +A F +   S +L  PP    
Sbjct: 131 DGVLTLVVPNRSGYWAHTDATPFGHGIPYSSGQLTRLLDQALFRIEHHSSALMTPPA--A 188

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK 226
             +    + E+ G        G++V+ ARK +Y G P+ + K
Sbjct: 189 LSVTQGRLMERAGRTLRLPCGGVHVVTARKNVYAGTPLIDEK 230


>gi|296116639|ref|ZP_06835249.1| hypothetical protein GXY_12568 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976851|gb|EFG83619.1| hypothetical protein GXY_12568 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 282

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 107/230 (46%), Gaps = 30/230 (13%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRL-------------LGLGYAIPFFS----- 51
           QFY+S  G+     + + LS+ W      R+             LG+GYA P+ S     
Sbjct: 10  QFYASPRGRLAATHLRRHLSSFWPAAPEERMGGQVRGQMVQGQILGVGYAAPYLSLWDND 69

Query: 52  ---CFHGKVERTLAFMPA-GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEF 107
              C   +++ TL   PA  +GAT           +V+E   P  +   D V+M+H LE 
Sbjct: 70  TTTCVSARLD-TLVTRPAPAEGATG-------RECVVAEERFPFCELFFDRVVMIHALEV 121

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANF 167
            +    +L ++W+V+    R+++VVPN+ GMWA  + +PFG G P+S+ Q+   L  A  
Sbjct: 122 TDARNTLLRQVWKVMKDDARLLLVVPNRSGMWAHADTSPFGQGTPFSYRQVTRALATACL 181

Query: 168 TLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
            +     +L+FPP       +   + E+ G    P   G+ VIEA K  Y
Sbjct: 182 RVERHENALYFPPVGPTGGRRWSGMLERAGTRLLPYLGGVCVIEAVKDAY 231


>gi|262277920|ref|ZP_06055713.1| putative SAM-dependent methyltransferase protein [alpha
           proteobacterium HIMB114]
 gi|262225023|gb|EEY75482.1| putative SAM-dependent methyltransferase protein [alpha
           proteobacterium HIMB114]
          Length = 235

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 109/225 (48%), Gaps = 11/225 (4%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLST---TWDDVT-GCRLLGLGYAIPFFSCFHGK 56
           M +DI+  ++FY S +GK     I   L      +D+   GC     GYA P+ S F  +
Sbjct: 1   MYLDILNYQKFYVSAIGKFLAHRIENQLKKYCYLYDNQNIGC----FGYAHPYLS-FLKE 55

Query: 57  VERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLH 116
              ++++  + +   +          L+ E  +P  DS  D V ++HYLE   +  L L 
Sbjct: 56  YNLSISYCYSKRMGISDEAVIKGKKILIDEERIPFQDSFFDHVFLIHYLENNNNTKLSLR 115

Query: 117 EIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
           EIWR L+  G++ +++PNK+  W   + +PF SG  +S  Q+  LL E+ F +    R +
Sbjct: 116 EIWRSLSPEGKLYILIPNKKSSWYLSDKSPFSSGNGFSKKQISQLLEESFFDIQSIERLI 175

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           +FP  + K I     + EK G+I    F G+Y    +K +Y  + 
Sbjct: 176 YFPNLNIKFINH--DLIEKFGSILFKYFNGVYFCVVKKRIYANIK 218


>gi|330813477|ref|YP_004357716.1| SAM-dependent methyltransferase 2 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486572|gb|AEA80977.1| SAM-dependent methyltransferase 2 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 237

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 107/218 (49%), Gaps = 2/218 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI++L +FY S LGK   D I   L          +L   G+  P+ S    K    
Sbjct: 1   MYQDIIKLEKFYQSELGKAVQDRIYSKLKKYIYLHDEEKLGSFGFGEPYLSLLPKKKASI 60

Query: 61  LAFMPAGQG-ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
             F     G   N  ++ FS+  L+ E  LP+ D  ++ ++ +H LE +E+    L E+W
Sbjct: 61  FNFFSQQMGIKKNIINERFSNV-LLDEEQLPIEDLFLNHIICIHCLEHSENLKKTLRELW 119

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL+  G++ +++PNK+  W+    +PF SG  +S  Q+  +L +  F +    R ++FP
Sbjct: 120 RVLSPEGKIYIILPNKKSSWSFSSKSPFSSGFGFSKNQITRVLEDNFFEIQSIDRLVYFP 179

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
             + + +L      EKIG+ F   F G Y+  A K +Y
Sbjct: 180 SWNSRLLLNNRFFLEKIGSYFWRFFNGFYLCVATKRIY 217


>gi|46203966|ref|ZP_00209189.1| hypothetical protein Magn03004620 [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 54/94 (57%)

Query: 1  MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
          MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 1  MRLDVTDLRAFYASPLGVVTHRVVGRAIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 60

Query: 61 LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADS 94
          LAFMPA QG  NWP    S TAL     LPL ++
Sbjct: 61 LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEA 94


>gi|23004411|ref|ZP_00047755.1| COG0500: SAM-dependent methyltransferases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 113

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 132 VPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
           +PN+ G+WAR + TPFG GQPYS  Q+  L+RE  F+    + +L+ PP   +  L+  +
Sbjct: 1   MPNRTGVWARRDATPFGHGQPYSRSQLSRLMRETLFSPEGWAETLYMPPIRSRFWLRSAA 60

Query: 192 VFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVP 237
            +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP
Sbjct: 61  AWERFGTGLAMPFAGLHVVDATKQLYRPVTVRQVRRLESRVPARVLVP 108


>gi|260893457|ref|YP_003239554.1| Methyltransferase type 11 [Ammonifex degensii KC4]
 gi|260865598|gb|ACX52704.1| Methyltransferase type 11 [Ammonifex degensii KC4]
          Length = 225

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 63/131 (48%), Gaps = 2/131 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP  D+S D V+    LEF  +P   L E+WRVL  GGR++V V N R  WAR      
Sbjct: 95  SLPFPDASFDAVVCFTALEFVAEPERALEEMWRVLKPGGRLLVGVLNHRSSWARRRKGKG 154

Query: 147 -FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
            F     YS  ++  LLR+ N         ++FPP     +  L  +FE +G +F    A
Sbjct: 155 VFAHAHFYSVRELEQLLRKLNPCRVKWQGVIYFPPELPSWLFSLVPLFEFLGRLFFKSSA 214

Query: 206 GIYVIEARKIL 216
            + +  A K L
Sbjct: 215 AVLIFRADKCL 225


>gi|288940136|ref|YP_003442376.1| type 11 methyltransferase [Allochromatium vinosum DSM 180]
 gi|288895508|gb|ADC61344.1| Methyltransferase type 11 [Allochromatium vinosum DSM 180]
          Length = 255

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 98/219 (44%), Gaps = 23/219 (10%)

Query: 8   LRQFYSSFLGKCTT----DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           L+ +Y S LG        D + ++L+ T+    G  L+ +G +  F         R    
Sbjct: 14  LQAWYRSALGAEVANHEGDCVRRLLANTF----GYYLVQVGASERFGEALTASRIRHRVL 69

Query: 64  MPAGQGATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           +P        P       ++V E + LPLA  S+D VL+ H LE+++ P  +L E+ RVL
Sbjct: 70  LPGTP-----PTGAVQGLSIVGEPDALPLASDSIDAVLLPHVLEYSDRPRAILAEVERVL 124

Query: 123 TSGGRMIVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
              GR+I++  +   +WA            P+ +G+     Q+   L E  F + +  R+
Sbjct: 125 IPEGRLILLGFDPLSLWALGRLWWPACRRAPW-NGRWRLAVQVEHWLNELGFEIEVCERA 183

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           LF PP       +  +  E +G  F P F G+YVI A K
Sbjct: 184 LFCPPIVSPAGARC-ATIESLGRRFWPLFGGLYVIRAVK 221


>gi|258541870|ref|YP_003187303.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632948|dbj|BAH98923.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636005|dbj|BAI01974.1| methyltransferase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639060|dbj|BAI05022.1| methyltransferase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642114|dbj|BAI08069.1| methyltransferase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645169|dbj|BAI11117.1| methyltransferase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648224|dbj|BAI14165.1| methyltransferase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651277|dbj|BAI17211.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654268|dbj|BAI20195.1| methyltransferase [Acetobacter pasteurianus IFO 3283-12]
          Length = 257

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 89/211 (42%), Gaps = 2/211 (0%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCR-LLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
           FY++  G+C    + + L   W D+     +LGLG+A  +        + T A + AG  
Sbjct: 11  FYTTARGQCFLALVGERLRWFWPDLGQQHAVLGLGHAAAYLEKLESG-KNTPACLVAGNA 69

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                      + +V   +LP      D VLMVH L+  +    +L    +V+   GR++
Sbjct: 70  PQWGAAPPLGRSCVVDMHSLPFQPEQFDRVLMVHALDDRKQSVSVLRAAGQVMKPDGRLL 129

Query: 130 VVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
           ++VP++ G  AR+  TPF     +S   +  +L  A         +LF P    + +   
Sbjct: 130 LIVPSRFGGRARLRGTPFRHDAAFSRRCLRQMLAAAMLKPEQWDEALFLPTGAMRWMRHN 189

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
               +  G +  PG   + ++EA +  Y  L
Sbjct: 190 GRKMDIAGKVLCPGAGSLILVEAVRDEYSAL 220


>gi|237748735|ref|ZP_04579215.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380097|gb|EEO30188.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 266

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 83/165 (50%), Gaps = 13/165 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP A  S+D +++ H  EFAE+P ++L E+ RVL   G++I+   N   +W   +     
Sbjct: 95  LPFASESIDLIILPHAFEFAENPHMILREVDRVLIPEGQVIISGFNPASLWGLRQSIGKL 154

Query: 149 SGQPY--SWYQMISL------LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
           +G  +  S+ + I L      L+  NF ++      + PP   +  LK ++  EK GN +
Sbjct: 155 TGAYFLPSYAEFIGLPRLKDWLKLLNFEINRGHFGCYRPPCRTRHWLKRFAFMEKAGNRW 214

Query: 201 GPGFAGIYVIEARKILYQGLPITES----KKKHISSPILVPHTVS 241
            P   G+Y+I+A K ++ G+ + ++    + + I   I V H  S
Sbjct: 215 WPFLGGVYLIQAIKRIH-GVHLIDAAFRKRPRQIFQTIPVNHKTS 258


>gi|171463547|ref|YP_001797660.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193085|gb|ACB44046.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 272

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 8/139 (5%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
            S   LP A  S+D +++ H LEFA DP  +L E+ RVL   GR+I+   N   +W   +
Sbjct: 93  ASSTELPFASESLDLIVLPHVLEFAADPHQILREVDRVLRPEGRLIISGFNPTSLWGAKQ 152

Query: 144 HTPFGSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
           +     G PY        S   +   L   NF+L       +  P   + +++  +  EK
Sbjct: 153 YLSRLVGSPYLPRDGQFISLIHLKDWLELLNFSLDRGHFGCYKFPLQGEAVMRKMNFLEK 212

Query: 196 IGNIFGPGFAGIYVIEARK 214
           +GN + P F  ++++ A K
Sbjct: 213 MGNRWWPIFGAVFLVSAIK 231


>gi|329114358|ref|ZP_08243120.1| Methyltransferase Type [Acetobacter pomorum DM001]
 gi|326696434|gb|EGE48113.1| Methyltransferase Type [Acetobacter pomorum DM001]
          Length = 257

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 96/231 (41%), Gaps = 8/231 (3%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCR-LLGLGYAIPFFSCFHGKVERTLAFMPAGQ- 68
           FY++  G+C    + + L   W D+     +LGLG+   +              + A   
Sbjct: 11  FYTTARGQCFLALVGERLHWFWPDLGQQHAVLGLGHTAAYLEKLENGRATPACLVAANAP 70

Query: 69  --GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
             GAT+ P    S + +V   +LP      D VLMVH L+  +    +L    +V+   G
Sbjct: 71  LWGATSTP----SLSCVVDLHSLPFQPKQFDRVLMVHALDDRQHSVSVLRAAGQVMKPDG 126

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
           R++++VP++ G  AR+  TPF     +S   +   L  A         +LF P    + +
Sbjct: 127 RLLLIVPSRFGGRARLRGTPFRHDAAFSRRCLKQTLASAMLKPEQWDEALFLPTGAMRWM 186

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  +  G +  PG   + ++EA +  Y  L +    ++   +  L+P
Sbjct: 187 RHNGRKMDIAGKMLCPGAGSLILVEAVRDEYSALSLPVKARQRWLARSLLP 237


>gi|254491115|ref|ZP_05104296.1| hypothetical protein MDMS009_1447 [Methylophaga thiooxidans DMS010]
 gi|224463628|gb|EEF79896.1| hypothetical protein MDMS009_1447 [Methylophaga thiooxydans DMS010]
          Length = 243

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 7/160 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP    S+D +L++H LE+A+DP  +L E  RVL + G++I+   N   +W       + 
Sbjct: 76  LPFRSHSIDNLLLLHVLEYADDPHQVLRETERVLAADGKVILCCFNPISLWGLRRLFSWQ 135

Query: 149 SGQPYSWY-----QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPG 203
              P+  Y     ++   L   NF ++   + LF PP      L+     E+ G    P 
Sbjct: 136 DAAPWHGYFFTKTRLKDWLALLNFEVTEQHKILFRPPFKHPRWLEGSHFLERWGKRLWPW 195

Query: 204 FAGIYVIEARKILYQGLPITESKKKH--ISSPILVPHTVS 241
           F  + V+ A K      P+ E+K++H    SP LV   ++
Sbjct: 196 FGAVSVMVATKRTIPLTPLRENKRQHRLFPSPGLVNKPIT 235


>gi|113868433|ref|YP_726922.1| methyltransferase [Ralstonia eutropha H16]
 gi|113527209|emb|CAJ93554.1| Methyltransferase [Ralstonia eutropha H16]
          Length = 243

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 74/164 (45%), Gaps = 15/164 (9%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------R 141
            LP    S+D V + H LEFAEDP  +L E+ RVL   GR++V   N   +W       R
Sbjct: 69  ELPFDTQSIDLVTLPHILEFAEDPHEVLREVSRVLMPEGRVVVTCFNPMSLWGARQGMNR 128

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           +  TPF     Q   + ++   L+   F +       + PP      L+  +  EK G+ 
Sbjct: 129 LGATPFLPTDAQQIGFVRIKDWLKLLGFDIIRGRFGCYCPPYRTDRWLQRAAFMEKAGDR 188

Query: 200 FGPGFAGIYVIEA----RKILYQGLPITESKK--KHISSPILVP 237
           + P F  +Y+I A    R I   G P  +SK     +SSP+  P
Sbjct: 189 WWPIFGAVYMISAIKRVRNIRLVG-PAWKSKPALAPVSSPVATP 231


>gi|220934130|ref|YP_002513029.1| Methyltransferase type 11 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995440|gb|ACL72042.1| Methyltransferase type 11 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 260

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 65/142 (45%), Gaps = 8/142 (5%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN----- 134
           +  L     LP+   ++D V++ H LEF  DP  +L E+ R L   G +++V  N     
Sbjct: 87  AQVLAQPRALPVQSDTLDVVVLAHVLEFCSDPHQVLREVDRTLVPEGHLLIVGFNPFSLM 146

Query: 135 --KRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
             +R    R    P+  G+ YS +++   LR   F L     + F PP     +L+    
Sbjct: 147 GLRRLFAGRGGMAPW-RGRYYSVFRIKDWLRLLGFDLVACVPAGFRPPLRGAGLLRRLQF 205

Query: 193 FEKIGNIFGPGFAGIYVIEARK 214
            E +G  F P F G YVI ARK
Sbjct: 206 METLGARFWPYFGGAYVILARK 227


>gi|187929119|ref|YP_001899606.1| type 11 methyltransferase [Ralstonia pickettii 12J]
 gi|187726009|gb|ACD27174.1| Methyltransferase type 11 [Ralstonia pickettii 12J]
          Length = 262

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 80/183 (43%), Gaps = 17/183 (9%)

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
           G+  T+ P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   G
Sbjct: 57  GEPDTSTPPRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEG 116

Query: 127 RMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSR 174
           R+I+   N   +W       R+    F   Q     QMI+  R  +      F +     
Sbjct: 117 RLIITGFNPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRF 172

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
             + PP      L+  +  EK G+ + P F  +Y+++A K + + + +     K   SP 
Sbjct: 173 GCYCPPNRSDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RSMRLVGPAWKTRKSPA 231

Query: 235 LVP 237
           LVP
Sbjct: 232 LVP 234


>gi|309782458|ref|ZP_07677182.1| methyltransferase type 11 [Ralstonia sp. 5_7_47FAA]
 gi|308918795|gb|EFP64468.1| methyltransferase type 11 [Ralstonia sp. 5_7_47FAA]
          Length = 265

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 80/183 (43%), Gaps = 17/183 (9%)

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
           G+  T+ P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   G
Sbjct: 60  GEPDTSTPPRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEG 119

Query: 127 RMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSR 174
           R+I+   N   +W       R+    F   Q     QMI+  R  +      F +     
Sbjct: 120 RLIITGFNPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRF 175

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
             + PP      L+  +  EK G+ + P F  +Y+++A K + + + +     K   SP 
Sbjct: 176 GCYCPPNRSDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RAMRLVGPAWKTRKSPS 234

Query: 235 LVP 237
           LVP
Sbjct: 235 LVP 237


>gi|194290093|ref|YP_002006000.1| hypothetical protein RALTA_A1996 [Cupriavidus taiwanensis LMG
           19424]
 gi|193223928|emb|CAQ69937.1| conserved hypothetical protein, putative methyltransferase
           [Cupriavidus taiwanensis LMG 19424]
          Length = 266

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 74/164 (45%), Gaps = 15/164 (9%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------R 141
            LP    S+D V + H LEFAEDP  +L E+ RVL   GR++V   N   +W       R
Sbjct: 92  ELPFDTQSIDLVTLPHILEFAEDPHEVLREVSRVLMPEGRVVVTCFNPVSLWGARQGMNR 151

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           +  TPF     Q   + ++   L+   F +       + PP      L+  +  EK G+ 
Sbjct: 152 LGATPFLPTDAQQIGFVRIKDWLKLLGFDIIRGRFGCYCPPYRTDRWLQRTAFMEKAGDR 211

Query: 200 FGPGFAGIYVIEA----RKILYQGLPITESKK--KHISSPILVP 237
           + P F  +Y+I A    R I   G P  +SK     +S+P+  P
Sbjct: 212 WWPIFGAVYMISAIKRVRNIRLVG-PAWKSKPALAPVSAPVATP 254


>gi|291613976|ref|YP_003524133.1| methyltransferase type 11 [Sideroxydans lithotrophicus ES-1]
 gi|291584088|gb|ADE11746.1| Methyltransferase type 11 [Sideroxydans lithotrophicus ES-1]
          Length = 249

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 86/214 (40%), Gaps = 21/214 (9%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L ++ SS  G        +    T  D+ G   L LG  +P     H      L F    
Sbjct: 11  LSEWSSSEQGNYVLKREQEYFDRTVSDIFGFNALQLG--LPEHDFLHSS-RMPLRFTAGN 67

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q   N           +    LP    S+D VL+ H LEFAE+P  +L E+ RVL   G 
Sbjct: 68  QAGNN---------VRLRCDELPFDSDSLDLVLLPHVLEFAENPHQILREVERVLRPEGN 118

Query: 128 MIVVVPNKRGMWARMEHTPFGSGQPYSWY-QMISLLREAN------FTLSITSRSLFFPP 180
           +I+   N   +W    H   G  Q Y W  + I L R  +      F ++    + + PP
Sbjct: 119 LIISGFNPFSLWGL--HRALGRKQGYPWRGRFIRLPRLKDWLALLGFEVAGGRFAAYAPP 176

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            H+   L+ ++  EK G+ +     G+Y + A K
Sbjct: 177 LHQSRWLERFAFMEKAGDRWWAVSGGVYFLHAIK 210


>gi|300691208|ref|YP_003752203.1| S-adenosyl-L-methionine-dependent methyltransferase [Ralstonia
           solanacearum PSI07]
 gi|299078268|emb|CBJ50916.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Ralstonia solanacearum PSI07]
          Length = 257

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 72/162 (44%), Gaps = 17/162 (10%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------R 141
            LP A  S+D V + H LEF +DP  +L E+ RVL   GR+I+   N   +W       R
Sbjct: 73  ELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLIITGFNPLSLWGMRQGMRR 132

Query: 142 MEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEK 195
           +    F   Q     QMI+  R  +      F +       + PP      L+  +  EK
Sbjct: 133 LGTASFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPNRTDKWLQRTAFMEK 188

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            G+ + P F  IY+++A K + +G  +     K   SP LVP
Sbjct: 189 AGDRWWPIFGAIYMLQAVKRV-RGTRLVGPAWKTRKSPALVP 229


>gi|153873915|ref|ZP_02002331.1| generic methyl-transferase [Beggiatoa sp. PS]
 gi|152069622|gb|EDN67670.1| generic methyl-transferase [Beggiatoa sp. PS]
          Length = 222

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 92/220 (41%), Gaps = 19/220 (8%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV---ERTLAF 63
           +L Q++ S LGK      + +L      + G  LL +G      S  HG +    R +  
Sbjct: 7   QLNQWFESPLGKRLLLEEANILQQILPHLFGYHLLQIG------SVGHGYLLENSRIMHR 60

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
             + Q A      Y S   L     LP A  S+D V++ H LEF EDP  +L E+ R+L 
Sbjct: 61  CVSSQNANTIIKPYTSVYGLPDA--LPFARDSIDVVVLPHILEFEEDPHEILREVERILI 118

Query: 124 SGGRMIVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
             G ++++  N   +W        R E+ P+  G+  S  ++   L    F L       
Sbjct: 119 PDGYVVILGFNPISLWGIWRLILKRRENAPW-CGRFLSSLRIKDWLALLGFDLKQQQTFF 177

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL 216
           F  P +         + EK+G  +   F  +Y++ A+ +L
Sbjct: 178 FALPFYNDRFRNYTKLLEKMGVHWAGNFGAVYLLVAKNVL 217


>gi|145589206|ref|YP_001155803.1| methyltransferase type 11 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047612|gb|ABP34239.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 272

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 12/148 (8%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V EG+   LP A+ ++D +++ H LEFA DP  +L E+ RVL   GR+++   N   +W 
Sbjct: 90  VIEGDSAELPFANETIDLIVLPHVLEFAADPHQILREVDRVLRPEGRLVISGFNPASLWG 149

Query: 141 RMEHTPFGSGQPY--SWYQMISLLREA------NFTLSITSRSLFFPPTHKKCILKLWSV 192
             ++     G PY     Q ISL+R        N++L       +  P      +     
Sbjct: 150 ARQYLSRLIGSPYLPRDGQFISLIRVKDWLQLLNYSLDRGHFGCYKFPLQGHSAMGRMDF 209

Query: 193 FEKIGNIFGPGFAGIYVIEARKILYQGL 220
            EK+GN + P F  ++++ A K  +QG+
Sbjct: 210 LEKMGNRWWPIFGAVFLVSAIK-RHQGM 236


>gi|207723985|ref|YP_002254383.1| generic methyltransferase; protein [Ralstonia solanacearum MolK2]
 gi|206589193|emb|CAQ36155.1| generic methyltransferase; protein [Ralstonia solanacearum MolK2]
          Length = 297

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 76/176 (43%), Gaps = 17/176 (9%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P +  +   +     LP A  S+D   + H LEF +DP  +L E+ RVL   GR+++   
Sbjct: 99  PRRQATPRVICRYDELPFASQSIDLAALPHVLEFTDDPHEVLREVARVLMPEGRLVITGF 158

Query: 134 NKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPT 181
           N   +W       R+    F   Q     QMI+  R  +      F +       + PP 
Sbjct: 159 NPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPN 214

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                L+  +  EK G+ + P F  +Y+++A K + +G+ +     K   SP LVP
Sbjct: 215 RTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RGMRLVGPAWKTRKSPALVP 269


>gi|94311145|ref|YP_584355.1| methyltransferase type 11 [Cupriavidus metallidurans CH34]
 gi|93354997|gb|ABF09086.1| Methyltransferase-like protein [Cupriavidus metallidurans CH34]
          Length = 264

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 73/164 (44%), Gaps = 14/164 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------R 141
            LP    S+D V + H LEF+EDP  +L E+ RVL   GR++V   N   +W       R
Sbjct: 89  ELPFDTQSIDLVTLPHVLEFSEDPHEVLREVSRVLMPEGRVVVTCFNPMSLWGARQGLNR 148

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           +   PF     Q   + ++   L+   F +       + PP   +  L+  +  EK G+ 
Sbjct: 149 LGAMPFLPSDAQTIGFVRIKDWLKLLGFEIIRGRFGCYCPPYRTERWLQRAAFMEKAGDR 208

Query: 200 FGPGFAGIYVIEARK------ILYQGLPITESKKKHISSPILVP 237
           + P F  +Y+I A K      ++       +S  K +++P+  P
Sbjct: 209 WWPIFGAVYMISAVKRVKNIRLVGPAWKTPKSALKPVAAPVATP 252


>gi|238026773|ref|YP_002911004.1| hypothetical protein bglu_1g11310 [Burkholderia glumae BGR1]
 gi|237875967|gb|ACR28300.1| Hypothetical protein bglu_1g11310 [Burkholderia glumae BGR1]
          Length = 270

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 74/164 (45%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   GR+++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTADPHRLLREAERVLMPEGRLVITGFNSLSLWGARQSVGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           + + PF   +  P ++ ++   ++   F +       + PP      +  ++  E  G+ 
Sbjct: 161 IANRPFVPAARDPIAFIRLKDWMKLLGFDIERGRFGCYRPPLASDKWMARYAFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K + +   +   + +K + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVREMRLVGPIRVRKPVRAPGLAPAATPT 264


>gi|307730500|ref|YP_003907724.1| methyltransferase type 11 [Burkholderia sp. CCGE1003]
 gi|307585035|gb|ADN58433.1| Methyltransferase type 11 [Burkholderia sp. CCGE1003]
          Length = 311

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 74/170 (43%), Gaps = 19/170 (11%)

Query: 54  HGKVERTLAFMPAGQGATN-WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           HG    T A +PA  G +  W D            +LP    SVD ++M H LEF  DP 
Sbjct: 117 HGPARNTFAPLPAPGGRSAVWCDLL----------DLPFEAQSVDLIVMPHTLEFTSDPH 166

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMISLLRE 164
            +L E  RVL   G++I++  N   +W   +     +G+P+        ++ ++   ++ 
Sbjct: 167 RLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFVPAAVDLIAFTRLKDWIKL 226

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             F L       + PP   +  L  ++  E  G+ + P F   Y+I+A K
Sbjct: 227 LGFDLERGRFGCYRPPLDSEQWLSRYAFMEAAGDRWWPIFGATYMIKAIK 276


>gi|254480609|ref|ZP_05093856.1| Methyltransferase domain family protein [marine gamma
           proteobacterium HTCC2148]
 gi|214039192|gb|EEB79852.1| Methyltransferase domain family protein [marine gamma
           proteobacterium HTCC2148]
          Length = 271

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 99/238 (41%), Gaps = 39/238 (16%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG--YAIPFFSCFHGKVERTLA 62
           + EL  +Y S  G+     I + L    D+  G  +L +G     P F        R +A
Sbjct: 9   LAELETWYDSDRGQYLLQQIKQALQPQLDNAFGYHILQIGPLSGDPLFGACRIN-HRIMA 67

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
               G+G          +  +   G +PL   SVD V+  H LEF ++P  +L E+ R+L
Sbjct: 68  CDSGGEG----------TNLICQAGEIPLESDSVDVVIAHHTLEFVDNPHQVLRELHRIL 117

Query: 123 TSGGRMIVVVPNK---RGMWARME----------HTPFGSGQPYSWYQMISL-LREAN-- 166
           T  G+++++  N    RG+  R++          H P    +   W  ++   LRE N  
Sbjct: 118 TPQGQLLILGFNPHSLRGLVTRIKGLSKRSFWQAHRPVSISRLSDWLHLLGFELREGNHL 177

Query: 167 FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA-RKILYQGLPIT 223
           + +  T ++ F   T     L  W V  K+         G+Y+  A +++  Q  P++
Sbjct: 178 YVVPPTGQARFRAAT---ASLDKWCVDHKL------PLGGLYMQAAIKQVAAQNRPLS 226


>gi|212213175|ref|YP_002304111.1| methyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212011585|gb|ACJ18966.1| methyltransferase [Coxiella burnetii CbuG_Q212]
          Length = 243

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 5/152 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           PD   S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+++   
Sbjct: 67  PDNLSSLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRLLIFGF 126

Query: 134 NKRGMWA-----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  KK   +
Sbjct: 127 NPLSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKKKPGRR 186

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
           L    E  G +  P   GIY++ A+K +Y  L
Sbjct: 187 LQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPL 218


>gi|94502171|ref|ZP_01308669.1| SAM-dependent methyltransferase [Oceanobacter sp. RED65]
 gi|94425696|gb|EAT10706.1| SAM-dependent methyltransferase [Oceanobacter sp. RED65]
          Length = 238

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 4/139 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           ++PL ++S+DCVLM H L+F + P   L E  R+    G +++V  N   +W    + P 
Sbjct: 73  DIPLRENSIDCVLMHHVLDFEDKPHQCLREAARITVPNGYVVIVGFNPVSLWGLARYLPK 132

Query: 148 GSGQPYSWY----QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPG 203
            +  P + +    +++  L   +F +         PP   K   K+    +++ ++ G  
Sbjct: 133 TATPPAAQFLAKGRVLDWLSLLDFRVEQVQTFQAMPPWGLKYFRKIGMRLDRLLSLIGNP 192

Query: 204 FAGIYVIEARKILYQGLPI 222
           F   YVI ARK++    PI
Sbjct: 193 FGNCYVIVARKLVAGRTPI 211


>gi|330719520|gb|EGG98127.1| SAM-dependent methyltransferase [gamma proteobacterium IMCC2047]
          Length = 259

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 76/159 (47%), Gaps = 9/159 (5%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK------RGMWARM 142
           LP+A++S+D +++ H LE++ +P  +L E  R L SGG++ V+  N       R + + +
Sbjct: 98  LPIANNSMDAIVLHHILEYSRNPHQILREAHRALNSGGQLFVMAFNPWSLMGVRKLVSPL 157

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           +  P+ +G   SW ++   L    F +  T    F  P +        S  E++G  +  
Sbjct: 158 KRAPW-TGSYRSWMKLNDWLNLLGFKVEHTHYGFFRAPLNTTKGDGNNSKLEQLGRKYNC 216

Query: 203 GFAGIYVIEARKILYQGLPITESKKKH--ISSPILVPHT 239
            F   Y I ARK      P+ E+K K   ++ P+  P T
Sbjct: 217 FFGSTYAIVARKQTVGMTPLHETKLKRRVLTFPLTEPTT 255


>gi|71907226|ref|YP_284813.1| generic methyl-transferase [Dechloromonas aromatica RCB]
 gi|71846847|gb|AAZ46343.1| generic methyl-transferase [Dechloromonas aromatica RCB]
          Length = 238

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 75/168 (44%), Gaps = 6/168 (3%)

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +Y     L +   LP A +S+D V++ H LEF+++P  +L E+ R+L   G++IV+  N 
Sbjct: 62  EYGQVDVLCNYTALPFASNSIDLVVLPHILEFSDEPHQILREVERILIPEGQVIVIGFNP 121

Query: 136 RGMWARMEHTPFGSGQPY-----SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
             +W            P+     S  ++   L+   F +   S   + PP  +   L+ W
Sbjct: 122 LSLWGLKRKLDRNGEYPWNGTYLSINRLKDWLKLLGFEVDRGSLGCYVPPVDQLKWLQNW 181

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVP 237
              E   N +     G+YV+ A K  +    IT   KK+ + +  L P
Sbjct: 182 RFIENATNRWWNFSGGVYVLRAIKRTHSMRLITPKWKKQAVRAKALRP 229


>gi|312795586|ref|YP_004028508.1| methyltransferase [Burkholderia rhizoxinica HKI 454]
 gi|312167361|emb|CBW74364.1| Methyltransferase (EC 2.1.1.-) [Burkholderia rhizoxinica HKI 454]
          Length = 270

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 9/159 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP    SVD +++ H LEF  DP  +L E  RVL   GR+++V  N   +W   +    
Sbjct: 105 DLPFESQSVDLLILPHTLEFTHDPHRLLREAERVLVPEGRLVIVGFNSLSLWGMRQSISR 164

Query: 148 GSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
             G  +        ++ +M   ++   F L       + PP   +  L  ++  E  G+ 
Sbjct: 165 RGGHAFVPAAHDLIAFTRMKDWIKLLGFELDRGRFGCYRPPVDTEKWLARYAFMEAAGDR 224

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVP 237
           + P F   Y+I A K ++    I  +K KK   +P L P
Sbjct: 225 WWPIFGAAYMITAIKRVHGMRLIGPAKIKKQALTPALNP 263


>gi|167836207|ref|ZP_02463090.1| hypothetical protein Bpse38_06926 [Burkholderia thailandensis
           MSMB43]
          Length = 270

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 100/244 (40%), Gaps = 30/244 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH---GKVERTLAFMPAG 67
           F++  LG    DA+        ++   CR L L  A    + +H    +  R+    PAG
Sbjct: 39  FHALQLGLPQLDALR-------ENRMPCRGLVLDPASGASAPYHYPWAREARSAEHAPAG 91

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + +T W D            +LP    SVD ++M H LEF  DP  +L E  RVL   G+
Sbjct: 92  R-STVWCDLL----------DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQ 140

Query: 128 MIVVVPNKRGMW------ARMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           +++   N   +W       +M   PF   +    ++ ++   ++   F L       + P
Sbjct: 141 LVITGFNSLSLWGARHSVGKMARRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRP 200

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPH 238
           P      L  ++  E  G+ + P F  +Y++ A +++    L      KK + +P L P 
Sbjct: 201 PLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVRAPGLTPA 260

Query: 239 TVST 242
              T
Sbjct: 261 ATPT 264


>gi|83747772|ref|ZP_00944806.1| Methyltransferase [Ralstonia solanacearum UW551]
 gi|207742895|ref|YP_002259287.1| generic methyltransferase; protein [Ralstonia solanacearum IPO1609]
 gi|83725544|gb|EAP72688.1| Methyltransferase [Ralstonia solanacearum UW551]
 gi|206594290|emb|CAQ61217.1| generic methyltransferase; protein [Ralstonia solanacearum IPO1609]
          Length = 297

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 75/176 (42%), Gaps = 17/176 (9%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P +  +   +     LP A  S+D   + H LEF +DP  +L E+ RVL   GR+++   
Sbjct: 99  PRRQATPRVICRYDELPFASQSIDLAALPHVLEFTDDPHEVLREVARVLMPEGRLVITGF 158

Query: 134 NKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPT 181
           N   +W       R+    F   Q     QMI+  R  +      F +       + PP 
Sbjct: 159 NPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPN 214

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                L+  +  EK G+ + P F  +Y+++A K + +G  +     K   SP LVP
Sbjct: 215 RTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RGTRLVGPAWKTRKSPALVP 269


>gi|241663327|ref|YP_002981687.1| type 11 methyltransferase [Ralstonia pickettii 12D]
 gi|240865354|gb|ACS63015.1| Methyltransferase type 11 [Ralstonia pickettii 12D]
          Length = 262

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 76/176 (43%), Gaps = 17/176 (9%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+++   
Sbjct: 64  PQRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLVITGF 123

Query: 134 NKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPT 181
           N   +W       R+    F   Q     QMI+  R  +      F +       + PP 
Sbjct: 124 NPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPN 179

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                L+  +  EK G+ + P F  +Y+++A K + + + +     K   SP LVP
Sbjct: 180 RSDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RAMRLVGPAWKTRKSPSLVP 234


>gi|153208780|ref|ZP_01947012.1| putative methyltransferase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218150|ref|YP_002304937.1| methyltransferase [Coxiella burnetii CbuK_Q154]
 gi|120575742|gb|EAX32366.1| putative methyltransferase [Coxiella burnetii 'MSU Goat Q177']
 gi|212012412|gb|ACJ19792.1| methyltransferase [Coxiella burnetii CbuK_Q154]
          Length = 234

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 5/152 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           PD   S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+++   
Sbjct: 67  PDNLSSLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRLLIFGF 126

Query: 134 NKRGMWA-----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  KK   +
Sbjct: 127 NPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKKKPGRR 186

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
           L    E  G +  P   GIY++ A+K +Y  L
Sbjct: 187 LQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPL 218


>gi|154706774|ref|YP_001425096.1| methyltransferase [Coxiella burnetii Dugway 5J108-111]
 gi|154356060|gb|ABS77522.1| methyltransferase [Coxiella burnetii Dugway 5J108-111]
          Length = 243

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 5/152 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           PD   S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+++   
Sbjct: 67  PDNLSSLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRLLIFGF 126

Query: 134 NKRGMWA-----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  KK   +
Sbjct: 127 NPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKKKPGRR 186

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
           L    E  G +  P   GIY++ A+K +Y  L
Sbjct: 187 LQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPL 218


>gi|161830615|ref|YP_001596266.1| putative methyltransferase [Coxiella burnetii RSA 331]
 gi|161762482|gb|ABX78124.1| putative methyltransferase [Coxiella burnetii RSA 331]
          Length = 243

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 5/152 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           PD   S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+++   
Sbjct: 67  PDNLSSLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRLLIFGF 126

Query: 134 NKRGMWA-----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  KK   +
Sbjct: 127 NPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKKKPGRR 186

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
           L    E  G +  P   GIY++ A+K +Y  L
Sbjct: 187 LQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPL 218


>gi|29653666|ref|NP_819358.1| putative methyltransferase [Coxiella burnetii RSA 493]
 gi|165920932|ref|ZP_02219602.1| putative methyltransferase [Coxiella burnetii RSA 334]
 gi|29540928|gb|AAO89872.1| methyltransferase [Coxiella burnetii RSA 493]
 gi|165916780|gb|EDR35384.1| putative methyltransferase [Coxiella burnetii RSA 334]
          Length = 243

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 5/152 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           PD   S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+++   
Sbjct: 67  PDNLSSLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRLLIFGF 126

Query: 134 NKRGMWA-----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  KK   +
Sbjct: 127 NPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKKKPGRR 186

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
           L    E  G +  P   GIY++ A+K +Y  L
Sbjct: 187 LQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPL 218


>gi|170695450|ref|ZP_02886595.1| Methyltransferase type 11 [Burkholderia graminis C4D1M]
 gi|170139641|gb|EDT07824.1| Methyltransferase type 11 [Burkholderia graminis C4D1M]
          Length = 290

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 19/182 (10%)

Query: 42  GLGYAIPFFSCFHGKVERTLAFMPAGQGATN-WPDQYFSSTALVSEGNLPLADSSVDCVL 100
           G G   P     HG      A +P+  G +  W D            +LP    SVD ++
Sbjct: 84  GNGAGNPTHGATHGPARGAFAPLPSPTGRSAVWCDLL----------DLPFEAQSVDLIV 133

Query: 101 MVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY------- 153
           M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G+P+       
Sbjct: 134 MPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFVPAAVDL 193

Query: 154 -SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA 212
            ++ ++   ++   F L       + PP      L  +   E  G+ + P F   Y+I+A
Sbjct: 194 IAFTRLKDWIKLLGFDLERGRFGCYRPPLDSDQWLSRYGFMEAAGDRWWPIFGATYMIKA 253

Query: 213 RK 214
            K
Sbjct: 254 IK 255


>gi|17546233|ref|NP_519635.1| hypothetical protein RSc1514 [Ralstonia solanacearum GMI1000]
 gi|17428530|emb|CAD15216.1| hypothetical generic methyltransferase; protein [Ralstonia
           solanacearum GMI1000]
          Length = 257

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 76/176 (43%), Gaps = 17/176 (9%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+++   
Sbjct: 59  PQRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLVITGF 118

Query: 134 NKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPT 181
           N   +W       R+    F   Q     QMI+  R  +      F +       + PP 
Sbjct: 119 NPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPN 174

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                L+  +  EK G+ + P F  +Y+++A K + + + +     K   SP LVP
Sbjct: 175 RTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RSVRLVGPAWKTRKSPTLVP 229


>gi|300112988|ref|YP_003759563.1| methyltransferase type 11 [Nitrosococcus watsonii C-113]
 gi|299538925|gb|ADJ27242.1| Methyltransferase type 11 [Nitrosococcus watsonii C-113]
          Length = 256

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 85/180 (47%), Gaps = 13/180 (7%)

Query: 70  ATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           A  WP+    + +L+S  + LP A ++VD +++ H LE+ E+P  +L E+ RVL   G +
Sbjct: 73  AEIWPEA--QAPSLLSHVDALPFASATVDGIILPHVLEYEENPHQVLREVQRVLVPYGTL 130

Query: 129 IVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
            ++  N    W        R    P+  G+ YS  ++   L    F        LF PP 
Sbjct: 131 AILGFNPWSFWGFWRFILYRRGSMPW-CGRFYSPTRIQDWLALLGFKTVELRYFLFRPPL 189

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE--SKKKHISSPILVPHT 239
            +  +++     E IG  + P FAG Y++ A+K + +  PI     +K+ +  P+L   T
Sbjct: 190 RQPRLMRRLRFLELIGRRWCPFFAGGYLVVAKKQVVRLNPIDSLWCEKESLDMPVLAEPT 249


>gi|330816257|ref|YP_004359962.1| hypothetical protein bgla_1g13320 [Burkholderia gladioli BSR3]
 gi|327368650|gb|AEA60006.1| hypothetical protein bgla_1g13320 [Burkholderia gladioli BSR3]
          Length = 270

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 74/164 (45%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
            LP    SVD ++M H LEF  DP  +L E+ RVL   GR+++   N   +W       R
Sbjct: 101 ELPFESQSVDLIVMPHTLEFTADPHGLLREVERVLMPEGRLVITGFNSLSLWGARQSVGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           + + PF   +  P ++ ++   ++   F +       + PP      +  ++  E  G+ 
Sbjct: 161 IANRPFVPTARDPIAFIRLKDWMKLLGFDIERGRFGCYRPPLATDKWMARYAFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K + +   +   + +K + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVREMRLVGPIRVRKPVLAPGLAPAATPT 264


>gi|134095498|ref|YP_001100573.1| hypothetical protein HEAR2320 [Herminiimonas arsenicoxydans]
 gi|133739401|emb|CAL62451.1| Conserved hypothetical protein, putative
           S-adenosyl-L-methionine-dependent methyltransferase
           [Herminiimonas arsenicoxydans]
          Length = 259

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP A SS+D +++ H LEFA++P  +L E+ RVL   G++I+   N   +W       R
Sbjct: 91  DLPFASSSIDLIVLPHVLEFAKEPHQVLREVERVLIPEGQVIISGFNPYSLWGARQLAGR 150

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           +  + F    G+  S  ++   L+  N  +       + PP   +  L  +S  E  G+ 
Sbjct: 151 LSESYFLPEEGEFISPMRLKDWLKLLNMEVGDGHLGCYAPPCETEKWLHRFSFMENAGDK 210

Query: 200 FGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPHTVST 242
           + P    +YV++A +++    L     K +  ++P  VP T  T
Sbjct: 211 WWPFLGAVYVVQAIKRVRGMRLIGPAWKTQKATAPQGVPATNKT 254


>gi|226196222|ref|ZP_03791807.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254298051|ref|ZP_04965504.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157807623|gb|EDO84793.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|225931808|gb|EEH27810.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 250

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 100/244 (40%), Gaps = 30/244 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH---GKVERTLAFMPAG 67
           F++  LG    DA+        ++   CR L L  A    + +H    +  R+    PAG
Sbjct: 19  FHALQLGLPQLDALR-------ENRMPCRGLVLDPASGASAPYHYPWAREARSAEHAPAG 71

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + +T W D            +LP    SVD ++M H LEF  DP  +L E  RVL   G+
Sbjct: 72  R-STVWCDLL----------DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQ 120

Query: 128 MIVVVPNKRGMW------ARMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           +++   N   +W       +M   PF   +    ++ ++   ++   F L       + P
Sbjct: 121 LVITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPH 238
           P      L  ++  E  G+ + P F  +Y++ A +++    L      KK + +P L P 
Sbjct: 181 PLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPA 240

Query: 239 TVST 242
              T
Sbjct: 241 ATPT 244


>gi|257095467|ref|YP_003169108.1| type 11 methyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047991|gb|ACV37179.1| Methyltransferase type 11 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 241

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 67/148 (45%), Gaps = 6/148 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA---RMEH 144
            LP A  S+D ++M H LEF +DP  +L E+ RVL   G +++   N   +W    R+ +
Sbjct: 74  QLPFAAHSIDALVMAHVLEFHDDPHQILREVERVLIPEGEVLITGFNPLSIWGLRRRLPN 133

Query: 145 TPFG---SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
            P     +G   S  ++   L+   F + +     + PP   +  LK W   E  G  + 
Sbjct: 134 CPRDFPWNGHYLSVLRLKDWLQLLGFAVDLVDFGCYVPPCEHERWLKRWHFMEATGARWW 193

Query: 202 PGFAGIYVIEARKILYQGLPITESKKKH 229
               G+Y++ A K ++    I  S K+ 
Sbjct: 194 SFAGGVYLMRAIKRVHAMRLILPSWKQQ 221


>gi|171318242|ref|ZP_02907405.1| Methyltransferase type 11 [Burkholderia ambifaria MEX-5]
 gi|171096586|gb|EDT41480.1| Methyltransferase type 11 [Burkholderia ambifaria MEX-5]
          Length = 270

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAARDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K +     + + K KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVRGMRLVGQIKMKKPVLAPGLTPAATPT 264


>gi|167587484|ref|ZP_02379872.1| Methyltransferase type 11 [Burkholderia ubonensis Bu]
          Length = 270

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   GR+++   N   +W       +
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGRLVITGFNSLSLWGMRQSFGK 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAARDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLASDQWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           + P F  +Y++ A K + +G+ +    K  +  P+L P
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIK--VKKPVLAP 255


>gi|170697941|ref|ZP_02889024.1| Methyltransferase type 11 [Burkholderia ambifaria IOP40-10]
 gi|172060230|ref|YP_001807882.1| methyltransferase type 11 [Burkholderia ambifaria MC40-6]
 gi|170137107|gb|EDT05352.1| Methyltransferase type 11 [Burkholderia ambifaria IOP40-10]
 gi|171992747|gb|ACB63666.1| Methyltransferase type 11 [Burkholderia ambifaria MC40-6]
          Length = 270

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAARDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K +     + + K KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVRGMRLVGQIKMKKPVLAPGLTPAATPT 264


>gi|300703804|ref|YP_003745406.1| s-adenosyl-l-methionine-dependent methyltransferase [Ralstonia
           solanacearum CFBP2957]
 gi|299071467|emb|CBJ42787.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Ralstonia solanacearum CFBP2957]
          Length = 297

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 75/176 (42%), Gaps = 17/176 (9%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P +  +   +     LP A  S+D   + H LEF +DP  +L E+ RVL   GR+++   
Sbjct: 99  PRRQATPRVICRYDELPFASQSIDLAALPHVLEFTDDPHEVLREVARVLMPEGRLVITGF 158

Query: 134 NKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPT 181
           N   +W       R+    F   Q     QMI+  R  +      F +       + PP 
Sbjct: 159 NPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPN 214

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                L+  +  EK G+ + P F  +Y+++A K + + + +     K   SP LVP
Sbjct: 215 RTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV-RSMRLVGPAWKTRKSPALVP 269


>gi|115351216|ref|YP_773055.1| type 11 methyltransferase [Burkholderia ambifaria AMMD]
 gi|115281204|gb|ABI86721.1| Methyltransferase type 11 [Burkholderia ambifaria AMMD]
          Length = 270

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAARDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K +     + + K KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVRGMRLVGQIKMKKPVLAPGLTPAATPT 264


>gi|134282729|ref|ZP_01769432.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|217423364|ref|ZP_03454865.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|237811763|ref|YP_002896214.1| methyltransferase type 11 [Burkholderia pseudomallei MSHR346]
 gi|238563613|ref|ZP_00438561.2| methyltransferase type 11 [Burkholderia mallei GB8 horse 4]
 gi|242315075|ref|ZP_04814091.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|251767847|ref|ZP_02268595.2| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254197431|ref|ZP_04903853.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254199438|ref|ZP_04905804.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254205751|ref|ZP_04912103.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|134245815|gb|EBA45906.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|147749034|gb|EDK56108.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753194|gb|EDK60259.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|169654172|gb|EDS86865.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|217393222|gb|EEC33243.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|237505751|gb|ACQ98069.1| methyltransferase type 11 [Burkholderia pseudomallei MSHR346]
 gi|238520322|gb|EEP83783.1| methyltransferase type 11 [Burkholderia mallei GB8 horse 4]
 gi|242138314|gb|EES24716.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|243061564|gb|EES43750.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 288

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 100/244 (40%), Gaps = 30/244 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH---GKVERTLAFMPAG 67
           F++  LG    DA+        ++   CR L L  A    + +H    +  R+    PAG
Sbjct: 57  FHALQLGLPQLDALR-------ENRMPCRGLVLDPASGASAPYHYPWAREARSAEHAPAG 109

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + +T W D            +LP    SVD ++M H LEF  DP  +L E  RVL   G+
Sbjct: 110 R-STVWCDLL----------DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQ 158

Query: 128 MIVVVPNKRGMW------ARMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           +++   N   +W       +M   PF   +    ++ ++   ++   F L       + P
Sbjct: 159 LVITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRP 218

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPH 238
           P      L  ++  E  G+ + P F  +Y++ A +++    L      KK + +P L P 
Sbjct: 219 PLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPA 278

Query: 239 TVST 242
              T
Sbjct: 279 ATPT 282


>gi|53718982|ref|YP_107968.1| hypothetical protein BPSL1343 [Burkholderia pseudomallei K96243]
 gi|53725123|ref|YP_102527.1| hypothetical protein BMA0764 [Burkholderia mallei ATCC 23344]
 gi|76812110|ref|YP_333005.1| hypothetical protein BURPS1710b_1601 [Burkholderia pseudomallei
           1710b]
 gi|121598297|ref|YP_992609.1| hypothetical protein BMASAVP1_A1274 [Burkholderia mallei SAVP1]
 gi|124384135|ref|YP_001026590.1| hypothetical protein BMA10229_A0595 [Burkholderia mallei NCTC
           10229]
 gi|126440882|ref|YP_001058510.1| hypothetical protein BURPS668_1467 [Burkholderia pseudomallei 668]
 gi|126449958|ref|YP_001080126.1| hypothetical protein BMA10247_0557 [Burkholderia mallei NCTC 10247]
 gi|126453084|ref|YP_001065770.1| hypothetical protein BURPS1106A_1497 [Burkholderia pseudomallei
           1106a]
 gi|167719047|ref|ZP_02402283.1| hypothetical protein BpseD_08479 [Burkholderia pseudomallei DM98]
 gi|167738048|ref|ZP_02410822.1| hypothetical protein Bpse14_08267 [Burkholderia pseudomallei 14]
 gi|167815232|ref|ZP_02446912.1| hypothetical protein Bpse9_08811 [Burkholderia pseudomallei 91]
 gi|167823640|ref|ZP_02455111.1| hypothetical protein Bpseu9_08167 [Burkholderia pseudomallei 9]
 gi|167845184|ref|ZP_02470692.1| hypothetical protein BpseB_07823 [Burkholderia pseudomallei B7210]
 gi|167893735|ref|ZP_02481137.1| hypothetical protein Bpse7_08241 [Burkholderia pseudomallei 7894]
 gi|167902187|ref|ZP_02489392.1| hypothetical protein BpseN_07904 [Burkholderia pseudomallei NCTC
           13177]
 gi|167910428|ref|ZP_02497519.1| hypothetical protein Bpse112_08030 [Burkholderia pseudomallei 112]
 gi|167918453|ref|ZP_02505544.1| hypothetical protein BpseBC_07842 [Burkholderia pseudomallei
           BCC215]
 gi|254178221|ref|ZP_04884876.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254188364|ref|ZP_04894875.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254259721|ref|ZP_04950775.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254358849|ref|ZP_04975122.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52209396|emb|CAH35341.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|52428546|gb|AAU49139.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|76581563|gb|ABA51038.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b]
 gi|121227107|gb|ABM49625.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124292155|gb|ABN01424.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126220375|gb|ABN83881.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126226726|gb|ABN90266.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126242828|gb|ABO05921.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|148027976|gb|EDK85997.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157936043|gb|EDO91713.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699260|gb|EDP89230.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254218410|gb|EET07794.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 270

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 100/244 (40%), Gaps = 30/244 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH---GKVERTLAFMPAG 67
           F++  LG    DA+        ++   CR L L  A    + +H    +  R+    PAG
Sbjct: 39  FHALQLGLPQLDALR-------ENRMPCRGLVLDPASGASAPYHYPWAREARSAEHAPAG 91

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + +T W D            +LP    SVD ++M H LEF  DP  +L E  RVL   G+
Sbjct: 92  R-STVWCDLL----------DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQ 140

Query: 128 MIVVVPNKRGMW------ARMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           +++   N   +W       +M   PF   +    ++ ++   ++   F L       + P
Sbjct: 141 LVITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRP 200

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPH 238
           P      L  ++  E  G+ + P F  +Y++ A +++    L      KK + +P L P 
Sbjct: 201 PLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPA 260

Query: 239 TVST 242
              T
Sbjct: 261 ATPT 264


>gi|237746603|ref|ZP_04577083.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229377954|gb|EEO28045.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 274

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP A  S+D +++ H  EFA  P  +L E+ RVL   G++I+   N   +W   +H  FG
Sbjct: 97  LPFASESIDLIILPHAFEFAHSPHQILREVDRVLIPEGQVIISGFNPASLWGVRQH--FG 154

Query: 149 S----------GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
                       +  S  ++   L+  NF +S      + PP   +  L+ ++  EK GN
Sbjct: 155 RLWGNRFLPEHAEFLSLSRLKDWLKLLNFEISRGYFGCYRPPCRTRRWLRRFAFMEKAGN 214

Query: 199 IFGPGFAGIYVIEARKILY 217
            + P    IY+I A K ++
Sbjct: 215 RWWPYLGAIYLIGAIKRVH 233


>gi|186475634|ref|YP_001857104.1| type 11 methyltransferase [Burkholderia phymatum STM815]
 gi|184192093|gb|ACC70058.1| Methyltransferase type 11 [Burkholderia phymatum STM815]
          Length = 271

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +    
Sbjct: 102 DLPFEAQSVDLLVMPHTLEFTRDPHRLLREAERVLMPEGQLIIIGFNSLSLWGARQSVGK 161

Query: 148 GSGQPY--SWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            +G+P+  + + +I+  R  +      F L       + PP   +  L  +   E  G+ 
Sbjct: 162 VAGRPFVPAAHDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLVGENWLSRYQFMEAAGDR 221

Query: 200 FGPGFAGIYVIEARK 214
           + P F  +YV+ A K
Sbjct: 222 WWPIFGAVYVVTAIK 236


>gi|299066483|emb|CBJ37671.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Ralstonia solanacearum CMR15]
          Length = 257

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 17/176 (9%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+++   
Sbjct: 59  PQRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLVITGF 118

Query: 134 NKRGMWA------RMEHTPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPT 181
           N   +W       R+    F   Q     QMI+  R  +      F +       + PP 
Sbjct: 119 NPLSLWGMRQGMRRLGTESFLPAQ----SQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPN 174

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                L+  +  E+ G+ + P F  +Y+++A K + + + +     K   SP LVP
Sbjct: 175 RTDKWLQRTAFMEQAGDRWWPIFGAVYMLQAVKRV-RSVRLVGPAWKTRKSPTLVP 229


>gi|161525204|ref|YP_001580216.1| type 11 methyltransferase [Burkholderia multivorans ATCC 17616]
 gi|189350057|ref|YP_001945685.1| SAM-dependent methyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|221201957|ref|ZP_03574993.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204913|ref|ZP_03577930.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|160342633|gb|ABX15719.1| Methyltransferase type 11 [Burkholderia multivorans ATCC 17616]
 gi|189334079|dbj|BAG43149.1| SAM-dependent methyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|221175770|gb|EEE08200.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221178040|gb|EEE10451.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 270

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAAHDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           + P F  +Y++ A K + +G+ +    K  +  P+L P
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIK--VKKPVLAP 255


>gi|221213890|ref|ZP_03586863.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221166067|gb|EED98540.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 270

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAAHDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           + P F  +Y++ A K + +G+ +    K  +  P+L P
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIK--VKKPVLAP 255


>gi|78065899|ref|YP_368668.1| hypothetical protein Bcep18194_A4428 [Burkholderia sp. 383]
 gi|77966644|gb|ABB08024.1| hypothetical protein Bcep18194_A4428 [Burkholderia sp. 383]
          Length = 270

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPATRDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K +     + + K KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVRGMRLVGQIKMKKPVLAPGLTPAASPT 264


>gi|134295349|ref|YP_001119084.1| type 11 methyltransferase [Burkholderia vietnamiensis G4]
 gi|134138506|gb|ABO54249.1| Methyltransferase type 11 [Burkholderia vietnamiensis G4]
          Length = 270

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 71/164 (43%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPAARDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVST 242
           + P F  +Y++ A K +     I   K KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRVRGMRLIGPIKMKKPVLAPGLTPAATPT 264


>gi|107022361|ref|YP_620688.1| methyltransferase type 11 [Burkholderia cenocepacia AU 1054]
 gi|116689308|ref|YP_834931.1| methyltransferase type 11 [Burkholderia cenocepacia HI2424]
 gi|105892550|gb|ABF75715.1| Methyltransferase type 11 [Burkholderia cenocepacia AU 1054]
 gi|116647397|gb|ABK08038.1| Methyltransferase type 11 [Burkholderia cenocepacia HI2424]
          Length = 270

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 11/165 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPATRDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLATDQWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITE--SKKKHISSPILVPHTVST 242
           + P F  +Y++ A K + +G+ +      KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIKMKKPVLAPGLTPAASPT 264


>gi|170732607|ref|YP_001764554.1| methyltransferase type 11 [Burkholderia cenocepacia MC0-3]
 gi|254245769|ref|ZP_04939090.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|124870545|gb|EAY62261.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|169815849|gb|ACA90432.1| Methyltransferase type 11 [Burkholderia cenocepacia MC0-3]
          Length = 270

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQTFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPATRDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLATDQWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           + P F  +Y++ A K + +G+ +    K  +  P+L P
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIK--MKKPVLAP 255


>gi|206559633|ref|YP_002230394.1| putative methyltransferase [Burkholderia cenocepacia J2315]
 gi|198035671|emb|CAR51558.1| putative methyltransferase [Burkholderia cenocepacia J2315]
          Length = 270

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 11/165 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 MANRPFVPATRDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITE--SKKKHISSPILVPHTVST 242
           + P F  +Y++ A K + +G+ +      KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIKMKKPVLAPGLTPAASPT 264


>gi|91784547|ref|YP_559753.1| hypothetical protein Bxe_A1252 [Burkholderia xenovorans LB400]
 gi|91688501|gb|ABE31701.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 289

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 19/170 (11%)

Query: 54  HGKVERTLAFMPAGQGATN-WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           +G  +  LA +PA  G +  W D            +LP    SVD ++M H LEF  DP 
Sbjct: 95  NGAAQGGLAGLPAPAGRSAVWCDLL----------DLPFEAQSVDLIVMPHTLEFTSDPH 144

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMISLLRE 164
            +L E  RVL   G++I++  N   +W   +     +G+P+        ++ ++   ++ 
Sbjct: 145 RLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFVPAAVDLIAFTRLKDWIKL 204

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             F L       + PP   +  L  +   E  G+ + P F   Y+I+A K
Sbjct: 205 LGFDLERGRFGCYRPPLGSEQWLSRYGFMEAAGDRWWPIFGATYMIKAIK 254


>gi|329900787|ref|ZP_08272591.1| SAM-dependent methyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549376|gb|EGF33944.1| SAM-dependent methyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 256

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 8/136 (5%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------A 140
             LP A  S+D V++ H LEF+ +P  +L E+ RVL   GR+I+   N   +W       
Sbjct: 88  AELPFASQSLDLVVLPHVLEFSREPHQVLREVERVLRPEGRLIICGFNSASLWGARQMAG 147

Query: 141 RMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
           R+  + F    GQ     ++   L   N  +       + PP   +  L+ ++  EKIG 
Sbjct: 148 RLSGSAFLPRDGQFIGMPRLKDWLELLNMEVDHGYFGCYAPPCRTEKWLERFAFMEKIGR 207

Query: 199 IFGPGFAGIYVIEARK 214
            + P    +YV+ A K
Sbjct: 208 RWWPYLGAVYVVHAIK 223


>gi|187924848|ref|YP_001896490.1| methyltransferase type 11 [Burkholderia phytofirmans PsJN]
 gi|187716042|gb|ACD17266.1| Methyltransferase type 11 [Burkholderia phytofirmans PsJN]
          Length = 287

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 19/170 (11%)

Query: 54  HGKVERTLAFMPAGQGATN-WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           +G  +  LA +PA  G +  W D            +LP    SVD ++M H LEF  DP 
Sbjct: 93  NGAAQSGLAGLPAPAGRSAVWCDLL----------DLPFEAQSVDLIVMPHTLEFTSDPH 142

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMISLLRE 164
            +L E  RVL   G++I++  N   +W   +     +G+P+        ++ ++   ++ 
Sbjct: 143 RLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFVPAAVDLIAFTRLKDWIKL 202

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             F L       + PP   +  L  +   E  G+ + P F   Y+I+A K
Sbjct: 203 LGFDLERGRFGCYRPPLGSEQWLARYGFMEAAGDRWWPIFGATYMIKAIK 252


>gi|296158205|ref|ZP_06841037.1| Methyltransferase type 11 [Burkholderia sp. Ch1-1]
 gi|295891541|gb|EFG71327.1| Methyltransferase type 11 [Burkholderia sp. Ch1-1]
          Length = 288

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 19/170 (11%)

Query: 54  HGKVERTLAFMPAGQGATN-WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           +G  +  LA +PA  G +  W D            +LP    SVD ++M H LEF  DP 
Sbjct: 94  NGAAQGGLAGLPAPAGRSAVWCDLL----------DLPFEAQSVDLIVMPHTLEFTSDPH 143

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMISLLRE 164
            +L E  RVL   G++I++  N   +W   +     +G+P+        ++ ++   ++ 
Sbjct: 144 RLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFVPAAVDLIAFTRLKDWIKL 203

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             F L       + PP   +  L  +   E  G+ + P F   Y+I+A K
Sbjct: 204 LGFDLERGRFGCYRPPLGSEQWLSRYGFMEAAGDRWWPIFGATYMIKAIK 253


>gi|167562348|ref|ZP_02355264.1| hypothetical protein BoklE_07281 [Burkholderia oklahomensis EO147]
 gi|167574354|ref|ZP_02367228.1| hypothetical protein BoklC_31230 [Burkholderia oklahomensis C6786]
          Length = 270

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 72/164 (43%), Gaps = 9/164 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       +
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGARQSVGK 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           M + PF   +    ++ ++   ++   F L       + PP      L  ++  E  G+ 
Sbjct: 161 MANRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDR 220

Query: 200 FGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPHTVST 242
           + P F  +Y++ A +++    L      KK + +P L P    T
Sbjct: 221 WWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPAATPT 264


>gi|152982721|ref|YP_001352900.1| hypothetical protein mma_1209 [Janthinobacterium sp. Marseille]
 gi|151282798|gb|ABR91208.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 256

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 8/135 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
            LP A +S+D V++ H LEFA++P  +L E+ RVL   G++I+   N    W       R
Sbjct: 91  ELPYASASIDLVILPHALEFAKEPHQVLREVERVLIPEGQVIICGFNPYSFWGARQIIGR 150

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           +  + F    G+  S  ++   L+  N  +S      + PP   +  L  ++  E +G  
Sbjct: 151 LSESYFLPQQGEFISLPRVKDWLKLLNMEVSGGYFGCYAPPCETQKWLDRFTFLENVGER 210

Query: 200 FGPGFAGIYVIEARK 214
           + P    +YV++A K
Sbjct: 211 WWPYLGAVYVVQAVK 225


>gi|83718692|ref|YP_443301.1| hypothetical protein BTH_I2789 [Burkholderia thailandensis E264]
 gi|167582320|ref|ZP_02375194.1| hypothetical protein BthaT_29540 [Burkholderia thailandensis TXDOH]
 gi|167620417|ref|ZP_02389048.1| hypothetical protein BthaB_29194 [Burkholderia thailandensis Bt4]
 gi|83652517|gb|ABC36580.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 270

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 93/227 (40%), Gaps = 23/227 (10%)

Query: 28  LSTTWDDVTGCRLLGLGYAIPFFSCFH---GKVERTLAFMPAGQGATNWPDQYFSSTALV 84
           L T  ++   CR L L  A    + +H    +   +    PAG+ +T W D         
Sbjct: 49  LDTLRENRMPCRGLVLDPASGASAPYHYPWAREAHSAEHAPAGR-STVWCDLL------- 100

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW----- 139
              +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W     
Sbjct: 101 ---DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGARHS 157

Query: 140 -ARMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
             +M   PF   +    ++ ++   ++   F L       + PP      L  ++  E  
Sbjct: 158 VGKMAKRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAA 217

Query: 197 GNIFGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPHTVST 242
           G+ + P F  +Y++ A +++    L      KK + +P L P    T
Sbjct: 218 GDRWWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPAATPT 264


>gi|221067919|ref|ZP_03544024.1| Methyltransferase type 11 [Comamonas testosteroni KF-1]
 gi|220712942|gb|EED68310.1| Methyltransferase type 11 [Comamonas testosteroni KF-1]
          Length = 277

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 71/156 (45%), Gaps = 15/156 (9%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---GMWARMEHT 145
           LP A++S+D +LM H LE + DP   L E  RVL   GR+++   N     G+  R+E +
Sbjct: 105 LPFAEASLDLLLMPHTLEASNDPHAALREAARVLVPEGRLVISGLNPSSLLGLQRRVERS 164

Query: 146 P-------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
                    G G    ++++   LR  +F +       + P T  +  L  W   E +G+
Sbjct: 165 AGYLPDLSLGVG----YWRLRDWLRLLSFEIEAVQFGCYRPATQSEKWLSRWQFMEGLGH 220

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
              P   G+Y + A K + QG+ +     +  S P+
Sbjct: 221 RCWPVMGGVYCVVAVKRV-QGMRMMSPSWRKSSVPV 255


>gi|332159397|ref|YP_004424676.1| hypothetical protein PNA2_1757 [Pyrococcus sp. NA2]
 gi|331034860|gb|AEC52672.1| hypothetical protein PNA2_1757 [Pyrococcus sp. NA2]
          Length = 304

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (48%), Gaps = 14/127 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR-----M 142
           NLP  D+S+DC+LMV  + F +DP   + E +RVL  GG +I+   ++     R      
Sbjct: 85  NLPFPDNSLDCILMVTTICFVDDPEKAIKEAYRVLKPGGHIIIGFIDRESEIGREYERNK 144

Query: 143 EHTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
           E + F    + +S  ++I LL ++ F +    ++LF P    K I       E +   FG
Sbjct: 145 EKSVFYREARFFSTREIIDLLEKSGFKVERIVQTLFHPLNEIKDI-------EPVEEGFG 197

Query: 202 PG-FAGI 207
            G F GI
Sbjct: 198 KGSFVGI 204


>gi|303256781|ref|ZP_07342795.1| methyltransferase type 11 [Burkholderiales bacterium 1_1_47]
 gi|302860272|gb|EFL83349.1| methyltransferase type 11 [Burkholderiales bacterium 1_1_47]
          Length = 261

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 92/219 (42%), Gaps = 9/219 (4%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGY-AIPFFSCFHGKVERTL 61
            + + L +FYSS LG+               D  G   + LG   I F    + ++   +
Sbjct: 17  AETITLEKFYSSSLGQYALRWEQNQYDKLVSDCFGYNAVQLGATGIDFLK--NNRIGLKV 74

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           A  P  +  T   +    +   +    +P    S+D V+M H LE +EDP  +L E++R+
Sbjct: 75  AAEPTLRPLTQLLETDDRTPLQMLFEAMPFESESIDLVVMPHALEVSEDPHALLREVYRI 134

Query: 122 LTSGGRMIVVVPNKRGMWA-RMEHTPFGSGQ--PYSWYQMISLLREANFTLSI-TSRSLF 177
           L  GGR+I+   N   +W  R +   FG+    P   +  +  +R+    LS    R  F
Sbjct: 135 LIPGGRVILTGFNLMSLWGLRFKMQRFGAKTFLPGKQFMSVFQIRDWLHLLSFHVDRGAF 194

Query: 178 --FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             +  T     +K  S  EK G+ + P    I+ I A K
Sbjct: 195 GCYGLTFSSAQIKEDSWIEKAGDRWWPQCGAIFAISATK 233


>gi|312143276|ref|YP_003994722.1| Methyltransferase type 11 [Halanaerobium sp. 'sapolanicus']
 gi|311903927|gb|ADQ14368.1| Methyltransferase type 11 [Halanaerobium sp. 'sapolanicus']
          Length = 236

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 88  NLPLADSSVDCVL---MVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--RM 142
           N+P AD+  D V    M+ + E  E+   +L E+WRVL  GGR ++ V N +  WA  R+
Sbjct: 97  NIPFADNYFDIVYSNSMIEFFEAGEELEAVLKEMWRVLKPGGRYVIGVLNSKSTWAYKRI 156

Query: 143 EHT-----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
             T      F     YSW ++ ++L    F       +LF PP  K
Sbjct: 157 AETIEKDSIFSEATFYSWEELKAIL--GKFGQVKIESTLFVPPYFK 200


>gi|169831614|ref|YP_001717596.1| type 11 methyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638458|gb|ACA59964.1| Methyltransferase type 11 [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 265

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 10/137 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           NLP    S D V     LEF  +P   + E+WR++  GGR++V V N    WA       
Sbjct: 96  NLPFPSLSFDLVTAFTVLEFTGNPEAAVRELWRLVKPGGRLVVGVLNSWSPWAWQRRRRA 155

Query: 148 GSG-------QPYSWYQMISLLREANFTLS--ITSRSLFFPPTHKKCILKLWSVFEKIGN 198
           G+G       Q +S + M ++L  AN + S  + S  +FFPP      + + +  ++I  
Sbjct: 156 GTGESVFAHAQFFSPWSMKAVL-TANTSQSRLVWSTCVFFPPWTGSLSINMAATLDRIAR 214

Query: 199 IFGPGFAGIYVIEARKI 215
            F   F  + V+ A ++
Sbjct: 215 PFLKPFGALIVMRAERL 231


>gi|254252712|ref|ZP_04946030.1| hypothetical protein BDAG_01951 [Burkholderia dolosa AUO158]
 gi|124895321|gb|EAY69201.1| hypothetical protein BDAG_01951 [Burkholderia dolosa AUO158]
          Length = 270

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 101 DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQTFGR 160

Query: 142 MEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
           + + PF   +    ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 161 IANRPFVPAARDQIAFIRLKDWIKLLGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDR 220

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           + P F  +Y++ A K + +G+ +    K  +  P+L P
Sbjct: 221 WWPIFGAVYMVTAVKRV-RGMRLVGPIK--VKKPVLAP 255


>gi|331000111|ref|ZP_08323805.1| methyltransferase domain protein [Parasutterella excrementihominis
           YIT 11859]
 gi|329572886|gb|EGG54509.1| methyltransferase domain protein [Parasutterella excrementihominis
           YIT 11859]
          Length = 246

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 92/219 (42%), Gaps = 9/219 (4%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGY-AIPFFSCFHGKVERTL 61
            + + L +FYSS LG+               D  G   + LG   I F    + ++   +
Sbjct: 2   AETITLEKFYSSSLGQYALRWEQNQYDKLVSDCFGYNAVQLGATGIDFLK--NNRIGLKV 59

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           A  P  +  T   +    +   +    +P    S+D V+M H LE +EDP  +L E++R+
Sbjct: 60  AAEPTLRPLTQLLETDDRTPLQMLFEAMPFESESIDLVVMPHALEVSEDPHALLREVYRI 119

Query: 122 LTSGGRMIVVVPNKRGMWA-RMEHTPFGSGQ--PYSWYQMISLLREANFTLSI-TSRSLF 177
           L  GGR+I+   N   +W  R +   FG+    P   +  +  +R+    LS    R  F
Sbjct: 120 LIPGGRVILTGFNLMSLWGLRFKMQRFGAKTFLPGKQFMSVFQIRDWLHLLSFHVDRGAF 179

Query: 178 --FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             +  T     +K  S  EK G+ + P    I+ I A K
Sbjct: 180 GCYGLTFSSAQIKEDSWIEKAGDRWWPQCGAIFAISATK 218


>gi|323526833|ref|YP_004228986.1| type 11 methyltransferase [Burkholderia sp. CCGE1001]
 gi|323383835|gb|ADX55926.1| Methyltransferase type 11 [Burkholderia sp. CCGE1001]
          Length = 290

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +    
Sbjct: 121 DLPFEAQSVDLLVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGK 180

Query: 148 GSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            +G+P+        ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 181 MTGRPFVPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLDSDQWLSRYGFMEAAGDR 240

Query: 200 FGPGFAGIYVIEARK 214
           + P F   Y+I+A K
Sbjct: 241 WWPIFGATYMIKAIK 255


>gi|295677148|ref|YP_003605672.1| Methyltransferase type 11 [Burkholderia sp. CCGE1002]
 gi|295436991|gb|ADG16161.1| Methyltransferase type 11 [Burkholderia sp. CCGE1002]
          Length = 292

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +    
Sbjct: 123 DLPFEAQSVDLLVMPHTLEFTSDPHRLLREAERVLVPEGQLIILGFNSLSLWGVRQSIGK 182

Query: 148 GSGQPY--SWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            +G+P+  S   +I+  R  +      F L       + PP      L  +   E  G+ 
Sbjct: 183 MTGRPFVPSAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLASDQWLARYGFMEAAGDR 242

Query: 200 FGPGFAGIYVIEARK 214
           + P F   Y+I+A K
Sbjct: 243 WWPIFGATYMIKAIK 257


>gi|206889785|ref|YP_002248330.1| hypothetical protein THEYE_A0485 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741723|gb|ACI20780.1| hypothetical protein THEYE_A0485 [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 248

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFL--MLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
            P+ D+S+DCV  V  +E   D +L   L+EI+R+L  GG +I+  PN   + A     P
Sbjct: 113 FPIEDNSIDCVFAVEIIEHLNDLYLSATLNEIYRILRPGGYLIITTPNNEDLEANKTICP 172

Query: 147 FGSGQPYSWYQMIS--------LLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
                 + W  + S        LL + NFT      +L +P + +K I  L  V +
Sbjct: 173 ECGCIFHRWQHVRSWDKVSLNMLLNQHNFTDIKIKEALIYPDSSRKIIKVLKKVIK 228


>gi|209517195|ref|ZP_03266040.1| Methyltransferase type 11 [Burkholderia sp. H160]
 gi|209502331|gb|EEA02342.1| Methyltransferase type 11 [Burkholderia sp. H160]
          Length = 293

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +    
Sbjct: 124 DLPFEAQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGVRQSVGK 183

Query: 148 GSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            +G+P+        ++ ++   ++   F L       + PP      L  +   E  G+ 
Sbjct: 184 MTGRPFVPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLASDQWLARYGFMEAAGDR 243

Query: 200 FGPGFAGIYVIEARK 214
           + P F   Y+I+A K
Sbjct: 244 WWPIFGATYMIKAIK 258


>gi|59712544|ref|YP_205320.1| S-adenosyl-L-methionine-dependent methyltransferase [Vibrio
           fischeri ES114]
 gi|59480645|gb|AAW86432.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio fischeri ES114]
          Length = 247

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--------W 139
            LP  + S+D  ++ H L+++ DP  +L EI RVL   G +I+   N            W
Sbjct: 84  QLPFLEKSIDACVLAHQLDYSSDPHQLLREIDRVLIGDGYVILTGFNPMSAIGLASLFPW 143

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            R  + P+ SG+ ++ +++   L   NF +  +      P T  +    +W+ FE +G  
Sbjct: 144 -RKNNLPW-SGRMFTPHRIKDWLSVLNFEVVYSDCFALAPLTRYRT---MWTWFEGLGGD 198

Query: 200 FGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHT 239
                +GIY I ARK  Y   PI  + KKK   +PI V  T
Sbjct: 199 AVKPISGIYFIVARKRTYPLRPIKSAWKKKPKLAPISVAQT 239


>gi|197334585|ref|YP_002156766.1| methyltransferase [Vibrio fischeri MJ11]
 gi|197316075|gb|ACH65522.1| methyltransferase [Vibrio fischeri MJ11]
          Length = 247

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 14/161 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--------W 139
            LP  + S+D  ++ H L+++ DP  +L EI RVL   G +I+   N            W
Sbjct: 84  QLPFLEKSIDACVLAHQLDYSSDPHQLLREIDRVLIGDGYVILTGFNPMSAIGLASLFPW 143

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            R  + P+ SG+ ++ +++   L   NF +  +      P T  +    +W+ FE +G  
Sbjct: 144 -RKNNLPW-SGRMFTPHRIKDWLSVLNFEVVYSDCFALAPLTRYRT---MWTWFEGLGGD 198

Query: 200 FGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHT 239
                +GIY I ARK  Y   PI  + KKK   +PI V  T
Sbjct: 199 AVKPISGIYFIVARKRTYPLRPIKSAWKKKPKLAPISVAQT 239


>gi|329890615|ref|ZP_08268958.1| phosphoglycerate mutase family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328845916|gb|EGF95480.1| phosphoglycerate mutase family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 348

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 1  MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
          MR  I +LR FY    G      +++ L   W +   C +LGLGYA P+   F G   R 
Sbjct: 1  MRRSIDDLRTFYGEPTGALARRMLARRLEDAWGEANNCDVLGLGYATPWLDGFIG-ARRV 59

Query: 61 LAFMPAGQG 69
          +A MP GQG
Sbjct: 60 IAAMPGGQG 68


>gi|299531592|ref|ZP_07044997.1| Methyltransferase type 11 [Comamonas testosteroni S44]
 gi|298720308|gb|EFI61260.1| Methyltransferase type 11 [Comamonas testosteroni S44]
          Length = 277

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 70/155 (45%), Gaps = 15/155 (9%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---GMWARMEHT 145
           LP A++S+D +LM H LE + DP   L E  RVL   GR+++   N     G+  R+E +
Sbjct: 105 LPFAEASLDLLLMPHTLEASNDPHAALREAARVLVPEGRLVISGLNPSSLLGLQRRVERS 164

Query: 146 P-------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
                    G G    ++++   LR  +F +       + P T  +  L  W   E +G+
Sbjct: 165 AGYLPDLSLGVG----YWRLRDWLRLLSFEIEAVQFGCYRPATQSEKWLSRWQFMEGLGH 220

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
              P   G+Y + A K + QG+ +     +  S P
Sbjct: 221 RCWPVMGGVYCVVAVKRV-QGMRLMSPSWRKSSVP 254


>gi|264677771|ref|YP_003277677.1| methyltransferase type 11 [Comamonas testosteroni CNB-2]
 gi|262208283|gb|ACY32381.1| Methyltransferase type 11 [Comamonas testosteroni CNB-2]
          Length = 277

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 15/155 (9%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---GMWARMEHT 145
           LP A++S+D +LM H LE   DP   L E  RVL   GR+++   N     G+  R+E +
Sbjct: 105 LPFAEASLDLLLMPHTLEACNDPHAALREAARVLVPEGRLVISGLNPSSLLGLQRRVERS 164

Query: 146 P-------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
                    G G    ++++   LR  +F +       + P T  +  L  W   E +G+
Sbjct: 165 AGYLPDLSLGVG----YWRLRDWLRLLSFEIEAVQFGCYRPATQSEKWLSRWQFMEGLGH 220

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
              P   G+Y + A K + QG+ +     +  S P
Sbjct: 221 RCWPVMGGVYCVVAVKRV-QGMRLMSPSWRKSSVP 254


>gi|152985540|ref|YP_001348841.1| hypothetical protein PSPA7_3482 [Pseudomonas aeruginosa PA7]
 gi|150960698|gb|ABR82723.1| hypothetical protein PSPA7_3482 [Pseudomonas aeruginosa PA7]
          Length = 253

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 11/164 (6%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
            EG  PL++ + D VL+ H L+F   P  +L E  R +  GG +++V  N   +W    H
Sbjct: 87  EEGAWPLSEHAADVVLLQHGLDFCLSPHRLLREAARTVRPGGHLLLVGINPWSLWGVRHH 146

Query: 145 TPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
               +G      + I   R  +      F L       + PP          +  E+ G+
Sbjct: 147 F---AGDALRQARCIPPSRACDWLNLLGFALEKRRFGCYRPPLASAAWQSRLARLERWGD 203

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
            +    AG Y++ ARK++    P+ +SK++      LVP  V+ 
Sbjct: 204 AWQSSGAGFYLLVARKLVVGLRPLRQSKREPRGQ--LVPMPVAK 245


>gi|160900328|ref|YP_001565910.1| type 11 methyltransferase [Delftia acidovorans SPH-1]
 gi|160365912|gb|ABX37525.1| Methyltransferase type 11 [Delftia acidovorans SPH-1]
          Length = 245

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 5/137 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---GMW 139
           L     LP +++S+D V+M H LE + DP  +L E  RVL   GR++V   N     G+ 
Sbjct: 54  LADPAALPFSEASLDLVVMPHTLETSPDPHAVLREAARVLMPEGRIVVCGLNPASLLGVQ 113

Query: 140 ARMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
            R E   +    G    ++++   LR   F +       + P       L+ W   +++G
Sbjct: 114 RRAERGVYLPDVGWGVGYWRLRDWLRLLAFEIEAVQFGCYRPAVQTDRWLRRWQFMDRVG 173

Query: 198 NIFGPGFAGIYVIEARK 214
            +  P   G+Y + A K
Sbjct: 174 RLGWPMLGGVYCVVAVK 190


>gi|118161393|gb|ABK64075.1| putative methyltransferase [Janthinobacterium lividum]
          Length = 258

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 8/149 (5%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P Q    T + +   LP    S+D V++ H LEFA +P  +L E+ RVL   GR+IV   
Sbjct: 75  PPQESRLTLVSAFDELPFDSQSLDLVVLPHVLEFAAEPHQVLREVERVLIPEGRVIVCGF 134

Query: 134 NKRGMWARME--------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           N   +W   +        H    +G+  S  +M   L+  N  +S +    + P    + 
Sbjct: 135 NPASLWGMRQGLGRVTGRHYLPQAGELISMPRMKDWLKLLNMGVSQSHFGCYAPACRTEK 194

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            L+  +  +K G  + P    +Y+++A K
Sbjct: 195 WLRRNAFMDKAGARWWPYLGAVYIVQAIK 223


>gi|77166268|ref|YP_344793.1| generic methyl-transferase [Nitrosococcus oceani ATCC 19707]
 gi|254435362|ref|ZP_05048869.1| hypothetical protein NOC27_2425 [Nitrosococcus oceani AFC27]
 gi|76884582|gb|ABA59263.1| generic methyl-transferase [Nitrosococcus oceani ATCC 19707]
 gi|207088473|gb|EDZ65745.1| hypothetical protein NOC27_2425 [Nitrosococcus oceani AFC27]
          Length = 256

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 13/180 (7%)

Query: 70  ATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           A  WP+    S +L+S  + LP A+++VD +++ H LE+   P  +L E  RVL   G +
Sbjct: 73  AEVWPEA--QSPSLLSRIDALPFANATVDGIILPHVLEYEAAPHQVLREAQRVLVPYGTL 130

Query: 129 IVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
            ++  N    W        R    P+  G+ YS  ++   L    F        LF PP 
Sbjct: 131 AILGFNPWSFWGLWRFILCRRGSMPW-CGRFYSLTRIQDWLALLGFKTVELRYFLFRPPL 189

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE--SKKKHISSPILVPHT 239
            +  +++     E++G  + P FAG Y++ A+K + +  PI     +++ ++ P L   T
Sbjct: 190 RQPRLMRRLRFLEEVGRRWYPFFAGSYLVVAKKQVMRLNPIDPLWREEESLNMPALAEPT 249


>gi|71726090|gb|AAZ39213.1| putative methyltransferase [Janthinobacterium lividum]
          Length = 258

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 8/149 (5%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P Q    T + +   LP    S+D V++ H LEFA +P  +L E+ RVL   GR+IV   
Sbjct: 75  PPQERRLTLVSAFDELPFDSQSLDLVVLPHVLEFAAEPHQVLREVERVLIPEGRVIVCGF 134

Query: 134 NKRGMWARME--------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           N   +W   +        H    +G+  S  +M   L+  N  +S +    + P    + 
Sbjct: 135 NPASLWGARQGLGRVTGRHYLPQAGELISMPRMKDWLKLLNMGVSQSHFGCYAPACKTEK 194

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            L+  +  +K G  + P    +Y+++A K
Sbjct: 195 WLRRNAFMDKAGARWWPYLGAVYIVQAIK 223


>gi|82702747|ref|YP_412313.1| generic methyl-transferase [Nitrosospira multiformis ATCC 25196]
 gi|82410812|gb|ABB74921.1| generic methyl-transferase [Nitrosospira multiformis ATCC 25196]
          Length = 259

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 76/160 (47%), Gaps = 8/160 (5%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           +  L +   LP+  +S D VLM H LEF+ +P  +L E+ RVL   G +IV   N R +W
Sbjct: 66  ADVLAAPDFLPIETNSTDLVLMPHMLEFSSNPHQILREVQRVLMPEGNLIVSGFNPRSLW 125

Query: 140 A--RMEHTPFGSGQPY-----SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
               +  +P   G P+     +  ++   L   +F ++   +  + PP  ++  L  +  
Sbjct: 126 GIRGLFGSPREGGFPWRGNFIALPRLKDWLTLLDFEITEDRQCCYAPPFSQEKWLTRFHF 185

Query: 193 FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            E+ G   G    G+Y + A K ++ G+ + + + K + +
Sbjct: 186 MEEAGERLGRFSGGVYFLTAVKRVH-GMRVIKPEWKEVRA 224


>gi|300312713|ref|YP_003776805.1| S-adenosylhomocysteine hydrolase [Herbaspirillum seropedicae SmR1]
 gi|300075498|gb|ADJ64897.1| S-adenosylhomocysteine hydrolase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 264

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 9/162 (5%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------A 140
           G LP A  S+D V++ H LEFA +P  +L E+ RVL   G++I+   N   +W       
Sbjct: 96  GELPFATQSLDLVVLPHVLEFAAEPHQVLREVERVLIPEGQVIICGFNPSSLWGVRQVAG 155

Query: 141 RMEHTPF--GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
           R+    F    G+     ++   L+  N  ++      + PP      L  +   EK G+
Sbjct: 156 RLTGAHFLPQDGEFIRLPRLKDWLKLLNMEVNRGHFGCYAPPCETTQWLDRFGFMEKAGD 215

Query: 199 IFGPGFAGIYVIEA-RKILYQGLPITESKKKHISSPILVPHT 239
            + P    +Y+++A +++    L     +++ + +P  VP T
Sbjct: 216 RWWPYLGAVYIVQAIKRVPGMRLIGPALQRQKVKAPRGVPVT 257


>gi|258515368|ref|YP_003191590.1| Methyltransferase type 11 [Desulfotomaculum acetoxidans DSM 771]
 gi|257779073|gb|ACV62967.1| Methyltransferase type 11 [Desulfotomaculum acetoxidans DSM 771]
          Length = 240

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 65/136 (47%), Gaps = 8/136 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-------KRGMWA 140
           N+P  + S   V+    LEF   P  ++ EI+RVL   G+ I+   N        R +  
Sbjct: 104 NIPFKEHSFKTVICSLALEFMGRPEKVVQEIFRVLQPSGQFILAFLNFWSPWNMYRMLKG 163

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK-LWSVFEKIGNI 199
            ++ T + +    S Y +  +L+EA FT     ++++FPP  K  +L  ++  FE IG+ 
Sbjct: 164 YVQPTIYNNANFMSRYYVNKVLKEAGFTDFSYYKAIYFPPIEKHFMLNSMYKHFEIIGDK 223

Query: 200 FGPGFAGIYVIEARKI 215
             P  +   V++  KI
Sbjct: 224 LFPCLSTYIVVKCHKI 239


>gi|313201261|ref|YP_004039919.1| type 11 methyltransferase [Methylovorus sp. MP688]
 gi|312440577|gb|ADQ84683.1| methyltransferase type 11 [Methylovorus sp. MP688]
          Length = 239

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 13/141 (9%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-- 140
           L     LP + +++D +LM H L+F+EDP   L E  RVL + G +++   N    W   
Sbjct: 68  LSDSTQLPFSANTIDLLLMPHTLDFSEDPHQTLREAERVLVAEGHLMISGFNPLSSWGVK 127

Query: 141 RMEHTPFGSGQPYSWY-QMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVF 193
           RM     G  Q Y W+   + LLR  +      F +  T  + + PP      L+     
Sbjct: 128 RM----LGKRQGYPWHGNFLPLLRIKDWLALLGFEIISTGMTCYAPPWVSARWLERSRFL 183

Query: 194 EKIGNIFGPGFAGIYVIEARK 214
           ++ G  + P   G+Y + ARK
Sbjct: 184 DQAGGRWWPMRGGVYFVVARK 204


>gi|297538710|ref|YP_003674479.1| type 11 methyltransferase [Methylotenera sp. 301]
 gi|297258057|gb|ADI29902.1| methyltransferase type 11 [Methylotenera sp. 301]
          Length = 262

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 68/162 (41%), Gaps = 9/162 (5%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME- 143
           S+  LP AD S+D +L+ H LEF+E P   L E  RV+   G +++   N+  +W     
Sbjct: 81  SDDFLPFADMSIDLLLLPHRLEFSERPHQTLREAARVMMPEGHLVISGFNQLSLWGATAG 140

Query: 144 -HTPFGSGQPYSWY-QMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                     Y W  + I L R  +      F +         PP  ++   K +S F+K
Sbjct: 141 LKKITSKNSSYPWNGKFIGLTRLKDWLALLGFEVVSVEMCCHIPPFEQQSWHKRFSFFDK 200

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           + +       G+Y + A+K +    PI  S K       L+P
Sbjct: 201 VSSRRCAMLGGVYFVVAKKRVVGMTPIKPSWKLSPLKSTLIP 242


>gi|253999159|ref|YP_003051222.1| type 11 methyltransferase [Methylovorus sp. SIP3-4]
 gi|253985838|gb|ACT50695.1| methyltransferase type 11 [Methylovorus sp. SIP3-4]
          Length = 239

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 13/141 (9%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-- 140
           L     LP + +++D +LM H L+F+EDP   L E  RVL + G +++   N    W   
Sbjct: 68  LSDSTQLPFSANTIDLLLMPHTLDFSEDPHQTLREAERVLVAEGHLMISGFNPLSSWGVK 127

Query: 141 RMEHTPFGSGQPYSWY-QMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVF 193
           RM     G  Q Y W+   + LLR  +      F +  T  + + PP      L+     
Sbjct: 128 RM----LGKRQGYPWHGNFLPLLRIKDWLALLGFEIISTGMTCYAPPWVSARWLERSRFL 183

Query: 194 EKIGNIFGPGFAGIYVIEARK 214
           ++ G  + P   G+Y + ARK
Sbjct: 184 DQAGGRWWPMRGGVYFVVARK 204


>gi|308049179|ref|YP_003912745.1| methyltransferase type 11 [Ferrimonas balearica DSM 9799]
 gi|307631369|gb|ADN75671.1| methyltransferase type 11 [Ferrimonas balearica DSM 9799]
          Length = 257

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 81/166 (48%), Gaps = 35/166 (21%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI-----VVVPNKRG-MWAR 141
            LPL ++S+D  L+   LEF +DP  +L E+ RVL SGG ++     V+ P   G +W +
Sbjct: 82  RLPLQNASIDAALVPFCLEFQQDPHALLRELDRVLISGGHLVLVGFSVLSPLAFGYLWPK 141

Query: 142 MEHT-P-----FGSGQPYSW-----YQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
             H  P     F  G+ + W     Y+++S    A+ T+  +       PT ++ +  L 
Sbjct: 142 HHHQFPWSGRLFTPGRVHDWLSLLGYRVLSHESLAHHTMLWSPEKF---PTAQRWLADL- 197

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPIL 235
                      PGF  +Y+I ARK+     P+T ++++ H+  P++
Sbjct: 198 ----------APGFGSVYLIVARKM---EAPLTPARQRWHLRRPLV 230


>gi|332286828|ref|YP_004418739.1| hypothetical protein PT7_3575 [Pusillimonas sp. T7-7]
 gi|330430781|gb|AEC22115.1| hypothetical protein PT7_3575 [Pusillimonas sp. T7-7]
          Length = 247

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 7/142 (4%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           +  + S  +LP    S+D +++ H LE + D   +L E  RVL   GR+++   N   +W
Sbjct: 75  AALVASPESLPFDTQSIDLLVLPHVLECSNDSHQILREAERVLVPEGRIVISGFNPWSLW 134

Query: 140 ARMEHTP-FGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSV 192
              +  P      P   +  +SL R  +      F L       + PP  ++  L  W+ 
Sbjct: 135 GASDRIPGLDPLLPIPAHLQVSLPRLKDWFKLLSFDLDRGRFGCYAPPCSEQIWLDRWAF 194

Query: 193 FEKIGNIFGPGFAGIYVIEARK 214
            EK G+ + P    +YV+ A K
Sbjct: 195 MEKAGDRWWPVCGAVYVVSAVK 216


>gi|292493433|ref|YP_003528872.1| generic methyl-transferase [Nitrosococcus halophilus Nc4]
 gi|291582028|gb|ADE16485.1| generic methyl-transferase [Nitrosococcus halophilus Nc4]
          Length = 268

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 73/156 (46%), Gaps = 9/156 (5%)

Query: 82  ALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           +L+S  + LP A ++VD +++ H LE+  +P  +L E+ RVL   G ++V+  N   +W 
Sbjct: 95  SLLSRADTLPFASATVDGMVLPHVLEYEANPHQVLREVQRVLVPYGTLVVLGFNPWSLWG 154

Query: 141 -------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                  R    P+  G+ YS  ++   L    F        LF PP     +++     
Sbjct: 155 LWRLFLWRWGQVPW-CGRFYSLTRLRDWLALLGFETVELRYFLFRPPLQHPRLMRRLRFL 213

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH 229
           E +G  + P  AG Y++ A+K + +  P+    +K 
Sbjct: 214 EGVGQRWWPFLAGGYLVVAKKQVMRLNPVDPLWRKE 249


>gi|240102995|ref|YP_002959304.1| SAM-dependent methyltransferase [Thermococcus gammatolerans EJ3]
 gi|239910549|gb|ACS33440.1| SAM-dependent methyltransferase [Thermococcus gammatolerans EJ3]
          Length = 223

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW---ARME- 143
           +LP  D S D VL V   EF  +P  +L EI+RVL  GG +++   N R +W    R++ 
Sbjct: 91  SLPFPDESFDLVLSVTMFEFIHEPEKVLAEIYRVLKPGGEVLIGTMNGRSLWFLFKRLKS 150

Query: 144 ---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
               T +   + Y+  ++ +LLR A F    ++  +FFP
Sbjct: 151 LFMETAYRYARFYTPRELEALLRGAGFKNVESAGVIFFP 189


>gi|298368588|ref|ZP_06979906.1| methyltransferase type 11 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282591|gb|EFI24078.1| methyltransferase type 11 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 232

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 72/163 (44%), Gaps = 29/163 (17%)

Query: 81  TALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           T +V +G  L  A  S+D +LM H  E+ + P++ L E  RVL SGGR+++   N   +W
Sbjct: 59  TDVVMDGTALAWAAQSLDILLMPHSHEYCQQPYVALVEAARVLKSGGRLVISGFNLSSLW 118

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREAN-FTLSITSRS--------------LFFPPTHKK 184
                    SG    W+    L  + N FTL +  +               ++ PP   +
Sbjct: 119 GM-------SG----WFDGNLLPEKKNCFTLPVFKKKVLSLGFEIEYGKFMVYVPPVKTE 167

Query: 185 CILKLWSVFEKIGNIFGPGFAGIY--VIEARKILYQGLPITES 225
             LK W   EK G+ + P  A +Y  V+  R+     LP  E+
Sbjct: 168 SGLKFWQFMEKAGDRWWPAAAAVYGLVLVKREAGLTLLPEVEN 210


>gi|15644048|ref|NP_229097.1| hypothetical protein TM1293 [Thermotoga maritima MSB8]
 gi|170289309|ref|YP_001739547.1| methyltransferase type 11 [Thermotoga sp. RQ2]
 gi|4981851|gb|AAD36367.1|AE001784_9 conserved hypothetical protein [Thermotoga maritima MSB8]
 gi|170176812|gb|ACB09864.1| Methyltransferase type 11 [Thermotoga sp. RQ2]
          Length = 207

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 6/101 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR-----M 142
           NLPL D S D  LMV  + F +DP   L E +R+L  GG +IV + ++     R      
Sbjct: 83  NLPLKDESFDFALMVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNK 142

Query: 143 EHTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           E + F  + + +S  +++ L+R+A F      ++LF  P+ 
Sbjct: 143 EKSVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFKHPSE 183


>gi|330829019|ref|YP_004391971.1| methyltransferase [Aeromonas veronii B565]
 gi|328804155|gb|AEB49354.1| Methyltransferase [Aeromonas veronii B565]
          Length = 240

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 91/237 (38%), Gaps = 43/237 (18%)

Query: 16  LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPD 75
           +G      I   L     ++ G  LL +G      SC    +   +   P G+    + D
Sbjct: 21  MGDWVAAEIQDRLDNWCPNLFGYHLLKIGALSAELSCKRSSIRHQVGVAPGGRLLDMYGD 80

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV----- 130
                       +LP+   SVD  L+ H L+F+ DP  +L E  RVLT  G +I+     
Sbjct: 81  PL----------DLPVRTGSVDACLLAHCLDFSADPHQVLREAERVLTDDGWLIISGYNP 130

Query: 131 --------VVP--NKRGMWARMEHTPFGSGQPYSWYQMI--SLLREANFTLSITSRSLFF 178
                    VP   +R  W+    TP   G+   W  ++   ++ +  F  S        
Sbjct: 131 MSLVGIGHCVPFLRRRMPWSARMFTP---GRVTDWLHLLGCEVMFDERFGYSFMG----- 182

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSP 233
               K+     W   E IG  +   FA +YVI ARK  +  +P+    +  K +++P
Sbjct: 183 ----KQSWHSWWR--ESIGRDYCRAFASVYVIAARKRRFPLIPVRRRWQLPKSLATP 233


>gi|254234908|ref|ZP_04928231.1| hypothetical protein PACG_00783 [Pseudomonas aeruginosa C3719]
 gi|126166839|gb|EAZ52350.1| hypothetical protein PACG_00783 [Pseudomonas aeruginosa C3719]
          Length = 253

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 72/164 (43%), Gaps = 11/164 (6%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
            EG  PL++ + D VL+ H L+F   P  +L E  R +  GG ++++  N   +W  + H
Sbjct: 87  EEGAWPLSEHAADVVLLQHGLDFCLSPHRLLREAARTVRPGGHLLLIGINPWSLWG-IRH 145

Query: 145 TPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
             + +G      + I   R  +      F L       + PP          +  E+ G+
Sbjct: 146 --YFAGDALRQARCIPPSRACDWLNLLGFALEKRRFGCYRPPLASAAWQSRLARLERWGD 203

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
            +    AG Y++ ARK++    P+ +SK++      LVP  V+ 
Sbjct: 204 AWQSSGAGFYLLVARKLIVGLRPLRQSKREPRGQ--LVPMPVAK 245


>gi|241765317|ref|ZP_04763295.1| Methyltransferase type 11 [Acidovorax delafieldii 2AN]
 gi|241364998|gb|EER59909.1| Methyltransferase type 11 [Acidovorax delafieldii 2AN]
          Length = 288

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP-- 146
           LP AD+S+D +L+ H LE + DP   L E+ RVL   GR+++   N   +WA  +H    
Sbjct: 96  LPFADNSLDLILLPHTLELSVDPHAALREVERVLVPEGRVVISGLNATSLWALRQHRARL 155

Query: 147 ---FGSGQPY 153
               G G+PY
Sbjct: 156 YQRMGRGRPY 165


>gi|319942612|ref|ZP_08016920.1| hypothetical protein HMPREF9464_02139 [Sutterella wadsworthensis
           3_1_45B]
 gi|319803791|gb|EFW00723.1| hypothetical protein HMPREF9464_02139 [Sutterella wadsworthensis
           3_1_45B]
          Length = 292

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 59/141 (41%), Gaps = 22/141 (15%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP+AD S+D V + H LE + +P   LHE  RVL   GR+I+   N  G W   + T   
Sbjct: 106 LPIADESMDLVTLPHVLELSPNPQQALHEAVRVLEPEGRLILTAFNGAGFWWMRQQTVRL 165

Query: 149 SGQPY--------------SWYQMISL-LREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
             +PY               W+ ++ L +    F        L+ P       L  W   
Sbjct: 166 GAKPYLPTDMAPIPLRRLKDWFALLGLEIDRGRF-------GLYRPGFRSARRLHAWEWL 218

Query: 194 EKIGNIFGPGFAGIYVIEARK 214
           +K G+ + P  + I ++ A K
Sbjct: 219 DKAGDRWLPQCSNILLLSAVK 239


>gi|15597011|ref|NP_250505.1| hypothetical protein PA1814 [Pseudomonas aeruginosa PAO1]
 gi|107101246|ref|ZP_01365164.1| hypothetical protein PaerPA_01002279 [Pseudomonas aeruginosa PACS2]
 gi|116049764|ref|YP_791429.1| hypothetical protein PA14_41070 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218892232|ref|YP_002441099.1| hypothetical protein PLES_35131 [Pseudomonas aeruginosa LESB58]
 gi|254240207|ref|ZP_04933529.1| hypothetical protein PA2G_00849 [Pseudomonas aeruginosa 2192]
 gi|296389795|ref|ZP_06879270.1| hypothetical protein PaerPAb_16666 [Pseudomonas aeruginosa PAb1]
 gi|313110512|ref|ZP_07796397.1| hypothetical protein PA39016_002410099 [Pseudomonas aeruginosa
           39016]
 gi|9947799|gb|AAG05203.1|AE004608_2 hypothetical protein PA1814 [Pseudomonas aeruginosa PAO1]
 gi|115584985|gb|ABJ11000.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126193585|gb|EAZ57648.1| hypothetical protein PA2G_00849 [Pseudomonas aeruginosa 2192]
 gi|218772458|emb|CAW28240.1| hypothetical protein PLES_35131 [Pseudomonas aeruginosa LESB58]
 gi|310882899|gb|EFQ41493.1| hypothetical protein PA39016_002410099 [Pseudomonas aeruginosa
           39016]
          Length = 253

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 72/164 (43%), Gaps = 11/164 (6%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
            EG  PL++ + D VL+ H L+F   P  +L E  R +  GG ++++  N   +W  + H
Sbjct: 87  EEGAWPLSEHAADVVLLQHGLDFCLSPHRLLREAARTVRPGGHLLLIGINPWSLWG-IRH 145

Query: 145 TPFGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
             + +G      + I   R  +      F L       + PP          +  E+ G+
Sbjct: 146 --YFAGDALRQARCIPPSRACDWLNLLGFALEKRRFGCYRPPLASAAWQSRLARLERWGD 203

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
            +    AG Y++ ARK++    P+ +SK++      LVP  V+ 
Sbjct: 204 AWQSSGAGFYLLVARKLVVGLRPLRQSKREPRGQ--LVPMPVAK 245


>gi|315230427|ref|YP_004070863.1| methyltransferase [Thermococcus barophilus MP]
 gi|315183455|gb|ADT83640.1| methyltransferase [Thermococcus barophilus MP]
          Length = 225

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW---ARME- 143
           NLP    + D VL V   EF  +P  +L+EI+R+L  GG +++   N + +W    R++ 
Sbjct: 93  NLPFKKEAFDLVLSVTMFEFIHEPEKVLNEIYRILKLGGEVVIGTMNGKSLWFLFKRVKS 152

Query: 144 ---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
               T +   + Y+  ++ SLL  A F+  + S+S+ F P+
Sbjct: 153 LFVETAYRYARFYTSKELESLLANAGFS-DVESKSVIFFPS 192


>gi|30248165|ref|NP_840235.1| Generic methyl-transferase [Nitrosomonas europaea ATCC 19718]
 gi|30180050|emb|CAD84050.1| Generic methyl-transferase [Nitrosomonas europaea ATCC 19718]
          Length = 278

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 8/133 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP+  SS+D VL+ H LEF  +P  +L E  RVL   G++I+   N   +W  M      
Sbjct: 79  LPIKSSSIDLVLLPHTLEFNSNPHQILREAHRVLIPEGKVIISGFNPFSLWG-MRQRMAK 137

Query: 149 SGQPYSWY-------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
           S   + W        +M   L   NF +       + PP  ++  L      E  G+ + 
Sbjct: 138 SKTDFPWCGRFIALPRMQDWLELHNFEIVAGQFGCYVPPCTREKWLSRLRFMEAAGDRWW 197

Query: 202 PGFAGIYVIEARK 214
           P   G+Y ++A K
Sbjct: 198 PIAGGVYFLQAVK 210


>gi|332526658|ref|ZP_08402763.1| hypothetical protein RBXJA2T_12247 [Rubrivivax benzoatilyticus JA2]
 gi|332110919|gb|EGJ11096.1| hypothetical protein RBXJA2T_12247 [Rubrivivax benzoatilyticus JA2]
          Length = 267

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 16/142 (11%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT--- 145
           LP    SVD V++ H LE A DP  +L E+ R+L   GR+++   N   +WA  + +   
Sbjct: 91  LPFPQHSVDLVVLPHALELAADPHQLLREVERILVPEGRLVISGLNPASLWALRQRSGHA 150

Query: 146 ----PFGSGQP---------YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
                 G GQP           ++++   LR   F +       + PP   +  L+ +  
Sbjct: 151 WRGIGLGRGQPTYLPRAGEFIGYWRLRDWLRLLGFHIESGRFGCYRPPLSSERWLQRFEW 210

Query: 193 FEKIGNIFGPGFAGIYVIEARK 214
            + +G+ + P     Y + A K
Sbjct: 211 MDPVGDRWWPVLGAAYFLVAVK 232


>gi|56479131|ref|YP_160720.1| generic methyl-transferase [Aromatoleum aromaticum EbN1]
 gi|56315174|emb|CAI09819.1| Generic methyl-transferase [Aromatoleum aromaticum EbN1]
          Length = 246

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 58/132 (43%), Gaps = 6/132 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------ARM 142
           LP A +++D VL+ H LEF+ +P  +L E+ RVL   G  I+   N   +W      AR 
Sbjct: 75  LPFATATLDLVLLPHVLEFSPNPHQVLREVERVLVPEGHAIISGFNPLSLWGVRRLLARD 134

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           +      GQ  S  +    L    F     S   + P       L+ W   +K G+ + P
Sbjct: 135 DGAFPWRGQYLSVRRTKDWLALLGFETQSGSFGCYAPAVTSGKWLERWRFIDKAGDRWWP 194

Query: 203 GFAGIYVIEARK 214
            F G Y+I+  K
Sbjct: 195 IFGGTYIIQGIK 206


>gi|91788149|ref|YP_549101.1| hypothetical protein Bpro_2280 [Polaromonas sp. JS666]
 gi|91697374|gb|ABE44203.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 278

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 22/200 (11%)

Query: 57  VERTLAFMPAGQGATNWPDQYFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLML 115
            +R  +  PA  G++          AL+++   LP  +SS+D V++ H LE + DP   L
Sbjct: 76  ADRASSATPAATGSS-------PRAALITDSAALPFPESSLDLVVLPHTLELSGDPHATL 128

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWA-RMEHTPF------------GSGQPYSWYQMISLL 162
            E+ RVL   GR+++   N   +W  R     F             +G+   ++++   L
Sbjct: 129 REVERVLVPEGRVVISGFNPTSLWGFRQSRGHFYQRLGYQDLFLPKTGEFIGYWRLRDWL 188

Query: 163 REANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           R  NF +       + P    +  L  +   +  G  + P F  +Y + A K + +G+ +
Sbjct: 189 RLLNFEVESGRFGCYRPALTSQKWLDRFDWMDAAGERWWPIFGAVYFLVAVKRV-RGVRL 247

Query: 223 TESKKKHISSPILVPHTVST 242
            E   K   +P   P  V+ 
Sbjct: 248 LEPAWKTRKNPAAAPTAVAN 267


>gi|288817945|ref|YP_003432292.1| SAM-dependent methyltransferase [Hydrogenobacter thermophilus TK-6]
 gi|288787344|dbj|BAI69091.1| SAM-dependent methyltransferase [Hydrogenobacter thermophilus TK-6]
 gi|308751543|gb|ADO45026.1| Methyltransferase type 11 [Hydrogenobacter thermophilus TK-6]
          Length = 215

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 46/108 (42%), Gaps = 7/108 (6%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           L     LP  DS  D  L+V  L F EDP   L E +RVL  G  +++ +      WA  
Sbjct: 80  LAKAEELPFKDSVFDSALIVVSLCFFEDPLASLKEAYRVLKEGSFLLLGLVLSESPWAEF 139

Query: 143 EHTPFGSGQP-------YSWYQMISLLREANFTLSITSRSLFFPPTHK 183
                  G P       YS+ Q++SL++ A F       +LF  P  K
Sbjct: 140 YREKAKKGHPIYSYAKFYSYPQLLSLIQSAGFKKDKAYTTLFEEPQDK 187


>gi|121534279|ref|ZP_01666103.1| Methyltransferase type 11 [Thermosinus carboxydivorans Nor1]
 gi|121307049|gb|EAX47967.1| Methyltransferase type 11 [Thermosinus carboxydivorans Nor1]
          Length = 229

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 64/156 (41%), Gaps = 11/156 (7%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A +    W ++    TA      LP  D++ D V+ +  +EF E+P   LHE+ R+L  G
Sbjct: 77  AAEKNKTWGNRVSFVTA--DAAALPFPDNAFDMVVSITAMEFFEEPRRCLHEMHRILRPG 134

Query: 126 GRMIVVVPNKRGMWARME-------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           GRMIV       +W+           T F   + YS   +  LL     T+S     +F 
Sbjct: 135 GRMIVATLGNWSLWSMQRRLKTLFTRTIFSHTRFYSIRDIARLLNP--ITISEWRGGIFI 192

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           PP     +++     E+ G  + P      V+   K
Sbjct: 193 PPFAPAALIRHPDKLERWGQKWIPALGTFLVVRVDK 228


>gi|319793186|ref|YP_004154826.1| methyltransferase type 11 [Variovorax paradoxus EPS]
 gi|315595649|gb|ADU36715.1| Methyltransferase type 11 [Variovorax paradoxus EPS]
          Length = 250

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 68/164 (41%), Gaps = 13/164 (7%)

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           MP    A + P +   +T L     LP A +S+D V+M H LE + DP   L E+ RVL 
Sbjct: 49  MPHRWLALSDPMRPAKATLLTDFTALPFAANSLDLVVMPHALELSPDPHATLREVERVLV 108

Query: 124 SGGRMIVVVPNKRGMWA---RMEH--TPFGSGQPY--------SWYQMISLLREANFTLS 170
             GR+++   N   +W    R  H     G G  Y         +++M   LR  +F + 
Sbjct: 109 PEGRVVICGLNPASLWGMRQRRAHLYRKLGVGDLYLPEGGEFIGYWRMRDWLRLLSFEVE 168

Query: 171 ITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                ++ P       L+     +K G  + P F   Y + A K
Sbjct: 169 SGRFGIYRPAVRSDAWLERCRWMDKAGERWWPIFGAAYFLVAVK 212


>gi|312883831|ref|ZP_07743550.1| SAM-dependent methyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368580|gb|EFP96113.1| SAM-dependent methyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 249

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 15/172 (8%)

Query: 81  TALVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN----- 134
           + ++++G +LP  + S D VL+ H L++  DP  ML E+ RV+   G +I+   N     
Sbjct: 75  SNVIADGYDLPFLEKSFDAVLVAHQLDYCNDPHRMLREVDRVVIDDGYLIITGFNPLSLI 134

Query: 135 --KRGMWARMEHTPFGSGQPYSWYQMISLLREANFT-LSITSRSLFFPPTHKKCILKLWS 191
              R M  + ++ P+ SG+ ++  +M   L   N+  L   S ++F  P  K  +L +W 
Sbjct: 135 GLTRFMPWKKKYLPW-SGRMFTPNRMKDWLGLLNYQILECDSYAVFSSP--KSNLLSVW- 190

Query: 192 VFEKIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVST 242
           +   +G    P F  +Y I ARK  Y   PI    K K   SP+ + + VS 
Sbjct: 191 LENSLGEWASP-FGSLYFIVARKRTYPLKPIKPHWKLKRKLSPLSINYRVSN 241


>gi|253996675|ref|YP_003048739.1| type 11 methyltransferase [Methylotenera mobilis JLW8]
 gi|253983354|gb|ACT48212.1| methyltransferase type 11 [Methylotenera mobilis JLW8]
          Length = 262

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 73/162 (45%), Gaps = 14/162 (8%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------RM 142
           LP+AD+S+D +++ H LEF+E P   L E  RV+   G +++   N   +W        +
Sbjct: 87  LPIADASLDLLILPHRLEFSERPHQTLREAERVMMPEGHLLISGFNPLSLWGMALFLRNL 146

Query: 143 EHTPFGSGQPYSWY-------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
            H+   + + + W        ++   L    F +         PP  ++   + +    K
Sbjct: 147 LHSNDAAAKSFPWTGSFIGLGRLKDWLALLGFEVVSVQMCCHIPPFEQESWHRRFGFMGK 206

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILV 236
           +G  +     G+Y I A+K +    P+  S K + ++SP++V
Sbjct: 207 LGAKWLSAIGGVYFIVAKKRVVGMTPLKPSWKAQPVTSPLVV 248


>gi|149377450|ref|ZP_01895193.1| SAM-dependent methyltransferase [Marinobacter algicola DG893]
 gi|149358291|gb|EDM46770.1| SAM-dependent methyltransferase [Marinobacter algicola DG893]
          Length = 273

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 68/156 (43%), Gaps = 9/156 (5%)

Query: 72  NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           NW        A+     LP    S+D V++ H  +F+  P   L E  RVL   G M+++
Sbjct: 74  NWQSSIPDGVAVCDADELPFPGDSMDLVILHHTADFSPHPHQALREASRVLRGEGVMMLI 133

Query: 132 VPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
             N   +W      +R    P+G G+     +M   LR  +F++  +  S F  P  +  
Sbjct: 134 GFNPFSLWGLRKLVSRHHEGPWG-GRFLMKGRMEDWLRLLDFSVESSDSSFFQVPLQRAV 192

Query: 186 ILKLWSVFEKI-GNIFGPGFAGIYVIEARKILYQGL 220
           + +   + E++ GN F P     Y I A+K +Y  L
Sbjct: 193 LAERRGLMERLCGNRFLP-VGAYYCILAKKRVYSRL 227


>gi|209695825|ref|YP_002263755.1| hypothetical protein VSAL_I2400 [Aliivibrio salmonicida LFI1238]
 gi|208009778|emb|CAQ80084.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 247

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 74/161 (45%), Gaps = 14/161 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--------W 139
            LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N            W
Sbjct: 84  QLPFLEKSIDACVLAHQLDYSSDPHQLLREVDRVLIHDGYVILTGFNPMSAIGIASLFPW 143

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            R  + P+ SG+ ++ +++   L   NF +  +      P T  + I   W+ FE +G  
Sbjct: 144 -RKNNLPW-SGRMFTPHRIKDWLAVLNFEVVYSDCFALAPLTRYQTI---WTWFENLGGE 198

Query: 200 FGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHT 239
                +GIY I ARK  Y    I  + KKK   +PI V  T
Sbjct: 199 SVKPVSGIYFIVARKRTYPLKAIKSAWKKKPKLAPISVAQT 239


>gi|212635107|ref|YP_002311632.1| S-adenosyl-L-methionine-dependent methyltransferase [Shewanella
           piezotolerans WP3]
 gi|212556591|gb|ACJ29045.1| S-adenosyl-L-methionine-dependent methyltransferase, putative
           [Shewanella piezotolerans WP3]
          Length = 224

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 11/110 (10%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST 81
           ++I +V+ + W  V G  +L LG           KV++T   +       + P+    + 
Sbjct: 4   ESIEEVMFSWWPRVFGYYMLSLG-------PLSAKVDKTGVGVSCHYSLFDEPE----AD 52

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            L     LP+ ++SVD V+M   LEF  DP+ +L E+ RVL SGG +I+ 
Sbjct: 53  ILADYSQLPIQNASVDAVVMNFLLEFETDPYRLLREVDRVLISGGHLIIA 102


>gi|88813347|ref|ZP_01128585.1| methyl-transferase [Nitrococcus mobilis Nb-231]
 gi|88789405|gb|EAR20534.1| methyl-transferase [Nitrococcus mobilis Nb-231]
          Length = 244

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 85/210 (40%), Gaps = 21/210 (10%)

Query: 38  CRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ------GATNWPDQYFSSTAL---VSEGN 88
           CRLL    A     C H +    +     GQ      GA  W  + +    +    S   
Sbjct: 21  CRLLSQRLA-----CLHARRVLQVGGFGGGQRPALFCGARQWVLENWLGGPVDIAASPVE 75

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-------R 141
           LP  + ++D V+++H LEF++ P  +L E  RVL+  G ++V+  N   +W        R
Sbjct: 76  LPFQNETMDVVVLIHQLEFSDKPHQILREAERVLSPEGHLLVLGFNPFSLWGLRYLFTRR 135

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
               P  +G+  S  ++   +R     +    R  F PP + + +L      E+ G  + 
Sbjct: 136 RCCGPPWTGRYRSQARIEDWMRLLGLKIECRERLYFRPPLNNRTMLGRLRQLEEFGPRYL 195

Query: 202 PGFAGIYVIEARKILYQGLPITESKKKHIS 231
               GI++    K +   +P    ++  ++
Sbjct: 196 HWLGGIHLTVGHKRVAGMIPAQPLRQPRLT 225


>gi|18977547|ref|NP_578904.1| hypothetical protein PF1175 [Pyrococcus furiosus DSM 3638]
 gi|18893258|gb|AAL81299.1| hypothetical protein PF1175 [Pyrococcus furiosus DSM 3638]
          Length = 210

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           NLP  D+S+DC+LMV  + F +DP   + E +RVL  GG +++   +K  +  R      
Sbjct: 85  NLPFEDNSLDCILMVTTICFVDDPEKAIKEAYRVLKPGGYIVIGFVDKESLIGREYEKRK 144

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
                +   + +S  +++ LL    F +    ++LF
Sbjct: 145 DKSVFYRDARFFSAREIMELLERNGFKIDGVVQTLF 180


>gi|322831644|ref|YP_004211671.1| methyltransferase type 11 [Rahnella sp. Y9602]
 gi|321166845|gb|ADW72544.1| Methyltransferase type 11 [Rahnella sp. Y9602]
          Length = 241

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 89/226 (39%), Gaps = 28/226 (12%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           A+ + L   W  + G  LL +G            +   + F   G+G     D Y     
Sbjct: 28  ALEQQLQPWWGKLYGFHLLKIGALSAEIDARACPISHQVNFAQEGEGLHVRGDPY----- 82

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
                +LP A  SVD  L+ H L +A+DP  +L E+ RVL   G M++   N   +    
Sbjct: 83  -----HLPFAAKSVDACLLSHTLAYADDPHRILREVDRVLIDDGWMVLSSFNPLSLLGIG 137

Query: 143 EHTP-FGSGQPYS-----WYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
           +  P F   QPYS       +++  L   N+ + +  R    P   KK   KL S     
Sbjct: 138 KLMPLFRKRQPYSSRLFTQMRLLDWLSLLNYEVMVHRRFHVLP--WKKNGGKLLSTHL-- 193

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                P    + +I ARK   +  P+T + KK ++    +P  V  
Sbjct: 194 -----PALGCMTLIIARK---RTFPLTPTAKKVLAQKQKIPQAVGA 231


>gi|209520780|ref|ZP_03269526.1| Methyltransferase type 11 [Burkholderia sp. H160]
 gi|209498777|gb|EDZ98886.1| Methyltransferase type 11 [Burkholderia sp. H160]
          Length = 312

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 71  TNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           TN+P     ST +   G  LP  D+S D VL ++ LE  +DPF    EI RVL  GG ++
Sbjct: 147 TNYP-----STDVRGVGEVLPFKDASFDGVLSLNVLEHVKDPFTAAKEILRVLKPGGDLV 201

Query: 130 VVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
           VVVP           T    G P+ +Y M +      F  SI    ++ P    +    +
Sbjct: 202 VVVP----------LTQPTHGYPHHYYNMTAEGILNLFGSSIDVERVYVP----ESTTAI 247

Query: 190 WSVF 193
           WS++
Sbjct: 248 WSIY 251


>gi|226945029|ref|YP_002800102.1| hypothetical protein Avin_29610 [Azotobacter vinelandii DJ]
 gi|226719956|gb|ACO79127.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW--- 139
           +  E   PLA+ + D V++ H L+F+  P  +L E  R +  GG ++VV  N R +W   
Sbjct: 83  VCEEQAWPLAEHAADVVVLQHALDFSLSPHALLREAARSVRPGGHLLVVGINPRSLWGLR 142

Query: 140 ------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                 A  +    GS +   W  ++       F L       + PP   +      +  
Sbjct: 143 RLFASDALRQARCIGSSRVGDWLSLL------GFALEKRRFGCYRPPLSSRAWQSRTARL 196

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           E  G  +     G Y++  RK++    P+ +++++ I   + +P
Sbjct: 197 ESWGESWQMPGGGFYLLVVRKLVVGLRPLPQTRREPIGKLLPLP 240


>gi|311103919|ref|YP_003976772.1| methyltransferase [Achromobacter xylosoxidans A8]
 gi|310758608|gb|ADP14057.1| methyltransferase domain protein 1 [Achromobacter xylosoxidans A8]
          Length = 257

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 69/164 (42%), Gaps = 23/164 (14%)

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           +P+ + A +W     S   L     LP    SVD +++ H  E AE+P  +L E+ RVL 
Sbjct: 69  IPSAESAASWQ----SRVVLAEPEALPFESQSVDLLILPHAFECAEEPHNVLREVERVLV 124

Query: 124 SGGRMIVVVPNKRGMWA---RMEHTPFGSGQPYS----------WYQMISLLREANFTLS 170
             GR+++   N   MW    RM        QP S          W++++SL  +A+    
Sbjct: 125 PEGRVVISGFNPWSMWGARTRMPGMEPWLPQPPSSQVSLPRLKDWFKLLSLEVDASHF-- 182

Query: 171 ITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                 + P    +  L+ WS  E  G  +      +YV+ A K
Sbjct: 183 ----GCYAPACRSEKWLQRWSFLESAGARWWSLGGAVYVVSAVK 222


>gi|88800081|ref|ZP_01115651.1| generic methyl-transferase [Reinekea sp. MED297]
 gi|88777207|gb|EAR08412.1| generic methyl-transferase [Reinekea sp. MED297]
          Length = 264

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 19/155 (12%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW-------- 139
           NLP    S+D +LM H L+  E+P+ ++ E    L  GG +IV+  N   +W        
Sbjct: 100 NLPFEPESIDMLLMHHTLDICENPYQVIREGAIALKPGGVLIVLGFNPYSLWGLRALIQG 159

Query: 140 ----ARMEHTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
               A + H+ F  SG+   W  ++      +F L    + LF+PP  +   L+  +   
Sbjct: 160 RGEGAGIWHSRFLRSGRVEDWMHLL------DFELERHEKHLFYPPYRRPSWLQRLNFGG 213

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH 229
           ++     P    +Y++   K +   LP  E + K 
Sbjct: 214 RVQRRLLPFTGAVYLLVGYKQVLGRLPAAEKRVKR 248


>gi|297526862|ref|YP_003668886.1| Methyltransferase type 11 [Staphylothermus hellenicus DSM 12710]
 gi|297255778|gb|ADI31987.1| Methyltransferase type 11 [Staphylothermus hellenicus DSM 12710]
          Length = 201

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           D+ F         N+PL D SVD V+ +  +E  +DP   LHE  RVL  GG +I+ +PN
Sbjct: 57  DKPFIMKLCADAQNIPLRDESVDVVIAISLIEHLQDPIKCLHEASRVLKEGGYLIIQLPN 116


>gi|83645318|ref|YP_433753.1| SAM-dependent methyltransferase [Hahella chejuensis KCTC 2396]
 gi|83633361|gb|ABC29328.1| SAM-dependent methyltransferase [Hahella chejuensis KCTC 2396]
          Length = 259

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 65/166 (39%), Gaps = 16/166 (9%)

Query: 64  MPAGQGA---------TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLM 114
           +P GQ +           W  +    + +     LPL   S+D V++ H L+ A  P   
Sbjct: 60  LPVGQSSLLGHRIISVPRWEKELPEGSLVCHSHELPLESDSIDLVILHHTLDVAARPHQS 119

Query: 115 LHEIWRVLTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFT 168
           L E  RVL SGG M+++  N    W       R    P+ SG+  +  ++   L   +F 
Sbjct: 120 LREAARVLRSGGHMVIIGFNPLSAWGLRRAIFRSPKAPW-SGRFLTSSRLEDWLSLLDFR 178

Query: 169 LSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           L       + PP   +  L   +  +K G  F       Y I A+K
Sbjct: 179 LKDVRYRFYAPPVTNQQWLSRLAFLDKFGARFRLPLGAYYTIVAQK 224


>gi|126174221|ref|YP_001050370.1| type 11 methyltransferase [Shewanella baltica OS155]
 gi|153000537|ref|YP_001366218.1| type 11 methyltransferase [Shewanella baltica OS185]
 gi|160875174|ref|YP_001554490.1| type 11 methyltransferase [Shewanella baltica OS195]
 gi|217973497|ref|YP_002358248.1| type 11 methyltransferase [Shewanella baltica OS223]
 gi|125997426|gb|ABN61501.1| Methyltransferase type 11 [Shewanella baltica OS155]
 gi|151365155|gb|ABS08155.1| Methyltransferase type 11 [Shewanella baltica OS185]
 gi|160860696|gb|ABX49230.1| Methyltransferase type 11 [Shewanella baltica OS195]
 gi|217498632|gb|ACK46825.1| Methyltransferase type 11 [Shewanella baltica OS223]
 gi|315267368|gb|ADT94221.1| Methyltransferase type 11 [Shewanella baltica OS678]
          Length = 245

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 55/118 (46%), Gaps = 17/118 (14%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A++K L   W  V G  LL LG      S     V    +  P+ +GA+     
Sbjct: 19  GEALQQAVAKQLEDWWPRVFGYHLLKLGPLSAELSSMASPVAHHFSLSPS-KGAS----- 72

Query: 77  YFSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                    EG+   LPL ++++D V+M   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 73  --------IEGDFCHLPLQNAAIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYLFIV 122


>gi|217970691|ref|YP_002355925.1| hypothetical protein Tmz1t_2290 [Thauera sp. MZ1T]
 gi|217508018|gb|ACK55029.1| conserved hypothetical protein [Thauera sp. MZ1T]
          Length = 241

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA---- 140
           SE  LP A  S+D VL+ H LEF+  P  +L E+ RVL   G +++   N   +W     
Sbjct: 70  SEYELPFATGSLDLVLLPHVLEFSAHPHRVLREVERVLVPEGSVVISGFNPLSLWGLRRL 129

Query: 141 ---RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
              R    P+ SG   S  ++   L    F +  +    + PP      L+ W   ++ G
Sbjct: 130 MARRGAEAPW-SGHYRSAMRIRDWLNLLGFEIQESRFGCYAPPLRTPQWLERWGCLDRAG 188

Query: 198 NIFGPGFAGIYVIEARK 214
           + + P     Y++   K
Sbjct: 189 SRWWPVLGAGYLLHGVK 205


>gi|319762432|ref|YP_004126369.1| methyltransferase type 11 [Alicycliphilus denitrificans BC]
 gi|330825717|ref|YP_004389020.1| type 11 methyltransferase [Alicycliphilus denitrificans K601]
 gi|317116993|gb|ADU99481.1| Methyltransferase type 11 [Alicycliphilus denitrificans BC]
 gi|329311089|gb|AEB85504.1| Methyltransferase type 11 [Alicycliphilus denitrificans K601]
          Length = 260

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 65/149 (43%), Gaps = 15/149 (10%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------ARME 143
           P A+ S+D V M H LE + DP   L E++RVL   GR ++   N   +W      AR+ 
Sbjct: 93  PFAEGSLDLVAMPHTLELSVDPHAALREVYRVLVPEGRAVISGLNPLSLWGLRQWRARLY 152

Query: 144 HTPFGSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
               G GQ Y        +  ++   LR   F L   S   + P    +  L+ +   + 
Sbjct: 153 QRCGGGGQLYLPDVGEFITPGRLRDWLRLLGFELESISFGCYRPAAASERWLEHYGWMDG 212

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITE 224
           +G  + P     YVI A K + QG+ + E
Sbjct: 213 LGARWWPILGAAYVIVAAKRV-QGMRLLE 240


>gi|326317358|ref|YP_004235030.1| type 11 methyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374194|gb|ADX46463.1| Methyltransferase type 11 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 279

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 73/183 (39%), Gaps = 15/183 (8%)

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P  +  T   D    +  L     LP  ++S+D VL+ H LE + DP   L E+ RVL  
Sbjct: 73  PPAETETGPADGAVRAALLADPVALPFPENSLDLVLLPHALELSVDPHAALREVHRVLMP 132

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPY--------SWYQMISLLREANFTLS 170
            GR++V   N   +W       R+       GQ Y          +++   LR  NF + 
Sbjct: 133 EGRLVVSGLNPVSLWGLRQRRVRLYQRLGAGGQLYLPDVGEFIGHWRLRDWLRLLNFEIE 192

Query: 171 ITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
             S   + P       L  +   + +G  + P     Y++ A K ++ G+ + E   +  
Sbjct: 193 TISFGAYRPAVRSARWLDRYEWLDAVGARWWPILGAAYMVVAVKRVH-GMRLLEPSWRTG 251

Query: 231 SSP 233
            +P
Sbjct: 252 QAP 254


>gi|114332142|ref|YP_748364.1| generic methyl-transferase [Nitrosomonas eutropha C91]
 gi|114309156|gb|ABI60399.1| generic methyl-transferase [Nitrosomonas eutropha C91]
          Length = 235

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-RMEHTPF 147
           LP+  +S+D VL+ H LEF   P  + HE+ RVL   GR+I+   N   +W  R   T  
Sbjct: 70  LPIRSNSLDLVLLPHTLEFNSYPLQIFHEVQRVLIDEGRVIISGFNPFSLWGIRWRMTK- 128

Query: 148 GSGQPYSWY-QMISLLREA------NFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
            SG  + W  + I L R        +F +       + PP   +  L      E  G+ +
Sbjct: 129 -SGMDFPWRGRFIDLSRVKDWLELLDFEIVAGQFGCYVPPFTGEKWLSRLRFMEAAGDRW 187

Query: 201 GPGFAGIYVIEARK 214
            P   G+Y ++A K
Sbjct: 188 WPVAGGVYFLQAVK 201


>gi|121607586|ref|YP_995393.1| type 11 methyltransferase [Verminephrobacter eiseniae EF01-2]
 gi|121552226|gb|ABM56375.1| Methyltransferase type 11 [Verminephrobacter eiseniae EF01-2]
          Length = 274

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 14/158 (8%)

Query: 74  PDQYFSSTALVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           P +     AL++E   LP A +S+D +++ H LE + DP   L E+ RVL   GR+++  
Sbjct: 54  PQRQRQQAALLAEPVALPFAAASLDLIVLPHTLELSIDPHAALREVERVLMPEGRVVISG 113

Query: 133 PNKRGMWARMEHTP-----FGSGQPY--------SWYQMISLLREANFTLSITSRSLFFP 179
            N   +W   +         G G PY         ++++   LR   F +  T    + P
Sbjct: 114 LNPTSLWGLRQRRARWYRHLGHGTPYLPEVGELIGYWRLRDWLRLLGFEVESTRFGCYRP 173

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
                  L+ +   + +G  + P     Y + A K ++
Sbjct: 174 AVRNAQWLERFGWMDALGEKWWPILGAAYFLVAVKRVH 211


>gi|187921339|ref|YP_001890371.1| type 11 methyltransferase [Burkholderia phytofirmans PsJN]
 gi|187719777|gb|ACD21000.1| Methyltransferase type 11 [Burkholderia phytofirmans PsJN]
          Length = 810

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
           GN+P  D SVD  +    LE  EDP  +L+E  R+LT GGR+IV VP+     +  +  P
Sbjct: 312 GNIP--DDSVDTAISFETLEHVEDPVALLNEFHRILTPGGRLIVSVPHDWSDESGFDPNP 369

Query: 147 F 147
           F
Sbjct: 370 F 370


>gi|149908876|ref|ZP_01897536.1| methyltransferase [Moritella sp. PE36]
 gi|149808150|gb|EDM68091.1| methyltransferase [Moritella sp. PE36]
          Length = 227

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 84/207 (40%), Gaps = 23/207 (11%)

Query: 16  LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL-AFMPAGQGATNWP 74
           +G+     I   L      + G  LL LG      +CF   ++  + A    G G     
Sbjct: 1   MGEWLASQIQARLDAWCPTIFGYHLLKLGSLSGELNCFGCSIQHQVTATSELGMGGI--- 57

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
                    +   +LP  ++ +D  ++   L+F+ DP  +L E+ RVLT  G +I+   N
Sbjct: 58  --------FIDPAHLPFQENCIDACILTQSLDFSADPHQVLREVERVLTGDGYLILSGYN 109

Query: 135 KRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCIL 187
              +         +  H P+ SG+ ++  ++   L    F +    R  F     KK  L
Sbjct: 110 PLSLCGLVKLCGIKRNHPPW-SGRMFTPARIKDWLELLGFEIIQDDRFGFTSFLGKK-PL 167

Query: 188 KLWSVFEKIGNIFGPGFAGIYVIEARK 214
             WS  E IG +  P F+ +Y I ARK
Sbjct: 168 TWWS--ESIGQMHFPSFSSVYFIVARK 192


>gi|20808303|ref|NP_623474.1| SAM-dependent methyltransferase [Thermoanaerobacter tengcongensis
           MB4]
 gi|20516906|gb|AAM25078.1| SAM-dependent methyltransferases [Thermoanaerobacter tengcongensis
           MB4]
          Length = 212

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 15/133 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           NLP  DSS D VLMV  + F +DP   L E +RVL + G +++   ++     R+     
Sbjct: 89  NLPFEDSSFDLVLMVTTICFVDDPLRALKECYRVLKNDGTILIGFVDRDSTIGRIYQANK 148

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
                +     ++  +++ LL EA F     S+++F          KL  + EK    +G
Sbjct: 149 EKSLFYKEATFFTTAEIVELLYEAGFKNFNFSQTIF---------KKLDEIKEKEPVKYG 199

Query: 202 PGFAGIYVIEARK 214
            G     VI A+K
Sbjct: 200 FGKGSFVVISAKK 212


>gi|295675913|ref|YP_003604437.1| Methyltransferase type 11 [Burkholderia sp. CCGE1002]
 gi|295435756|gb|ADG14926.1| Methyltransferase type 11 [Burkholderia sp. CCGE1002]
          Length = 312

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 71  TNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           TN+P     ST +   G  LP  D+S D +L ++ LE  +DPF    EI RVL  GG ++
Sbjct: 147 TNYP-----STDVRGVGEALPFKDASFDGLLSLNVLEHVKDPFTAAKEILRVLKPGGDLV 201

Query: 130 VVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
           VVVP           T    G P+ +Y M +      F   I +  ++ P    +    +
Sbjct: 202 VVVP----------LTQPTHGYPHHYYNMTAEGILNLFGSEIKAERVYVP----ESTTAI 247

Query: 190 WSVF 193
           WS++
Sbjct: 248 WSIY 251


>gi|187479405|ref|YP_787430.1| hypothetical protein BAV2935 [Bordetella avium 197N]
 gi|115423992|emb|CAJ50545.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 252

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 81/217 (37%), Gaps = 12/217 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IVEL +++ +  GK               DV G     +G A P     +    +     
Sbjct: 8   IVELAEWFQTPPGKYALAWERARFDEEVADVFGYYAWQMGLADPDLLANNRMPFKAWVGA 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                 T WP +  +   L     LP    SVD +++ H LE AE P  +L E+ RVL  
Sbjct: 68  DLFTSDTAWPARVQAQPEL-----LPFESQSVDLLVLPHMLECAEAPHEVLREVERVLVP 122

Query: 125 GGRMIVVVPNKRGMWARMEHTP-FGSGQPYSWYQMISL------LREANFTLSITSRSLF 177
            GR+++   N   +W      P   +  P      +SL      L+  +F +       F
Sbjct: 123 EGRVVISGFNPWSLWGVRNALPGMEAWLPVPLKSQVSLPRLRDWLKLLSFEVDRGHYGCF 182

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            P    +  +K W   E +G  +      +YV+ A K
Sbjct: 183 IPACRNESWIKRWHFMEGLGKRWWRVGGAVYVVSAVK 219


>gi|52696211|pdb|1VLM|A Chain A, Crystal Structure Of Sam-Dependent Methyltransferase,
           Possible Histamine N-Methyltransferase (Tm1293) From
           Thermotoga Maritima At 2.20 A Resolution
 gi|52696212|pdb|1VLM|B Chain B, Crystal Structure Of Sam-Dependent Methyltransferase,
           Possible Histamine N-Methyltransferase (Tm1293) From
           Thermotoga Maritima At 2.20 A Resolution
          Length = 219

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 6/101 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR-----M 142
           NLPL D S D  L V  + F +DP   L E +R+L  GG +IV + ++     R      
Sbjct: 95  NLPLKDESFDFALXVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNK 154

Query: 143 EHTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           E + F  + + +S  ++  L R+A F      ++LF  P+ 
Sbjct: 155 EKSVFYKNARFFSTEELXDLXRKAGFEEFKVVQTLFKHPSE 195


>gi|192360820|ref|YP_001982515.1| generic methyl-transferase [Cellvibrio japonicus Ueda107]
 gi|190686985|gb|ACE84663.1| Generic methyl-transferase [Cellvibrio japonicus Ueda107]
          Length = 301

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/227 (18%), Positives = 91/227 (40%), Gaps = 26/227 (11%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           +R  I ++ +++ + LG+       ++++ + + + G  L+ LG +         ++   
Sbjct: 29  LRDSIEDMSEWFETPLGQALIQEEKRLVNESLNCLFGYHLMQLGISGRIDMGEGIRISHR 88

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
               P         D++   + L    +LPLA  S+D V++ H L++ + P  +L E  R
Sbjct: 89  FLLHPRR-------DEHPKLSGLTDFNHLPLASDSIDAVILHHTLDYTQSPHHLLREAAR 141

Query: 121 VLTSGGRMIVVVPNKRGMW-------------ARMEHTPFGSGQPYSWYQMISLLREANF 167
           V+   G ++++  N   +W             AR  +     G+   W  ++      N 
Sbjct: 142 VIIPRGHLVIIGFNPWSLWGLGSWVARLFSSQARWRYQYLRLGRLLDWLSLV------NL 195

Query: 168 TLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                 +  + PP  +   ++     E  G  +   + G Y+I ARK
Sbjct: 196 EPVEIYQGYYRPPLAQPNAIQHLQWMESWGKRWRLPWGGFYMIVARK 242


>gi|163793717|ref|ZP_02187691.1| Nitroreductase [alpha proteobacterium BAL199]
 gi|159180828|gb|EDP65345.1| Nitroreductase [alpha proteobacterium BAL199]
          Length = 464

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           T L+ +G LP AD+SVD V++   LE   DP  ML E+ RVL  GG ++  + N    + 
Sbjct: 334 TELMPQGVLPHADASVDAVVLPQVLEHMPDPQRMLDEVRRVLKPGGHVVASIRNLDSDYG 393

Query: 141 RMEH 144
           R  H
Sbjct: 394 RHWH 397


>gi|307721808|ref|YP_003892948.1| Methyltransferase type 11 [Sulfurimonas autotrophica DSM 16294]
 gi|306979901|gb|ADN09936.1| Methyltransferase type 11 [Sulfurimonas autotrophica DSM 16294]
          Length = 209

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           N+PLAD   D VLMV  + F +DP + L  I+R+L   G +I+   +K     ++     
Sbjct: 86  NIPLADEKYDFVLMVTTICFVDDPLMSLKNIYRILEPKGAVIIGFVDKNSQLGKLYEQNS 145

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
                +     Y+  ++I+LL +  F+     ++LF
Sbjct: 146 QQSRFYKEAHFYTAEEIINLLEKVGFSHVTCVQTLF 181


>gi|323498000|ref|ZP_08103009.1| SAM-dependent methyltransferase [Vibrio sinaloensis DSM 21326]
 gi|323317045|gb|EGA70047.1| SAM-dependent methyltransferase [Vibrio sinaloensis DSM 21326]
          Length = 247

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 76/168 (45%), Gaps = 13/168 (7%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN------- 134
           ++++G +LP  + S D V+M H L++  DP  ML E+ RV+   G +I+   N       
Sbjct: 77  VIADGYDLPFLEKSFDVVVMAHQLDYCNDPHRMLREVDRVMIDDGYIIITGFNPVSLTGI 136

Query: 135 KRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
            R +  R  + P+ SG+ ++  ++   L   N+ +        FP    +    +W+ FE
Sbjct: 137 ARLLPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVECDSYALFPMQKYRT---MWTWFE 192

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVS 241
                +      +Y I ARK  Y   PI    K K   +PI V + +S
Sbjct: 193 NSLGDWASPMGSLYFIVARKRTYPLKPIKPHWKLKRKLTPIGVNYKLS 240


>gi|134299117|ref|YP_001112613.1| type 11 methyltransferase [Desulfotomaculum reducens MI-1]
 gi|134051817|gb|ABO49788.1| Methyltransferase type 11 [Desulfotomaculum reducens MI-1]
          Length = 244

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP  + S D VL +  LE   D    LHE+ RV+  GG ++  VP  R +W R +     
Sbjct: 88  LPFENHSFDLVLCLDVLEHLPDERPALHELKRVVRPGGMLVFTVPAFRWLWGRHDELN-N 146

Query: 149 SGQPYSWYQMISLLREANFTLSITSRSLFF 178
             + Y++ ++I+LL+++N  +  T+   FF
Sbjct: 147 HYRRYNFGELINLLKKSNLRVERTTYFNFF 176


>gi|239815322|ref|YP_002944232.1| methyltransferase type 11 [Variovorax paradoxus S110]
 gi|239801899|gb|ACS18966.1| Methyltransferase type 11 [Variovorax paradoxus S110]
          Length = 251

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 67/156 (42%), Gaps = 16/156 (10%)

Query: 74  PDQYFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           P Q     AL ++   LP A +S+D V++ H LE ++DP   L E+ RVL   GR+++  
Sbjct: 59  PGQPSGRAALYTDFAALPFAANSLDLVVLPHALELSQDPHAALREVERVLVPEGRVVICG 118

Query: 133 PNKRGMWA---RMEH-----------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            N   +W    R  H            P G G+   +++M   LR  +F +      ++ 
Sbjct: 119 LNPASLWGMRQRRAHLYRRLGLGDLFLPEG-GEFIGYWRMRDWLRLLSFEVESGRFGVYR 177

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           P    +  L+     +  G  + P F   Y + A K
Sbjct: 178 PAVRSEAWLERCRWMDAAGERWWPIFGAAYFLVAVK 213


>gi|226328905|ref|ZP_03804423.1| hypothetical protein PROPEN_02807 [Proteus penneri ATCC 35198]
 gi|225202091|gb|EEG84445.1| hypothetical protein PROPEN_02807 [Proteus penneri ATCC 35198]
          Length = 238

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%), Gaps = 12/146 (8%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           AI   L   W  + G  LL LG           +++  L+ +      T+      ++  
Sbjct: 28  AIELRLQNWWPKMYGFHLLKLGQ-------LSAELDTKLSIVSHQVNVTS---NKINADV 77

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           + S   LP  + S+D  LM H L+++ DP  +L E  RVL   G +++   N   +    
Sbjct: 78  IASLDYLPFENKSIDVCLMAHVLDYSADPHWLLREADRVLIDDGWIVLTSFNPMSLLGLG 137

Query: 143 EHTPF-GSGQPYSWYQMISLLREANF 167
           + TPF    QPYS  +M SL R+ ++
Sbjct: 138 KCTPFLRQRQPYS-SRMFSLRRQIDW 162


>gi|260767801|ref|ZP_05876736.1| SAM-dependent methyltransferase [Vibrio furnissii CIP 102972]
 gi|260617310|gb|EEX42494.1| SAM-dependent methyltransferase [Vibrio furnissii CIP 102972]
 gi|315179368|gb|ADT86282.1| SAM-dependent methyltransferase [Vibrio furnissii NCTC 11218]
          Length = 244

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 10/162 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK---RGMWARM-- 142
           +LP  + S+D V++ H L++  DP  +L E+ RVL   G +I+   N     G+ + M  
Sbjct: 83  DLPFLEKSIDAVIVAHQLDYCNDPHSILREVDRVLIDDGYIILTGFNPLSLTGLASLMPW 142

Query: 143 -EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
            +H    SG+ ++  ++   L   N+ +    +   FP    +    LW+  E      G
Sbjct: 143 RKHNLPWSGRMFTPNRIKDWLSVLNYQVIECDQYALFPMQKYR---PLWTWLENSFGDCG 199

Query: 202 PGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVST 242
             F  +Y I ARK  Y   PI    + K   SP+ V + V +
Sbjct: 200 APFGSLYFIVARKRTYPLKPIKPHWRLKRRLSPVGVNYRVKS 241


>gi|325983347|ref|YP_004295749.1| Methyltransferase type 11 [Nitrosomonas sp. AL212]
 gi|325532866|gb|ADZ27587.1| Methyltransferase type 11 [Nitrosomonas sp. AL212]
          Length = 256

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            ++     G LP+  SS+D V++ H LEF  +P  +L E+ R+L   G ++V   N   +
Sbjct: 66  ETSVRAEAGFLPIQTSSMDLVILPHALEFNANPHQILREVHRILIPEGHLVVSGFNPFSL 125

Query: 139 WARMEHTPFGSGQPYSWY-------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
           W    H      + + W        ++   L+  +F ++      + PP  ++   + ++
Sbjct: 126 WGVCPHLK-SMREEFPWNGDFIALSRLKDWLKLLDFEMAGGRLCCYVPPLKQEKWRRRFA 184

Query: 192 VFEKIGNIFGPGFAGIYVIEARK 214
             E  G+ + P   G+Y + A K
Sbjct: 185 FMEAAGDRWWPISGGVYFLHAIK 207


>gi|229519250|ref|ZP_04408693.1| SAM-dependent methyltransferase [Vibrio cholerae RC9]
 gi|229343939|gb|EEO08914.1| SAM-dependent methyltransferase [Vibrio cholerae RC9]
          Length = 245

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYLIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK  Y   PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-FGSLYFIVARKRTYPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|254172255|ref|ZP_04878931.1| methionine biosynthesis protein MetW [Thermococcus sp. AM4]
 gi|214034151|gb|EEB74977.1| methionine biosynthesis protein MetW [Thermococcus sp. AM4]
          Length = 222

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW---ARME- 143
           +LP  D S D VL V   EF  +P  +L EI+RVL  GG  ++   N R  W    R++ 
Sbjct: 90  SLPFPDESFDLVLSVTMFEFIHEPEKVLEEIYRVLRPGGEALIGTMNGRSAWFLFKRLKS 149

Query: 144 ---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
               T +   + Y+  ++ +LL  A F    ++  +FFP
Sbjct: 150 LFVETAYRYARFYTPGELEALLTNAGFKNIESAGVIFFP 188


>gi|159040992|ref|YP_001540244.1| methyltransferase type 11 [Caldivirga maquilingensis IC-167]
 gi|157919827|gb|ABW01254.1| Methyltransferase type 11 [Caldivirga maquilingensis IC-167]
          Length = 210

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 1/121 (0%)

Query: 33  DDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLA 92
           D +    L GLG  +   S F  ++   +A  P+        D+ ++  + V E  +P+ 
Sbjct: 30  DTIKALGLSGLGLDVGAGSGFFTRLINAIALEPSPGMIKLAKDRTWAVVSGVGE-LMPIR 88

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQP 152
           DSS+D V++V  L FA +P  +L E  RVL S GR++  +      W  +       G P
Sbjct: 89  DSSMDYVIIVVTLCFAMNPEAILRESIRVLKSNGRLVACIVPLESQWGALYSELGSRGHP 148

Query: 153 Y 153
           Y
Sbjct: 149 Y 149


>gi|325130339|gb|EGC53105.1| hypothetical protein NMBOX9930304_0857 [Neisseria meningitidis
           OX99.30304]
 gi|325208257|gb|ADZ03709.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33]
          Length = 221

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++  LL +A F + +    ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRLLADAGFDIELGKFMVYLPPVSSLGQIRFWQFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|226939808|ref|YP_002794881.1| Generic methyl-transferase [Laribacter hongkongensis HLHK9]
 gi|226714734|gb|ACO73872.1| Generic methyl-transferase [Laribacter hongkongensis HLHK9]
          Length = 255

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 8/133 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK------RGMWAR 141
            LP A  S+D +LM H L+F+  P   L E  RVL   GR+++   N       R +W+R
Sbjct: 84  QLPFATRSLDLLLMPHTLDFSAHPRETLREAERVLAPEGRLVLTGFNPVSLFGLRRVWSR 143

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
            +  P+ +    S  ++   L   +F L+  +   + PPT  +     +   E  G+ + 
Sbjct: 144 -QQAPW-NAHFLSLRRLKDWLELLDFDLASGAFLCYAPPTGSEEWRSRFRFMESAGDRWW 201

Query: 202 PGFAGIYVIEARK 214
           P  +G+Y + A K
Sbjct: 202 PAASGVYALHAIK 214


>gi|325110494|ref|YP_004271562.1| methyltransferase type 11 [Planctomyces brasiliensis DSM 5305]
 gi|324970762|gb|ADY61540.1| Methyltransferase type 11 [Planctomyces brasiliensis DSM 5305]
          Length = 261

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
           LP AD++ D V+ +  +E   +PFL++ E+ RV   GG +IV  PN   MW+R++
Sbjct: 71  LPFADNTFDGVICLEGVEHVLNPFLLIGELIRVSKIGGHVIVSTPNIMNMWSRLQ 125


>gi|254284094|ref|ZP_04959062.1| generic methyl-transferase [gamma proteobacterium NOR51-B]
 gi|219680297|gb|EED36646.1| generic methyl-transferase [gamma proteobacterium NOR51-B]
          Length = 186

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 52/115 (45%), Gaps = 13/115 (11%)

Query: 28  LSTTWDDVTGCRLLGLG----YAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           LS   D++ G  ++ LG      IP  +     +       P G GA        S  AL
Sbjct: 4   LSIALDELFGYHMVLLGTDPAIDIPSMTRVQQVIRSRPGAGPVGTGA-------LSVYAL 56

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
             E  LP    SVD V+ +H L+ +EDP   L EI RVLT  G +I+V  N R +
Sbjct: 57  DEE--LPFETESVDVVVALHALDVSEDPHQALREIRRVLTPHGHLILVGMNPRSL 109


>gi|261253704|ref|ZP_05946277.1| SAM-dependent methyltransferase [Vibrio orientalis CIP 102891]
 gi|260937095|gb|EEX93084.1| SAM-dependent methyltransferase [Vibrio orientalis CIP 102891]
          Length = 245

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 15/170 (8%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G +LP  + S D VLM H L++  DP  ML E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYDLPFLEKSFDAVLMAHQLDYCNDPHRMLREVDRVMIDDGYLIITGFNPISLTGL 136

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +        FP    +    +W+  
Sbjct: 137 GSLMPWRR-NNLPW-SGRMFTPNRIKDWLGLLNYQVVECDSYALFPMQKYRT---MWTWL 191

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVST 242
           E     +      +Y + ARK  Y   PI    K K   +P+ V + VS 
Sbjct: 192 ENSLGDWASPMGSLYFVVARKRTYPLKPIKPHWKLKRKLTPVSVNYKVSN 241


>gi|157369155|ref|YP_001477144.1| type 11 methyltransferase [Serratia proteamaculans 568]
 gi|157320919|gb|ABV40016.1| Methyltransferase type 11 [Serratia proteamaculans 568]
          Length = 239

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+   +A+ + L   W  + G  LL LG      +     +   +     GQ      D 
Sbjct: 22  GEYYREALERQLQPWWSKLFGFHLLKLGNLSASLATDKCAISHQVNVALEGQNLQVIADA 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           Y           LP A  SVD  L+ H L +A+DP  ML E+ RVL   G +++
Sbjct: 82  Y----------QLPFAAKSVDACLLAHTLSYADDPHRMLREVDRVLIDDGWLVI 125


>gi|237807684|ref|YP_002892124.1| Methyltransferase type 11 [Tolumonas auensis DSM 9187]
 gi|237499945|gb|ACQ92538.1| Methyltransferase type 11 [Tolumonas auensis DSM 9187]
          Length = 251

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 87/220 (39%), Gaps = 49/220 (22%)

Query: 37  GCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSE-GNLPLADSS 95
           G  LL LG      SC    +    A  P G           +S  ++++   LP+   S
Sbjct: 42  GYHLLKLGTLSSQLSCAASSIRHQCAVAPEG-----------ASLGIIADVDELPIRSGS 90

Query: 96  VDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM---------------W- 139
           +D  L+ H L+F+ DP  +L E+ RVLT  G +I+   N   +               W 
Sbjct: 91  IDACLLAHLLDFSSDPHQILREVERVLTPDGWIIISGFNPYSLVGLGRLLPNLRRRLPWS 150

Query: 140 ARMEHTPFGSGQPYSWYQMI--SLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
           ARM    F   +   W  ++   ++    F  S  +R   F           W   EK G
Sbjct: 151 ARM----FSPERVLDWLHLLGFEVVHLEGFAYSTVTRRNRF---------HFWK--EKTG 195

Query: 198 NIFGPGFAGIYVIEARKILYQGLPITESKKKH-ISSPILV 236
              G  FA  Y++ ARK   + +P+T  ++   +  P++V
Sbjct: 196 RRCGYRFASTYMLAARK---RTIPLTRIREAAWLRRPVMV 232


>gi|157962226|ref|YP_001502260.1| type 11 methyltransferase [Shewanella pealeana ATCC 700345]
 gi|157847226|gb|ABV87725.1| Methyltransferase type 11 [Shewanella pealeana ATCC 700345]
          Length = 246

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (46%), Gaps = 21/120 (17%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     ++ + LS  W  + G  +L LG           K+ +T      G G +    Q
Sbjct: 19  GPVIRQSVEQALSPWWPRIFGYFMLNLG-------PLSHKMAKT------GVGISR---Q 62

Query: 77  Y--FSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           Y  F       EG+   LP+ ++S+D V+M   LEF  DP+ +L E+ RVL SGG +++ 
Sbjct: 63  YSLFDEAQANIEGDYCQLPIQNTSIDAVVMNFLLEFEADPYRLLREVDRVLISGGHLVIT 122


>gi|117618831|ref|YP_856104.1| methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117560238|gb|ABK37186.1| methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 244

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 97/233 (41%), Gaps = 29/233 (12%)

Query: 6   VELRQFYSSF-LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +E+   +S+  +G      I + L +    + G  LL +G      SC    +   +   
Sbjct: 14  IEIPTSWSALPMGDWVAAEIQERLDSWCPHLFGYHLLKVGALSAELSCGCSSIRHQIGVA 73

Query: 65  PAGQGATNWPDQYFSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           P+G+              L  +G+   LP+   SVD  L+ H L+F+ DP  +L E  RV
Sbjct: 74  PSGR-------------LLDLKGDPLALPVRTGSVDACLLAHCLDFSPDPHQVLREAERV 120

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQ-PYSWYQMISLLREANFTLSITSRSLF--- 177
           LT  G +IV   N   +       PF     P+S  +M +  R  ++   +    +F   
Sbjct: 121 LTDDGWLIVSGYNPLSLVGIGHCLPFLRQHLPWS-ARMFTPARVTDWLQLLGCEVMFDER 179

Query: 178 --FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
             +    K+  +  W   E +G  +   FA +YVI ARK   +  P+T  +++
Sbjct: 180 FGYSFMGKQSRIGWWR--ESVGRDYCRPFASVYVIAARK---RRFPLTPVRRR 227


>gi|119503279|ref|ZP_01625363.1| SAM-dependent methyltransferase [marine gamma proteobacterium
           HTCC2080]
 gi|119460925|gb|EAW42016.1| SAM-dependent methyltransferase [marine gamma proteobacterium
           HTCC2080]
          Length = 270

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 9/139 (6%)

Query: 8   LRQFYS-SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           L Q+YS S LGK   + ++K +    D   G  LL +G           +V R L  +  
Sbjct: 18  LEQWYSTSPLGKRLREQLNKDMGVILDQWFGYNLLVIGPNTDIPISEMTRVRRVLQVLDR 77

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
            Q       +   +     +  LPL   SVD V++++ L+ +  P  +L E+ RVLT  G
Sbjct: 78  DQQL-----RKGYTGVYAHDEELPLETESVDVVVVLNALDLSAHPHQLLREVHRVLTPHG 132

Query: 127 RMIVVVPNK---RGMWARM 142
            +++V  N     G+W R+
Sbjct: 133 HLLIVGTNGWSISGLWHRL 151


>gi|269960615|ref|ZP_06174987.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834692|gb|EEZ88779.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 251

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYELPFLEKSFDVVVLAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPISLTGL 136

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +    R   FP T  K    +W+  
Sbjct: 137 ASLLPWRR-NNLPW-SGRMFTVNRIKDWLGVLNYQVIHCDRYALFPMTRYKT---MWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI 222
           E  +G+   P    +Y I ARK  Y   PI
Sbjct: 192 ENSLGDWASPA-GSLYYIVARKRTYPLKPI 220


>gi|323135761|ref|ZP_08070844.1| transcriptional regulator, ArsR family [Methylocystis sp. ATCC
           49242]
 gi|322398852|gb|EFY01371.1| transcriptional regulator, ArsR family [Methylocystis sp. ATCC
           49242]
          Length = 337

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 13/108 (12%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VP-NKRGMWARMEHT 145
           LP+  +SVD  +M   L + +DP   L E  RVL  GGR++VV   P N+  +  +  H 
Sbjct: 217 LPIERNSVDLAIMHQVLHYLDDPARALREAARVLAPGGRLLVVDFAPHNEEALRDKHAHR 276

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK---KCILKLW 190
             G    +S  +++ LLR+A    +I  R L   P  K   K  + LW
Sbjct: 277 RLG----FSESEIVGLLRQAGLE-TILHREL--APDAKEGAKLTVSLW 317


>gi|319944003|ref|ZP_08018283.1| type 11 methyltransferase [Lautropia mirabilis ATCC 51599]
 gi|319742764|gb|EFV95171.1| type 11 methyltransferase [Lautropia mirabilis ATCC 51599]
          Length = 321

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 19/142 (13%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
           G LP A  SVD V+M H LE   DP  +L E+ RVL   GR++V+  N   +W   +  P
Sbjct: 118 GELPFASQSVDLVVMPHRLEDCTDPHQLLREVDRVLRPEGRLVVLGINPWSLWGLRQALP 177

Query: 147 --------------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
                          G+     W +++S   E + T+        +P   ++ + +    
Sbjct: 178 GWLGGGFLPHAGALIGAPHVRDWIRLLSF--EPDDTVYG---GYAWPFLRQEWLARSQRF 232

Query: 193 FEKIGNIFGPGFAGIYVIEARK 214
            E+ G+ + P    +Y++ A K
Sbjct: 233 LERAGDRWWPVCGAVYLVSAVK 254


>gi|237808580|ref|YP_002893020.1| Methyltransferase type 11 [Tolumonas auensis DSM 9187]
 gi|237500841|gb|ACQ93434.1| Methyltransferase type 11 [Tolumonas auensis DSM 9187]
          Length = 214

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 7/106 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR--MEHT 145
            LP  D+  D VLMV  + F +D      E +RVL  GG ++V   +K  +  R  ME  
Sbjct: 87  QLPFEDNQFDLVLMVTVICFLDDVLQAFKEAYRVLKPGGYILVGFIDKESVLGRQYMEKR 146

Query: 146 P----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCIL 187
                +     YS  +++S LR+A F+ S+ S+    P +    IL
Sbjct: 147 EKSLFYQDAVFYSAPEVLSFLRQAGFS-SVMSKQTLIPASPNDTIL 191


>gi|91793375|ref|YP_563026.1| methyltransferase type 11 [Shewanella denitrificans OS217]
 gi|91715377|gb|ABE55303.1| Methyltransferase type 11 [Shewanella denitrificans OS217]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 69/147 (46%), Gaps = 11/147 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------RGMWA 140
           +LPL ++++D VLM   +EF  +P+ +L E+ RVL  GG +++V  N        + +  
Sbjct: 76  HLPLQNTTIDTVLMSFLMEFETNPYRLLREVDRVLICGGYVVIVGFNPISPLFMGKVLSG 135

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
             E  P+  GQ +   ++   L    + +   SRSL+ P              E+  + +
Sbjct: 136 YQEKLPW-CGQFFMPSRVKDWLGLLGYQVLEDSRSLYHPLIK---TFAFGQYLEQSLHKW 191

Query: 201 GPGFAGIYVIEARKILYQGLPITESKK 227
            PG   +Y I ARK+     PI + K+
Sbjct: 192 LPGTGSVYFIVARKLDAPLTPIRDKKR 218


>gi|85709302|ref|ZP_01040367.1| predicted transcriptional regulator [Erythrobacter sp. NAP1]
 gi|85688012|gb|EAQ28016.1| predicted transcriptional regulator [Erythrobacter sp. NAP1]
          Length = 335

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV---VPNKRGMWARMEHTPFGSG 150
            S D VL+   L FA+DP L L E  RV   GGR+ +V     +   + +R +H   G  
Sbjct: 220 QSFDTVLLHQVLHFAQDPALPLAEAARVTRPGGRIAIVDFAAHDHEELRSRYQHARLG-- 277

Query: 151 QPYSWYQMISLLREANFT 168
             +S  QM  LLR+A F+
Sbjct: 278 --FSDRQMARLLRDAGFS 293


>gi|260775262|ref|ZP_05884159.1| SAM-dependent methyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608443|gb|EEX34608.1| SAM-dependent methyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 247

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 15/170 (8%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G +LP  + S D V+M H L++  DP  ML E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYDLPFLEKSFDAVVMAHQLDYCNDPHRMLREVDRVMIDDGYLIITGFNPISLTGL 136

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +        FP    +    +W+  
Sbjct: 137 ASLMPW-RKNNLPW-SGRMFTPNRIRDWLSVLNYQVIECDSYALFPMQKYRT---MWTWL 191

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVST 242
           E     +      +Y I ARK  Y   PI    K K   +PI V + +S+
Sbjct: 192 ENSLGDWASPMGSLYFIVARKRTYPLKPIKPHWKLKRKLTPIGVNYKISS 241


>gi|83590024|ref|YP_430033.1| UbiE/COQ5 methyltransferase [Moorella thermoacetica ATCC 39073]
 gi|83572938|gb|ABC19490.1| UbiE/COQ5 methyltransferase [Moorella thermoacetica ATCC 39073]
          Length = 230

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           NLP  D++ D ++ V  LEFA D   +L E +RVL  GGRM++ +     +W+R
Sbjct: 98  NLPFGDNTFDKIVSVTALEFAPDLKAVLEESYRVLKPGGRMVIGLIGGNSLWSR 151


>gi|145299714|ref|YP_001142555.1| methyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852486|gb|ABO90807.1| methyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 240

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 71/153 (46%), Gaps = 11/153 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP+   SVD  L+ H L+F+ DP  +L E  RVLT  G +IV   N   +       PF 
Sbjct: 84  LPVRTGSVDACLLAHCLDFSPDPHQVLREAERVLTDDGWLIVSGYNPLSLVGIGHCLPFL 143

Query: 149 SGQ-PYSWYQMISLLREANFTLSITSRSLF-----FPPTHKKCILKLWSVFEKIGNIFGP 202
             + P+S  +M +  R  ++   +    +F     +    K+  +  W   E +G  +  
Sbjct: 144 RQRLPWS-ARMFTPARVTDWLQLLGCEVMFDERFGYSFMGKQSRIGWWR--ESVGRDYCR 200

Query: 203 GFAGIYVIEARKILYQGLPITESKK--KHISSP 233
            FA +YVI ARK  +  +P+    +  + I++P
Sbjct: 201 PFASVYVIAARKRRFPLIPVRRRWRLPESIAAP 233


>gi|326388580|ref|ZP_08210173.1| ArsR family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206831|gb|EGD57655.1| ArsR family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 337

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV---VPNKRGMWARME 143
             LP A +S D +L    L +A+ P  +L E  RV   GGR+ +V     ++  +  R  
Sbjct: 224 AQLPFASASFDTLLFHQVLHYAQAPEAVLAEAARVTAPGGRIAIVDFAAHDREELRTRHA 283

Query: 144 HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
           H   G    ++  QM +L  EA F   +  R+L      K+ I+KLW+   +
Sbjct: 284 HARLG----FADAQMAALFAEAGFE-PLADRAL----AGKELIVKLWTAVRR 326


>gi|261245487|emb|CBG23277.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 240

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLFLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|167623802|ref|YP_001674096.1| type 11 methyltransferase [Shewanella halifaxensis HAW-EB4]
 gi|167353824|gb|ABZ76437.1| Methyltransferase type 11 [Shewanella halifaxensis HAW-EB4]
          Length = 246

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 21/119 (17%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     ++ + LS  W  + G  +L LG           K+++       G G +    Q
Sbjct: 19  GPVIRQSVEQALSPWWPRIFGYYMLNLG-------PLSHKIDKI------GVGISK---Q 62

Query: 77  Y--FSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           Y  F       EG+   LP+ + S+D V+M   LEF  DP+ +L E+ RVL SGG +++
Sbjct: 63  YSLFDQPQASIEGDYSHLPIQNISIDAVVMNFILEFEADPYRLLREVDRVLISGGHLVI 121


>gi|304408608|ref|ZP_07390229.1| Methyltransferase type 11 [Shewanella baltica OS183]
 gi|307305436|ref|ZP_07585184.1| Methyltransferase type 11 [Shewanella baltica BA175]
 gi|304352429|gb|EFM16826.1| Methyltransferase type 11 [Shewanella baltica OS183]
 gi|306911739|gb|EFN42164.1| Methyltransferase type 11 [Shewanella baltica BA175]
          Length = 245

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 17/118 (14%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A++K L   W  V G  LL LG      S     V    + +   +GA+     
Sbjct: 19  GEALQQAVAKQLEDWWPRVFGYHLLKLGPLSAELSSMASPVAHHFS-LSRSKGAS----- 72

Query: 77  YFSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                    EG+   LPL ++++D V+M   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 73  --------IEGDFCHLPLQNAAIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYLFIV 122


>gi|319956982|ref|YP_004168245.1| methyltransferase type 11 [Nitratifractor salsuginis DSM 16511]
 gi|319419386|gb|ADV46496.1| Methyltransferase type 11 [Nitratifractor salsuginis DSM 16511]
          Length = 209

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM----- 142
            +PL D SVD VLMV  + F +DP   L EI R+L  GG +IV   ++     R      
Sbjct: 86  EIPLPDESVDFVLMVTTICFVDDPLKALKEIHRILRPGGWVIVGFVDRDTPLGRFYLKHR 145

Query: 143 -EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
            E   +     +S  ++  LLR A F+     ++LF P
Sbjct: 146 NESRFYAPATFFSADEVAELLRRAGFSELKAVQTLFGP 183


>gi|332715624|ref|YP_004443090.1| type 11 methyltransferase [Agrobacterium sp. H13-3]
 gi|325062309|gb|ADY65999.1| Methyltransferase type 11 [Agrobacterium sp. H13-3]
          Length = 286

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +P  D+S D VL    LE   DP  ++ E++RVL  GG MI  VP      AR+ H P+
Sbjct: 135 IPFPDASCDAVLCTEVLEHVADPASLVAEMYRVLRPGGVMIATVP----FAARVHHAPY 189


>gi|120611320|ref|YP_970998.1| type 11 methyltransferase [Acidovorax citrulli AAC00-1]
 gi|120589784|gb|ABM33224.1| Methyltransferase type 11 [Acidovorax citrulli AAC00-1]
          Length = 251

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 70/173 (40%), Gaps = 15/173 (8%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           D    +  L     LP  ++S+D VL+ H LE + DP   L E+ RVL   GR++V   N
Sbjct: 53  DGPVRAALLADPVALPFPENSLDLVLLPHALELSVDPHAALREVHRVLVPEGRLVVSGLN 112

Query: 135 KRGMWA------RMEHTPFGSGQPY--------SWYQMISLLREANFTLSITSRSLFFPP 180
              +W       R+       G+ Y          +++   LR  NF +   S   + P 
Sbjct: 113 PVSLWGLRQRRVRLYQRLGAGGRLYLPDVGEFIGHWRLRDWLRLLNFEIETISFGAYRPA 172

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
                 L  +   + +G  + P     Y++ A K ++ G+ + E   +   +P
Sbjct: 173 VRSARWLDRYEWLDAVGARWWPILGAAYMVVAVKRVH-GMRLLEPSWRTGQAP 224


>gi|110799969|ref|YP_694632.1| UbiE/COQ5 family methlytransferase [Clostridium perfringens ATCC
           13124]
 gi|110674616|gb|ABG83603.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens ATCC
           13124]
          Length = 207

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL S G++++  V   +G WAR E   
Sbjct: 96  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKSNGKVVITDVLEHKGEWAREEM-- 153

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
           F +   +++ Q+I+   +A F  +SI +  L
Sbjct: 154 FDTWLGFNYDQLINWFEKAGFKNISIKNTGL 184


>gi|119944271|ref|YP_941951.1| methyltransferase type 11 [Psychromonas ingrahamii 37]
 gi|119862875|gb|ABM02352.1| Methyltransferase type 11 [Psychromonas ingrahamii 37]
          Length = 246

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 56/137 (40%), Gaps = 18/137 (13%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-RMEHT 145
             LPL DS++D  ++ H L+F+ DP  +L EI RVL   G +I+   N   +   R    
Sbjct: 82  NQLPLQDSTIDLCILTHELDFSSDPHQLLREIDRVLALDGTLIISGYNPISLLGLRTALN 141

Query: 146 P--------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
           P        F   +   W  ++    +        SR+L     +  C L      E  G
Sbjct: 142 PKNPKNARLFLPNRVIDWLHLLGFKIQQKQHFDFLSRNL-----NSTCSL----FIEDFG 192

Query: 198 NIFGPGFAGIYVIEARK 214
             + P F  +Y I A+K
Sbjct: 193 QNYLPYFCSVYFIIAKK 209


>gi|71277808|ref|YP_268730.1| hypothetical protein CPS_2000 [Colwellia psychrerythraea 34H]
 gi|71143548|gb|AAZ24021.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 257

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 66/148 (44%), Gaps = 11/148 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV-------VVPNKRGMWA 140
           +LPL + SVD  L+ H LEF+ DP  ++ E  RVL   G +++       +V   R +  
Sbjct: 83  DLPLQEHSVDVCLLSHALEFSLDPHHVVREANRVLIPNGYLVLTGFNPLSLVGLNRLLPY 142

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
           R   TP+     +S  ++   L    F +    R L    T K     L   + K+   +
Sbjct: 143 RRSKTPWNE-HFFSPMRIKDWLHLMGFEILADQRCLHSSLTGKVSTDSLEHRWHKLAKSY 201

Query: 201 GPGFAGIYVIEARKILYQGLPITESKKK 228
            P    +YVI A+K   + LP+T  K K
Sbjct: 202 LPALGSVYVIVAKK---RVLPLTPIKPK 226


>gi|254508678|ref|ZP_05120793.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus 16]
 gi|219548435|gb|EED25445.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus 16]
          Length = 245

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG---- 137
           ++++G +LP  + S D V+M H L++  DP  ML E+ RV+   G +I+   N       
Sbjct: 77  VIADGYDLPFFEKSFDAVVMAHQLDYCNDPHRMLREVDRVMIDDGYLIITGFNPISFTGL 136

Query: 138 ---MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
              M  R  + P+ SG+ ++  ++   L   N+ +        FP    +    +W+  E
Sbjct: 137 ASLMPWRRNNLPW-SGRMFTPNRIKDWLSVLNYQVIECDSYALFPMQKYRT---MWTWLE 192

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVST 242
                +      +Y I ARK  Y   PI    K K   +P+ V + VS 
Sbjct: 193 NSLGDWAAPMGSLYFIVARKRTYPLKPIKPHWKLKRKLTPVSVNYKVSN 241


>gi|260221007|emb|CBA29142.1| hypothetical protein Csp_A10660 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 175

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 13/139 (9%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-RMEHTPF 147
           +P   +S+D +++ H LEF+ DP   L E+ RVL   G++++   N   +W  R   + +
Sbjct: 1   MPFPANSMDLLVLPHALEFSPDPHAALREVERVLVPEGKVVICGLNPASLWGWRQRRSRW 60

Query: 148 ------------GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                       G G    ++++   LR  +F +       + P       L+ +S  ++
Sbjct: 61  YQRLGWGRVFLPGWGDLIGYWRLRDWLRLLSFEVEAGRFGCYRPAVDSPEWLRRFSWLDR 120

Query: 196 IGNIFGPGFAGIYVIEARK 214
           IG  + P F   Y + A K
Sbjct: 121 IGGRWWPIFGAAYFVVATK 139


>gi|156975481|ref|YP_001446388.1| hypothetical protein VIBHAR_03212 [Vibrio harveyi ATCC BAA-1116]
 gi|156527075|gb|ABU72161.1| hypothetical protein VIBHAR_03212 [Vibrio harveyi ATCC BAA-1116]
          Length = 251

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 14/149 (9%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK---RGM 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N     G+
Sbjct: 77  VIADGYELPFLEKSFDVVVLAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPISFTGL 136

Query: 139 WA----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
            +    R  + P+ SG+ ++  ++   L   N+ +    R   FP T  K    +W+  E
Sbjct: 137 ASLLPWRRNNLPW-SGRMFTANRIKDWLGVLNYQVIHCDRYALFPMTRYKT---MWTWLE 192

Query: 195 K-IGNIFGPGFAGIYVIEARKILYQGLPI 222
             +G+   P    +Y I ARK  Y   PI
Sbjct: 193 NSLGDWASPA-GSLYYIVARKRTYPLKPI 220


>gi|87124075|ref|ZP_01079925.1| hypothetical protein RS9917_10706 [Synechococcus sp. RS9917]
 gi|86168644|gb|EAQ69901.1| hypothetical protein RS9917_10706 [Synechococcus sp. RS9917]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           LPLAD+SVDC L+V   ++ + P  +  E+WRV   GG +IV   N+
Sbjct: 104 LPLADASVDCSLIVAGWQYLQQPEAVAAELWRVTRPGGELIVAFSNR 150


>gi|198243385|ref|YP_002214218.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197937901|gb|ACH75234.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 240

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QIIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|294340666|emb|CAZ89058.1| Conserved hypothetical protein, putative
           S-adenosyl-L-methionine-dependent methyltransferase
           [Thiomonas sp. 3As]
          Length = 296

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 14/137 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP    S+D V++ H LE+ +DP   L E+ RVL  GG++++   N   +W   +     
Sbjct: 129 LPFPAQSLDLVVLPHTLEWVDDPHACLREVDRVLVPGGQIVISGFNTWSLWGMRQLVGRV 188

Query: 149 SGQPYSWY-----------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
            G    WY           ++   LR  +F ++      + P       L  W   ++ G
Sbjct: 189 GG---GWYLPQHGEFLAPRRVRDWLRLLSFEVTQGRFGCYRPALCSPLWLHRWRFMDQAG 245

Query: 198 NIFGPGFAGIYVIEARK 214
           + + P F  +Y + A K
Sbjct: 246 DRWWPVFGAVYFLAAIK 262


>gi|326621962|gb|EGE28307.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 222

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 65  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 124

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 125 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 181

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 182 QIIVARK---RTIPLTLNPLRHNKSKTPIRQTV 211


>gi|270263403|ref|ZP_06191672.1| methyltransferase type 11 [Serratia odorifera 4Rx13]
 gi|270042287|gb|EFA15382.1| methyltransferase type 11 [Serratia odorifera 4Rx13]
          Length = 239

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+   +A+ + L   W  + G  LL LG      +     +   +     G+      D 
Sbjct: 22  GEYYREALERQLQPWWSKLFGFHLLKLGNLSASLATDKCAISHQVNVSLKGENLQVLADA 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           Y           LP A  SVD  L+ H L +A+DP  ML E+ RVL   G +++
Sbjct: 82  Y----------QLPFAAKSVDACLLAHTLSYADDPHRMLREVDRVLIDDGWLVI 125


>gi|157375127|ref|YP_001473727.1| hypothetical protein Ssed_1990 [Shewanella sediminis HAW-EB3]
 gi|157317501|gb|ABV36599.1| conserved hypothetical protein [Shewanella sediminis HAW-EB3]
          Length = 244

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 92/218 (42%), Gaps = 22/218 (10%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G      I K L+  W  V G  +L LG             E  +  +P G+  + +  +
Sbjct: 19  GDTIKRHIEKELAPWWPKVFGYHMLSLGAL---------SAELDMPGLPIGRRFSLFDGE 69

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK- 135
             +  A  SE  LP+ +  +D V+M   LEF  DP+ +L E  RVL SGG + ++  N  
Sbjct: 70  GAALRADFSE--LPIQNGVIDAVVMNMLLEFEPDPYKLLRETDRVLISGGYLFIIGFNPL 127

Query: 136 ------RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 + +  + E  P+  G+ +   ++   L    + +    R L+    H    +  
Sbjct: 128 SPAFIGKILPKQQEALPW-CGRFFMPSRVKDWLGLLGYRVVGDERLLYH---HMLSDINQ 183

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
            S+++     + PG   +Y+I ARK+     PI E +K
Sbjct: 184 DSIWQHALKAWLPGSGSLYLIVARKLESPLTPIHEKRK 221


>gi|323495338|ref|ZP_08100416.1| SAM-dependent methyltransferase [Vibrio brasiliensis LMG 20546]
 gi|323310409|gb|EGA63595.1| SAM-dependent methyltransferase [Vibrio brasiliensis LMG 20546]
          Length = 247

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG---- 137
           ++++G +LP  + S D VLM H L++  DP  ML E+ RV+   G +I+   N       
Sbjct: 77  VIADGYDLPFLEKSFDAVLMAHQLDYCNDPHRMLREVDRVMIDDGYLIITGFNPISFTGL 136

Query: 138 ---MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
              M  R  + P+ SG+ ++  ++   L   N+ +        FP    +    +W+  E
Sbjct: 137 ASLMPWRRNNLPW-SGRMFTPNRVKDWLGLLNYQVLECDSYALFPMQKYRT---MWTWLE 192

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPILVPHTVST 242
                +      +Y I ARK  Y   PI    K K   +P+ V + VS 
Sbjct: 193 NSLGDWASPVGSLYFIVARKRTYPLKPIKPHWKLKRKLTPLGVNYKVSN 241


>gi|296136538|ref|YP_003643780.1| Methyltransferase type 11 [Thiomonas intermedia K12]
 gi|295796660|gb|ADG31450.1| Methyltransferase type 11 [Thiomonas intermedia K12]
          Length = 296

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 14/137 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP    S+D V++ H LE+ +DP   L E+ RVL  GG++++   N   +W   +     
Sbjct: 129 LPFPAQSLDLVVLPHTLEWVDDPHACLREVDRVLVPGGQIVISGFNTWSLWGMRQLVGRV 188

Query: 149 SGQPYSWY-----------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
            G    WY           ++   LR  +F ++      + P       L  W   ++ G
Sbjct: 189 GG---GWYLPQHGEFLAPRRVRDWLRLLSFEVTQGRFGCYRPALCSPLWLHRWRFMDQAG 245

Query: 198 NIFGPGFAGIYVIEARK 214
           + + P F  +Y + A K
Sbjct: 246 DRWWPVFGAVYFLAAIK 262


>gi|121604584|ref|YP_981913.1| type 11 methyltransferase [Polaromonas naphthalenivorans CJ2]
 gi|120593553|gb|ABM36992.1| Methyltransferase type 11 [Polaromonas naphthalenivorans CJ2]
          Length = 273

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 60/145 (41%), Gaps = 13/145 (8%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-- 140
           L     LP  ++S+D V++ H LE   DP   L E+ RVL   GR+++   N   +W   
Sbjct: 96  LTDSAALPFPENSLDLVVLPHTLELGRDPHSALREVARVLVPEGRVVISGFNPASLWGLR 155

Query: 141 --------RMEHTPF---GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                   R+ +  F    +G    ++++   LR  +F +       + P    +  L  
Sbjct: 156 QRRDHFYQRLGYDEFFLPNAGDYIGYWRLRDWLRLLDFEVESARFGCYRPAFDSQKWLDR 215

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARK 214
           +   +  G  + P F  +Y + A K
Sbjct: 216 FDWMDAAGERWWPIFGAVYFLVAVK 240


>gi|39995737|ref|NP_951688.1| hypothetical protein GSU0630 [Geobacter sulfurreducens PCA]
 gi|39982501|gb|AAR33961.1| conserved domain protein [Geobacter sulfurreducens PCA]
 gi|298504748|gb|ADI83471.1| SAM-dependent methyltransferase, type 11 [Geobacter sulfurreducens
           KN400]
          Length = 240

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 9/101 (8%)

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           G + W   +    A +   NLP+ D+S D VL    LE  + P   + E++RVL  GGR+
Sbjct: 65  GDSTWNYDHLDYKAPLD--NLPIPDASFDAVLCTQVLEHLQKPLECVKEMYRVLKPGGRL 122

Query: 129 IVVVPNKRGMWARMEH-TPFGSGQPYSWYQMISLLREANFT 168
            + VP      A+ EH TP+   + Y+ Y +  L   A F+
Sbjct: 123 FLTVP-----MAQDEHQTPYDYFR-YTSYGLKYLCTAAGFS 157


>gi|109898215|ref|YP_661470.1| hypothetical protein Patl_1896 [Pseudoalteromonas atlantica T6c]
 gi|109700496|gb|ABG40416.1| conserved hypothetical protein [Pseudoalteromonas atlantica T6c]
          Length = 249

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 68/152 (44%), Gaps = 23/152 (15%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           ++ L +SSVD  ++ H L+FA+DP  +L E+ R +   G +++V  N   +         
Sbjct: 84  DMALKESSVDGFVLAHELDFAQDPHQILREVDRAIMPDGDLVIVGFNPLSL--------- 134

Query: 148 GSGQPYSWYQMISLLREANF-----------TLSITSRSLFFPPTHKKCILKLWSVFEKI 196
              +   W+   S+L+EA F            L      + + P  K  I K  ++  + 
Sbjct: 135 TGLRKLVWFNRQSILQEARFFSVPRIKDWLHLLGFEVTQVTYRPYSKFFITKPNNIITRW 194

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
              F P  A +YVI A+K   + +P++  K K
Sbjct: 195 CKRFLPQLASMYVIVAKK---RTVPLSPIKPK 223


>gi|148359054|ref|YP_001250261.1| generic methyl-transferase [Legionella pneumophila str. Corby]
 gi|296107103|ref|YP_003618803.1| generic methyl-transferase [Legionella pneumophila 2300/99 Alcoy]
 gi|148280827|gb|ABQ54915.1| generic methyl-transferase [Legionella pneumophila str. Corby]
 gi|295649004|gb|ADG24851.1| generic methyl-transferase [Legionella pneumophila 2300/99 Alcoy]
          Length = 246

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 73  WPDQYFSSTALV----SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           W    FSST  +    S   LPL   ++DCV++   LE   + F ++ EI R+L   G +
Sbjct: 65  WIASPFSSTNRIHLECSLNQLPLNRDTMDCVIVPLTLEPFGNNFSLIDEIDRILKPMGFL 124

Query: 129 IVVVPNKRGMWARMEH----TPFGSG--QPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I +  N   +W           +G+   +  S + +  +  +  +     +   + PP +
Sbjct: 125 IFLCINPWSLWGGAMKWGLLNCYGNQTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPPVN 184

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG-----LPITESKKKHISSPI 234
            + ++K  + F++IG +  P  +G Y    +K  Y        P  ES KK   SP+
Sbjct: 185 SQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEYISPSLTVEPAIESVKKEYDSPL 241


>gi|212709214|ref|ZP_03317342.1| hypothetical protein PROVALCAL_00248 [Providencia alcalifaciens DSM
           30120]
 gi|212688126|gb|EEB47654.1| hypothetical protein PROVALCAL_00248 [Providencia alcalifaciens DSM
           30120]
          Length = 241

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 79/206 (38%), Gaps = 16/206 (7%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A+   L+  W  + G  LL LG+          ++      +P     T   D 
Sbjct: 22  GEHYRQALEAQLAPWWQKMFGYHLLKLGH-------LSTEIHTKECMIP--HQFTVGEDP 72

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           +    A   E  LP AD  +D  LM H L ++ DP  +L E+ RVL   G +I+   N  
Sbjct: 73  HLFDVAANPEA-LPFADKVIDACLMPHLLAYSHDPHWILREVDRVLIDDGWLILSGFNPF 131

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
            +    +  P     QPY   +    LR  ++   +    L+    H+ C    W   EK
Sbjct: 132 SLAGMAKLVPILRKQQPYC-SRFFPSLRVFDWLGLLNYEVLY----HRNCQALPWLSSEK 186

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLP 221
             N    G   + VI ARK  Y   P
Sbjct: 187 RVNKRCGGLGVMSVIVARKRTYPLTP 212


>gi|332141408|ref|YP_004427146.1| SAM-dependent methyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551430|gb|AEA98148.1| SAM-dependent methyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 297

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 78/169 (46%), Gaps = 18/169 (10%)

Query: 79  SSTALVSEGN--------LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           SS + +++GN        LP A++S+D  L+ + L+FA+DP  +L E+ RV+T  G +I+
Sbjct: 114 SSESTINKGNMVVGQSHSLPFAENSIDGFLLANELDFAQDPHEILREVDRVITQNGYVII 173

Query: 131 VVPNKRGMWARMEHTPFGSGQP------YSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +    +  P   G        ++ Y+M   L+   F + +  R + F     +
Sbjct: 174 SGFNPLSLAGIAKFLPVKRGNILHDARFFTSYRMKDWLQLLGFEI-VEQRQVLFSTLFFQ 232

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
              K  +  +     + P  + +YVI A+K +   +P+T  K K    P
Sbjct: 233 QRWKGAAKLQHYLASYLPWCSAVYVILAKKRV---IPMTAIKPKRNLKP 278


>gi|309379225|emb|CBX22182.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 221

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 27/140 (19%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLECGA-PSQILSEAHRILKPSGRVMLTGFNPHSLWG--- 114

Query: 144 HTPFGSGQPYSWYQMISL---------------LREANFTLSITSRSLFFPPTHKKCILK 188
                   P SW+    L               + +A F + +    ++ PP      ++
Sbjct: 115 --------PGSWFDGERLPEKRFCLTLRGLKRQIADAGFDIELGKFMVYLPPVSSPGQIR 166

Query: 189 LWSVFEKIGNIFGPGFAGIY 208
            W   EK G+ + P  A +Y
Sbjct: 167 FWRFMEKAGDRWWPQCAAVY 186


>gi|296109039|ref|YP_003615988.1| hypothetical protein Metin_0354 [Methanocaldococcus infernus ME]
 gi|295433853|gb|ADG13024.1| hypothetical protein Metin_0354 [Methanocaldococcus infernus ME]
          Length = 213

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------- 140
           NLP  D S D +L ++ LE        L E++RVL  GGR++V+V NK   +        
Sbjct: 85  NLPFKDESFDTILCINVLEHTNHE-KALKELFRVLKRGGRLVVIVVNKDSFFKEPIFFDF 143

Query: 141 RMEHTPFGSGQPYSWYQMIS 160
           R++H P  S + +  +++I+
Sbjct: 144 RVKHEPL-SLKDFKEFKIIN 162


>gi|52841751|ref|YP_095550.1| generic methyl-transferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628862|gb|AAU27603.1| generic methyl-transferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 247

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 73  WPDQYFSSTALV----SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           W    FSST  +    S   LPL   ++DCV++   LE   + F ++ EI R+L   G +
Sbjct: 66  WIASPFSSTNRIHLECSLNQLPLNRDTLDCVIVPLTLEPFGNNFSLIDEIDRILKPMGFL 125

Query: 129 IVVVPNKRGMWARMEH----TPFGSG--QPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I +  N   +W           +G+   +  S + +  +  +  +     +   + PP +
Sbjct: 126 IFLCINPWSLWGGAMKWGVLNCYGNRTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPPVN 185

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG-----LPITESKKKHISSPI 234
            + ++K  + F++IG +  P  +G Y    +K  Y        P  ES KK   SP+
Sbjct: 186 SQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEYISPSLTIEPAIESVKKEYDSPL 242


>gi|54297433|ref|YP_123802.1| hypothetical protein lpp1478 [Legionella pneumophila str. Paris]
 gi|53751218|emb|CAH12629.1| hypothetical protein lpp1478 [Legionella pneumophila str. Paris]
          Length = 247

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 73  WPDQYFSSTALV----SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           W    FSST  +    S   LPL   ++DCV++   LE   + F ++ EI R+L   G +
Sbjct: 66  WIASPFSSTNRIHLECSLNQLPLNRDTMDCVIVPLTLEPFGNNFSLIDEIDRILKPMGFL 125

Query: 129 IVVVPNKRGMWARMEH----TPFGSG--QPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I +  N   +W           +G+   +  S + +  +  +  +     +   + PP +
Sbjct: 126 IFLCINPWSLWGGAMKWGLLNCYGNQTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPPVN 185

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG-----LPITESKKKHISSPI 234
            + ++K  + F++IG +  P  +G Y    +K  Y        P  ES KK   SP+
Sbjct: 186 SQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEYISPSLTVEPAIESVKKEYDSPL 242


>gi|268592017|ref|ZP_06126238.1| SAM-dependent methyltransferase [Providencia rettgeri DSM 1131]
 gi|291312409|gb|EFE52862.1| SAM-dependent methyltransferase [Providencia rettgeri DSM 1131]
          Length = 244

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 83/207 (40%), Gaps = 18/207 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMPAGQGATNWPD 75
           G+    AI   LS  W  + G  LL LG         H   E +T   + + Q      D
Sbjct: 22  GEQYRQAIENQLSPWWPKIFGFHLLKLG---------HLSTEIQTEGCLISHQFNVGTGD 72

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
             F+  A      LPL   S+D  LM H L ++ DP  +L E+ RVL   G +I+   N 
Sbjct: 73  PRFNLVA--KPEALPLTQKSIDACLMTHCLAYSHDPHWLLREVDRVLIDDGWLIISGFNP 130

Query: 136 RGMWARMEHTP-FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
             +    +  P     QPY   +    +R  ++ LS+ +  + +   H+ C +  W    
Sbjct: 131 FSLLGMAKLVPVLRKRQPYC-SRFFPSVRVFDW-LSLLNYEVLY---HRNCQIIPWLGAN 185

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLP 221
           +  N    G   + VI ARK  Y   P
Sbjct: 186 RRVNKSCGGVGVLSVIVARKRTYPLTP 212


>gi|212223926|ref|YP_002307162.1| UbiE/COQ5 methyltransferase [Thermococcus onnurineus NA1]
 gi|212008883|gb|ACJ16265.1| UbiE/COQ5 methyltransferase [Thermococcus onnurineus NA1]
          Length = 223

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW---ARME- 143
           +LP  D S D VL V   EF  +P  ++ EI RVL  GG +++   N R  W    R++ 
Sbjct: 91  SLPFPDESFDLVLSVTMFEFIHEPEKVIAEIHRVLKPGGEVLIGTMNGRSPWFFFKRLKS 150

Query: 144 ---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
               T +   + Y+  ++  LL+   FT   ++  +FFP
Sbjct: 151 LFVETAYRYARFYTPRELELLLKNGGFTEVESAGVIFFP 189


>gi|91223498|ref|ZP_01258763.1| putative SAM-dependent methyltransferase [Vibrio alginolyticus
           12G01]
 gi|91191584|gb|EAS77848.1| putative SAM-dependent methyltransferase [Vibrio alginolyticus
           12G01]
          Length = 248

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G  LP  D S D V++ H L++A DP  +L E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYELPFLDKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYVIITGFNPLSLTGL 136

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +    R   FP    K    +W+  
Sbjct: 137 ASLLPW-RKHNLPW-SGRMFTSNRIKDWLGLLNYQVIHCDRYALFP---MKRYRTMWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI 222
           E  +G+   P    +Y I ARK  Y   PI
Sbjct: 192 ENSLGDWASPA-GSLYYIVARKRTYPLKPI 220


>gi|222100262|ref|YP_002534830.1| Methyltransferase type 11 [Thermotoga neapolitana DSM 4359]
 gi|221572652|gb|ACM23464.1| Methyltransferase type 11 [Thermotoga neapolitana DSM 4359]
          Length = 199

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query: 83  LVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           LV EG   NLPL D S D  LMV  + F +DP   L E  RV+  GG +IV +  +    
Sbjct: 67  LVIEGTAENLPLKDESFDFALMVTTICFVDDPLRALQEAKRVIRKGGHIIVGIVGRESFL 126

Query: 140 ARMEHTP------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
            R           +   + +S  +++ L++   F      ++LF  P+
Sbjct: 127 GREYEEKKEKSLFYKRARFFSTEEIVHLMKMVGFGDFKVVQTLFNHPS 174


>gi|238913718|ref|ZP_04657555.1| hypothetical protein SentesTe_21657 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 240

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|158313966|ref|YP_001506474.1| methyltransferase type 11 [Frankia sp. EAN1pec]
 gi|158109371|gb|ABW11568.1| Methyltransferase type 11 [Frankia sp. EAN1pec]
          Length = 274

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 29/53 (54%)

Query: 92  ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
           AD S D VL+ H LE   DP  +L E  RVL  GGR+ V +PN      R +H
Sbjct: 80  ADGSFDLVLLSHILEHLVDPAPLLAEARRVLAPGGRIAVALPNVAHFRQRAQH 132


>gi|293603366|ref|ZP_06685794.1| type 11 methyltransferase [Achromobacter piechaudii ATCC 43553]
 gi|292818276|gb|EFF77329.1| type 11 methyltransferase [Achromobacter piechaudii ATCC 43553]
          Length = 259

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 63/152 (41%), Gaps = 21/152 (13%)

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           + S   L     LP    SVD +++ H  E  +DP  +L E+ RVL   GR+++   N  
Sbjct: 78  WQSRVVLAEPEALPFESQSVDLLILPHAFECTQDPHNVLREVERVLVPEGRVVISGFNPW 137

Query: 137 GMWA---RMEHTPFGSGQPYS----------WYQMISL-LREANFTLSITSRSLFFPPTH 182
            MW    RM        QP S          W++++SL ++E+ F         + P   
Sbjct: 138 SMWGARTRMPGMEPWLPQPPSSQVSLVRLKDWFKLLSLEVKESQF-------GCYAPACR 190

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            +  L+ W   E  G  +      +Y++ A K
Sbjct: 191 SEKWLQRWGFLESAGARWWSLGGAVYMVSAVK 222


>gi|254786147|ref|YP_003073576.1| SAM-dependent methyltransferase [Teredinibacter turnerae T7901]
 gi|237683590|gb|ACR10854.1| SAM-dependent methyltransferase [Teredinibacter turnerae T7901]
          Length = 285

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 3/136 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCF-HGKVER 59
           +R  +  L  +Y S LG+        +L      + G  L+ L   +P+     H ++  
Sbjct: 19  LRQSLAALAAWYESPLGQAALQEQQHILRDELSCLFGYHLMELSI-VPYERLSEHSRINH 77

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
             +  P         D        +SE + LPLAD S+D  ++ H LEF+ +P  +L E 
Sbjct: 78  RFSLSPVHVPPPPCDDASLRDVQGLSELDALPLADESIDVTILHHVLEFSPNPHQVLKEA 137

Query: 119 WRVLTSGGRMIVVVPN 134
            RV    G +I+   N
Sbjct: 138 ARVTVPRGHVIIFAFN 153


>gi|148270611|ref|YP_001245071.1| methyltransferase type 11 [Thermotoga petrophila RKU-1]
 gi|281412921|ref|YP_003347000.1| Methyltransferase type 11 [Thermotoga naphthophila RKU-10]
 gi|147736155|gb|ABQ47495.1| Methyltransferase type 11 [Thermotoga petrophila RKU-1]
 gi|281374024|gb|ADA67586.1| Methyltransferase type 11 [Thermotoga naphthophila RKU-10]
          Length = 207

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query: 83  LVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           LV EG   NLPL D S D  LMV  + F +DP   L E  RV+  GG +IV +  +    
Sbjct: 75  LVIEGTAENLPLKDESFDFALMVTTICFVDDPLRALQEAKRVIRKGGHIIVGIVGRESFL 134

Query: 140 ARMEHTP------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
            R           +   + +S  +++ L++   F      ++LF  P+
Sbjct: 135 GREYEEKKEKSLFYKRARFFSTEEIVHLMKMVGFGDFKVVQTLFNHPS 182


>gi|16763645|ref|NP_459260.1| SAM-dependent methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62178828|ref|YP_215245.1| hypothetical protein SC0258 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167554224|ref|ZP_02347965.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167995091|ref|ZP_02576181.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168232193|ref|ZP_02657251.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238649|ref|ZP_02663707.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168239996|ref|ZP_02664928.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168819166|ref|ZP_02831166.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443090|ref|YP_002039496.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447422|ref|YP_002044246.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472658|ref|ZP_03078642.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735250|ref|YP_002113279.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251859|ref|YP_002145262.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262826|ref|ZP_03162900.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|200390349|ref|ZP_03216960.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204926935|ref|ZP_03218137.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207855774|ref|YP_002242425.1| hypothetical protein SEN0264 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|16418762|gb|AAL19219.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62126461|gb|AAX64164.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|194401753|gb|ACF61975.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194405726|gb|ACF65945.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459022|gb|EDX47861.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710752|gb|ACF89973.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197215562|gb|ACH52959.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197241081|gb|EDY23701.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288609|gb|EDY27986.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|199602794|gb|EDZ01340.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204323600|gb|EDZ08795.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205321520|gb|EDZ09359.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205327155|gb|EDZ13919.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333447|gb|EDZ20211.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205340191|gb|EDZ26955.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343970|gb|EDZ30734.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206707577|emb|CAR31851.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|267991949|gb|ACY86834.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301156883|emb|CBW16359.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911227|dbj|BAJ35201.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320084511|emb|CBY94303.1| Uncharacterized protein yafS [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321224916|gb|EFX49977.1| SAM-dependent methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322614542|gb|EFY11471.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620060|gb|EFY16932.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623355|gb|EFY20194.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629347|gb|EFY26126.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632067|gb|EFY28821.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637195|gb|EFY33897.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640308|gb|EFY36968.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645925|gb|EFY42445.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652376|gb|EFY48730.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652580|gb|EFY48930.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660390|gb|EFY56626.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664543|gb|EFY60736.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669404|gb|EFY65554.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670950|gb|EFY67083.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678811|gb|EFY74866.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681840|gb|EFY77865.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687966|gb|EFY83932.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322713279|gb|EFZ04850.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128577|gb|ADX16007.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323194320|gb|EFZ79515.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197736|gb|EFZ82868.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203468|gb|EFZ88493.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206787|gb|EFZ91740.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213394|gb|EFZ98195.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214687|gb|EFZ99438.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221460|gb|EGA05876.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226222|gb|EGA10438.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229990|gb|EGA14110.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233729|gb|EGA17818.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238577|gb|EGA22635.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244265|gb|EGA28274.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246426|gb|EGA30409.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252191|gb|EGA36044.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258048|gb|EGA41727.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259854|gb|EGA43485.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265131|gb|EGA48630.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272694|gb|EGA56101.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|332987208|gb|AEF06191.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 240

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|226365923|ref|YP_002783706.1| methyltransferase [Rhodococcus opacus B4]
 gi|226244413|dbj|BAH54761.1| putative methyltransferase [Rhodococcus opacus B4]
          Length = 259

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LPL D SVD V+    +E   D    L E +RVLT GG ++V  PN R  ++    TP 
Sbjct: 101 ELPLGDESVDTVVNFQVIEHLWDQAQFLRECFRVLTPGGELLVSTPN-RITFSPGRDTPL 159

Query: 148 G--SGQPYSWYQMISLLREANFTLSITS 173
                +     ++  LL EA FT+++ +
Sbjct: 160 NPFHTRELDAAELTELLEEAGFTVALMT 187


>gi|224582103|ref|YP_002635901.1| hypothetical protein SPC_0272 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224466630|gb|ACN44460.1| hypothetical protein SPC_0272 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 222

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 65  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 124

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 125 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 181

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 182 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 211


>gi|56414618|ref|YP_151693.1| hypothetical protein SPA2507 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|168261340|ref|ZP_02683313.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197363546|ref|YP_002143183.1| hypothetical protein SSPA2338 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205351593|ref|YP_002225394.1| hypothetical protein SG0260 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|56128875|gb|AAV78381.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095023|emb|CAR60569.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205271374|emb|CAR36167.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205350042|gb|EDZ36673.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|326626621|gb|EGE32964.1| putative Methyltransferase type 11 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 240

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|304413388|ref|ZP_07394861.1| SAM-dependent methyltransferase [Candidatus Regiella insecticola
           LSR1]
 gi|304284231|gb|EFL92624.1| SAM-dependent methyltransferase [Candidatus Regiella insecticola
           LSR1]
          Length = 237

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 10/115 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + +   W    G  LL +G+     +     +   ++ +          +Q
Sbjct: 22  GEYYRAAIEEAMQPWWSKFFGFHLLKIGHLSAEIASDQCSISHQVSAV----------EQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            +++  L S   LP A+ SVD  L++H L +  DP  +L E+ R+LT  G ++  
Sbjct: 72  GYNTQVLASPYQLPFAEKSVDVCLLLHTLAYGTDPHRILREVDRILTDDGWLVTT 126


>gi|325527249|gb|EGD04628.1| methyltransferase type 11 [Burkholderia sp. TJI49]
          Length = 181

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------AR 141
           +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W       R
Sbjct: 81  DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQTFGR 140

Query: 142 MEHTPF 147
           M + PF
Sbjct: 141 MANRPF 146


>gi|149927489|ref|ZP_01915743.1| Methyltransferase type 11 [Limnobacter sp. MED105]
 gi|149823762|gb|EDM82988.1| Methyltransferase type 11 [Limnobacter sp. MED105]
          Length = 272

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
            LP    S+D +++ H LEF+EDP  +L E+ RVL   GR+++   N   +W 
Sbjct: 99  ELPFESQSLDMIVLPHVLEFSEDPHQLLREVERVLMPEGRVVITGFNPMSLWG 151


>gi|23013125|ref|ZP_00053064.1| COG0500: SAM-dependent methyltransferases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 200

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +  +L +   LP  DSS+D  L+ H +E   DP  ++ E+WR+   G +M + VP+
Sbjct: 40  ADLSLCATTPLPFEDSSIDEFLLSHLIEHIPDPLPLMQELWRIAKPGAKMQIRVPH 95


>gi|162456014|ref|YP_001618381.1| ArsR family transcriptional regulator [Sorangium cellulosum 'So ce
           56']
 gi|161166596|emb|CAN97901.1| transcriptional regulator, ArsR family [Sorangium cellulosum 'So ce
           56']
          Length = 317

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP  D+S D +L+ H L +AEDP   L E  RVL  GGR++++  +      R    P+G
Sbjct: 202 LPFGDASFDSILVFHTLTYAEDPPRALEECARVLRPGGRVVILSLD--AHQQREITVPYG 259

Query: 149 SGQP 152
              P
Sbjct: 260 ERHP 263


>gi|327399550|ref|YP_004340419.1| type 11 methyltransferase [Hippea maritima DSM 10411]
 gi|327182179|gb|AEA34360.1| Methyltransferase type 11 [Hippea maritima DSM 10411]
          Length = 316

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           NLP  D   D +L+   + F +DP   L E +RVL  GG+++V + ++     +      
Sbjct: 192 NLPFMDEEYDFILIAVTICFVKDPKKTLKEAYRVLKKGGKIVVAIVDRASEIGKEYLNKK 251

Query: 148 GSGQPYSWY------QMISLLREANFTLSITSRSLF 177
             G+ Y +       ++  +L+E  F    T ++LF
Sbjct: 252 EKGRFYKYVTFFSAEELQDILKETGFEAENTYQTLF 287


>gi|224824458|ref|ZP_03697565.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
 gi|224602951|gb|EEG09127.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
          Length = 246

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LP    S+D V++ H L+F+  P  +L E  RVL   GR+++   N   +W        
Sbjct: 74  QLPFESRSLDLVVLPHILDFSIHPHQVLREAERVLMPEGRVVLTGFNPVSLWGVRRLIEG 133

Query: 148 GSGQPYSWYQMISLLREANF--TLSITSRSLFF----PPTHKKCILKLWSVFEKIGNIFG 201
               P++  Q +SL+R  ++   L +      F    PP  +   L+ +   EK G+ + 
Sbjct: 134 RQQVPWN-AQFLSLVRIKDWLTLLDLEPEGGSFMGYCPPFARADWLERFRFMEKAGDRWW 192

Query: 202 PGFAGIYVIEARK 214
           P  AG+Y I+A K
Sbjct: 193 PLAAGVYGIQAIK 205


>gi|124267714|ref|YP_001021718.1| hypothetical protein Mpe_A2528 [Methylibium petroleiphilum PM1]
 gi|124260489|gb|ABM95483.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 281

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 70/170 (41%), Gaps = 18/170 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP A  S+D V++ H LE A DP   L E+ RVL   G++++   N   +W   +     
Sbjct: 94  LPFASQSLDLVVLPHTLELARDPHHTLREVERVLVPEGQVVITGLNPTSLWGLRQAGGRA 153

Query: 149 -----------------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
                            +G   ++ ++   LR  +F +       + P    +  L  ++
Sbjct: 154 AQRLGRRSDDERLFLPRAGDFIAYRRLRDWLRLLSFEVESGGFGCYRPALRSQAWLDRYA 213

Query: 192 VFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
             E+ G  + P F  +Y+++A K + +G+ +     K    P   P  VS
Sbjct: 214 WMERAGERWWPVFGAVYLLKAVKRV-RGMRLIGPAWKKTPKPRAAPAVVS 262


>gi|163801802|ref|ZP_02195699.1| hypothetical protein 1103602000600_AND4_15180 [Vibrio sp. AND4]
 gi|159174310|gb|EDP59114.1| hypothetical protein AND4_15180 [Vibrio sp. AND4]
          Length = 251

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%), Gaps = 10/147 (6%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           +V++G  LP  + S D  ++ H L++A DP  +L E+ RV+   G +I+   N   +   
Sbjct: 77  VVADGYELPFLEKSFDVAVLAHQLDYASDPHRLLREVDRVMMDDGYIIITGFNPISVTGL 136

Query: 142 MEHTPFG------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
               P+       SG+ ++ +++   L   N+ +    R   FP T  K +L  W +   
Sbjct: 137 ASLLPWRRNILPWSGRMFTTHRIKDWLGVLNYQVVHCERYALFPMTRCKTMLT-W-LENS 194

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPI 222
           +G+   P    +Y I ARK  Y   PI
Sbjct: 195 LGDWASPA-GSLYYIVARKRTYPLKPI 220


>gi|239908667|ref|YP_002955409.1| putative glycosyltransferase [Desulfovibrio magneticus RS-1]
 gi|239798534|dbj|BAH77523.1| putative glycosyltransferase [Desulfovibrio magneticus RS-1]
          Length = 1200

 Score = 46.2 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           +PLAD+SVDC +    LE    P  +L EI RVL  GG +    P    +W  +   P  
Sbjct: 104 IPLADASVDCAMATEVLEHCPAPLPVLKEIRRVLAPGGSLFFTTPF---LWP-IHDAPHD 159

Query: 149 SGQPYSWYQMISLLREANF 167
             + Y+ Y +  LL EA F
Sbjct: 160 HYR-YTPYALERLLAEAGF 177



 Score = 35.0 bits (79), Expect = 8.8,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NL   D+S D V   H LE   D    + E+ RVL   G  IV+VP
Sbjct: 754 NLQFPDASFDAVYCSHVLEHVPDDRKAMRELHRVLAKDGLAIVMVP 799


>gi|168465315|ref|ZP_02699197.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195631734|gb|EDX50254.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 240

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 66/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       +  N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRFLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|126465628|ref|YP_001040737.1| methyltransferase type 11 [Staphylothermus marinus F1]
 gi|126014451|gb|ABN69829.1| Methyltransferase type 11 [Staphylothermus marinus F1]
          Length = 216

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 8/102 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP  D+  D V++V  + F  DP  ML EI RVL   G ++  V  K   W        
Sbjct: 89  DLPFIDNYFDSVIVVVTICFVNDPLKMLSEINRVLKKNGTLVTCVVPKESSWGIYYRWLK 148

Query: 148 GSGQP--------YSWYQMISLLREANFTLSITSRSLFFPPT 181
            SG+         Y+  ++  +L    F +  T  +L +PP+
Sbjct: 149 NSGKSLFYKYARFYTIQELYYMLSITGFIVKDTCSTLLYPPS 190


>gi|260772247|ref|ZP_05881163.1| SAM-dependent methyltransferase [Vibrio metschnikovii CIP 69.14]
 gi|260611386|gb|EEX36589.1| SAM-dependent methyltransferase [Vibrio metschnikovii CIP 69.14]
          Length = 244

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK---RG 137
           T +    +LP  + S+D  ++ H L++  DP  +L E+ RVL   G +I+   N     G
Sbjct: 76  TVIADAYDLPFLEKSIDVAIIAHQLDYCNDPHRILREVDRVLIDDGYVIITGFNPISLTG 135

Query: 138 MWARM---EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
           + + M   +H    SG+ ++  ++   L   N+ +    +   FP    +    LW+  E
Sbjct: 136 LTSTMPWRKHNLPWSGRMFTSSRIKDWLSVLNYQVLECDQYALFPMQKYR---PLWAWLE 192

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPI 222
                +      +Y I ARK  Y   PI
Sbjct: 193 NAMGGWASPLGSLYFIVARKRTYPLKPI 220


>gi|254514369|ref|ZP_05126430.1| SAM-dependent methyltransferase [gamma proteobacterium NOR5-3]
 gi|219676612|gb|EED32977.1| SAM-dependent methyltransferase [gamma proteobacterium NOR5-3]
          Length = 267

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 15/97 (15%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN---- 134
           S++       LPL   SVD V+  H LEF E P   L E+ RVL   G +I+V  N    
Sbjct: 79  SASMFCHGDELPLESDSVDTVVAFHALEFDEHPHGSLREMQRVLRPHGHLIIVGFNPLSL 138

Query: 135 -----------KRGMWARMEHTPFGSGQPYSWYQMIS 160
                      K  +W R  H P    +   W +++ 
Sbjct: 139 LGASQYLRGLKKNSLWNRQRHRPVSLHRLTDWLRLLD 175


>gi|261400682|ref|ZP_05986807.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269209593|gb|EEZ76048.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 221

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 27/140 (19%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPSGRVMLTGFNPHSLWG--- 114

Query: 144 HTPFGSGQPYSWYQMISL---------------LREANFTLSITSRSLFFPPTHKKCILK 188
                   P SW+    L               + +A F + +    ++ PP      ++
Sbjct: 115 --------PGSWFDGERLPEKRFCLTLRGLKRQIADAGFDIELGKFMVYLPPVSSPGQIR 166

Query: 189 LWSVFEKIGNIFGPGFAGIY 208
            W   EK G+ + P  A +Y
Sbjct: 167 FWRFMEKAGDRWWPQCAAVY 186


>gi|284028480|ref|YP_003378411.1| type 11 methyltransferase [Kribbella flavida DSM 17836]
 gi|283807773|gb|ADB29612.1| Methyltransferase type 11 [Kribbella flavida DSM 17836]
          Length = 240

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 60/149 (40%), Gaps = 23/149 (15%)

Query: 43  LGYAIPFFSCFHGKVERTLAFMPAGQGATN------WPD---QYFSSTALVSEGN----- 88
           L  A+   +    K  R L    AG G T       W     +Y +  A V+ G      
Sbjct: 26  LARALDSLAKAGAKPGRALDIGAAGGGNTRVLRSRGWNATALEYGAEGAAVAHGRNIPVI 85

Query: 89  ------LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
                 LPLAD ++D V+    LE  ED     +EI RVL  GG  ++ VP    +W+  
Sbjct: 86  RGDAVALPLADEAMDLVVAYDVLEHIEDDKSASNEIARVLRPGGVALIAVPVDMALWS-- 143

Query: 143 EH-TPFGSGQPYSWYQMISLLREANFTLS 170
           EH T  G  + Y    ++S L  A   + 
Sbjct: 144 EHDTAVGHVRRYDREGLLSTLTSAGLQIE 172


>gi|147677409|ref|YP_001211624.1| hypothetical protein PTH_1074 [Pelotomaculum thermopropionicum SI]
 gi|146273506|dbj|BAF59255.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 264

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           NLP AD + + +L    LE  E P   + E++RVL  GG++ + VP   G     EH   
Sbjct: 107 NLPFADKTFEAILCTEVLEHLEQPRETVKELFRVLKPGGKLFLTVPMAHG-----EHQVP 161

Query: 148 GSGQPYSWYQMISLLREANFT 168
                Y+ Y + S+  EA F 
Sbjct: 162 HDFFRYTSYGLRSICSEAGFN 182


>gi|37680715|ref|NP_935324.1| SAM-dependent methyltransferase [Vibrio vulnificus YJ016]
 gi|37199464|dbj|BAC95295.1| SAM-dependent methyltransferase [Vibrio vulnificus YJ016]
          Length = 255

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 70/150 (46%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +++   N   +   
Sbjct: 77  VIADGYELPFLEKSFDAVILAHQLDYASDPHRLLREVDRVMMDDGYLVITGFNPVSLTGL 136

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +    R   FP    K    +W+  
Sbjct: 137 ASLMPWRR-NNLPW-SGRMFTTNRIKDWLGVLNYQVVHCDRYALFP---MKKYRTMWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI 222
           E  +G+   P    +Y I ARK  Y   PI
Sbjct: 192 ENSLGDWASPA-GSLYFIVARKRTYPLKPI 220


>gi|111223617|ref|YP_714411.1| hypothetical protein FRAAL4217 [Frankia alni ACN14a]
 gi|111151149|emb|CAJ62859.1| hypothetical protein FRAAL4217 [Frankia alni ACN14a]
          Length = 271

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 46/109 (42%), Gaps = 20/109 (18%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPL  ++VD  L VH L    DP  +L E+ RVL  GGR+ VV                G
Sbjct: 90  LPLRTATVDACLAVHVLHLVGDPDRVLAEVARVLRPGGRLAVV----------------G 133

Query: 149 SGQPYSWYQMISLLREANFTLSIT----SRSLFFPPTHKKCILKLWSVF 193
           +GQ      + ++LR+ +  L        R     P  ++  L+L   F
Sbjct: 134 AGQHERHSDVTAVLRDLDEALRAERPRRDRPELLLPAAQRSGLRLVEEF 182


>gi|183601082|ref|ZP_02962575.1| hypothetical protein PROSTU_04707 [Providencia stuartii ATCC 25827]
 gi|188019423|gb|EDU57463.1| hypothetical protein PROSTU_04707 [Providencia stuartii ATCC 25827]
          Length = 241

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 83/207 (40%), Gaps = 16/207 (7%)

Query: 16  LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPD 75
            G+    A+   L   W  + G  LL LG+          +V+ T   M + Q      D
Sbjct: 21  FGEHYRQALQYQLRPWWPKIFGFHLLKLGH-------LSTEVD-TEECMVSHQFCLGNDD 72

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
             F   A      LP    S+D  L+ H L ++ DP  +L E+ RVL   G +I+   N 
Sbjct: 73  PRFQVIA--EPQALPFTAKSIDACLISHMLAYSHDPHWVLREVDRVLVDDGWLIISGFNP 130

Query: 136 RGMWARMEHTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
             +    +  PF    QPY   ++   LR  ++ LS+ +  + +   H+ C +  W   E
Sbjct: 131 FSLLGIGKMVPFLRKQQPYC-SRLFPTLRVFDW-LSVLNYEVLY---HRNCQVFPWHGPE 185

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLP 221
              N    G   + VI ARK  Y   P
Sbjct: 186 NWLNQRIKGVGTLNVIVARKRTYPLTP 212


>gi|170726956|ref|YP_001760982.1| hypothetical protein Swoo_2610 [Shewanella woodyi ATCC 51908]
 gi|169812303|gb|ACA86887.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908]
          Length = 248

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 93/217 (42%), Gaps = 20/217 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G      I  +L+  W  V G  +L LG             E  +  +P G+  + +  +
Sbjct: 19  GDQIKSLIEHILTPWWPKVFGYHMLNLGAL---------SAELDMPDLPIGRRFSLFDGK 69

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
             S  A  +   LP+ +S +D V+M   LEF  DP+ +L E  RVL SGG + ++  N  
Sbjct: 70  GASIRAEFTA--LPIQNSVIDAVVMNMLLEFEPDPYKLLRETDRVLISGGYLFIIGFNPL 127

Query: 137 GMWARMEHTP-FGSGQPYS-WYQMISLLRE----ANFTLSITSRSLFFPPTHKKCILKLW 190
                 +  P +   QP++  + M S +++      + +    R L+    H    +K  
Sbjct: 128 SPAFIGKLLPKYQQQQPWNGRFFMPSRVKDWLGLLGYQVISDERFLYH---HLLSDIKSE 184

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
           S+++     + P    +Y+I ARK+     PI E +K
Sbjct: 185 SIWQDALQAWLPSSGSLYLIVARKLESPLTPIHEKRK 221


>gi|31789421|gb|AAP58536.1| putative methyltransferase [uncultured Acidobacteria bacterium]
          Length = 271

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-----RGMWARM 142
            LP AD+S D +  +  +E  ++    + E+ RVL  GGR I+ VPN+     R + A +
Sbjct: 119 ELPFADASFDAIYSMGTIEHFDETERAVREMARVLRPGGRAIIGVPNRHDPFLRPLLATL 178

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
                   +G  + YS   +  LL  A FT++  +  LF P
Sbjct: 179 LQAVGLYGYGYEKSYSRASLRRLLEPAGFTVAAETAILFMP 219


>gi|53803341|ref|YP_114957.1| hypothetical protein MCA2546 [Methylococcus capsulatus str. Bath]
 gi|53757102|gb|AAU91393.1| conserved domain protein [Methylococcus capsulatus str. Bath]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            LP  D + DC+L     E   DPFL + E  RVL  GGRM +  P
Sbjct: 102 RLPFGDGAFDCILCTEVFEHLHDPFLAMKECSRVLKHGGRMFMSTP 147


>gi|313668435|ref|YP_004048719.1| hypothetical protein NLA_11310 [Neisseria lactamica ST-640]
 gi|313005897|emb|CBN87353.1| hypothetical protein NLA_11310 [Neisseria lactamica 020-06]
          Length = 221

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 27/140 (19%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPSGRVMLTGFNPHSLWG--- 114

Query: 144 HTPFGSGQPYSWYQMISL---------------LREANFTLSITSRSLFFPPTHKKCILK 188
                   P SW+    L               + +A F + +    ++ PP      ++
Sbjct: 115 --------PGSWFDGERLPEKRFCLTLRGLKRQIADAGFDIELGKFMVYLPPVSSPGQIR 166

Query: 189 LWSVFEKIGNIFGPGFAGIY 208
            W   EK G+ + P  A +Y
Sbjct: 167 FWRFMEKAGDRWWPHCAAVY 186


>gi|88703292|ref|ZP_01101008.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88702006|gb|EAQ99109.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 291

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (43%), Gaps = 16/96 (16%)

Query: 80  STALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN---- 134
           S +L   G+ LPL   S+D V+  H LEF E P   L E+ RVL   G +IVV  N    
Sbjct: 90  SASLYCHGDELPLESDSIDTVVAFHALEFDEHPHGSLREMQRVLRPHGHLIVVGFNPYSL 149

Query: 135 -----------KRGMWARMEHTPFGSGQPYSWYQMI 159
                      K  +W R  H P    +   W +++
Sbjct: 150 LGAIHYARGLQKSSLWNRQRHRPVSLHRLTDWLRLL 185


>gi|257139537|ref|ZP_05587799.1| hypothetical protein BthaA_10106 [Burkholderia thailandensis E264]
          Length = 209

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 56/132 (42%), Gaps = 20/132 (15%)

Query: 28  LSTTWDDVTGCRLLGLGYAIPFFSCFH---GKVERTLAFMPAGQGATNWPDQYFSSTALV 84
           L T  ++   CR L L  A    + +H    +   +    PAG+ +T W D         
Sbjct: 29  LDTLRENRMPCRGLVLDPASGASAPYHYPWAREAHSAEHAPAGR-STVWCDLL------- 80

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW----- 139
              +LP    SVD ++M H LEF  DP  +L E  RVL   G++++   N   +W     
Sbjct: 81  ---DLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLVITGFNSLSLWGARHS 137

Query: 140 -ARMEHTPFGSG 150
             +M   PF S 
Sbjct: 138 VGKMAKRPFVSA 149


>gi|90407279|ref|ZP_01215465.1| methyltransferase [Psychromonas sp. CNPT3]
 gi|90311562|gb|EAS39661.1| methyltransferase [Psychromonas sp. CNPT3]
          Length = 246

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 28/43 (65%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            LPL DS +D  ++ H L+F+ DP  +L EI RVLT  G +IV
Sbjct: 83  QLPLQDSCIDLCILSHELDFSNDPHQLLREIDRVLTIDGVLIV 125


>gi|221134805|ref|ZP_03561108.1| SAM-dependent methyltransferase [Glaciecola sp. HTCC2999]
          Length = 257

 Score = 45.8 bits (107), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 50/130 (38%), Gaps = 7/130 (5%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP    +VD   +++ L+F  DP  +L E+ RV  S G +I+   N   +   +   P  
Sbjct: 102 LPFGQGTVDTACLINALDFTHDPHQLLREVERVTRSDGHIILTGCNPLSLSGLLHQLPVY 161

Query: 149 SGQPYSWYQMISLLREAN----FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGF 204
              P+S  +  S  R          SI  R  F P        K   + E I  I     
Sbjct: 162 QAHPFSSARFFSYYRVKEWLNVLGFSIKYRCFFGP---ANIFGKPKKIKETIDTIGSSSM 218

Query: 205 AGIYVIEARK 214
             +Y I A+K
Sbjct: 219 RSMYFIVAQK 228


>gi|320155616|ref|YP_004187995.1| SAM-dependent methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|326423902|ref|NP_760759.2| SAM-dependent methyltransferase [Vibrio vulnificus CMCP6]
 gi|319930928|gb|ADV85792.1| SAM-dependent methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|319999278|gb|AAO10286.2| SAM-dependent methyltransferase [Vibrio vulnificus CMCP6]
          Length = 255

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 14/149 (9%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG---- 137
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +++   N       
Sbjct: 77  VIADGYELPFLEKSFDAVILAHQLDYASDPHRLLREVDRVMMDDGYLVITGFNPVSFTGL 136

Query: 138 ---MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
              M  R  + P+ SG+ ++  ++   L   N+ +    R   FP    K    +W+  E
Sbjct: 137 ASLMPWRKNNLPW-SGRMFTTNRIKDWLGVLNYQVVHCDRYALFP---MKKYRTMWTWLE 192

Query: 195 K-IGNIFGPGFAGIYVIEARKILYQGLPI 222
             +G+   P    +Y I ARK  Y   PI
Sbjct: 193 NSLGDWASPA-GSLYFIVARKRTYPLKPI 220


>gi|254805098|ref|YP_003083319.1| hypothetical protein NMO_1137 [Neisseria meningitidis alpha14]
 gi|254668640|emb|CBA06275.1| hypothetical protein NMO_1137 [Neisseria meningitidis alpha14]
          Length = 221

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +A F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRRLADAGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|254428568|ref|ZP_05042275.1| hypothetical protein ADG881_1798 [Alcanivorax sp. DG881]
 gi|196194737|gb|EDX89696.1| hypothetical protein ADG881_1798 [Alcanivorax sp. DG881]
          Length = 258

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 6/145 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV-----VVPNKRGMWARME 143
           LP+A SSVD +L+ H ++FA DP   L E  R +  GG+M +     V       W    
Sbjct: 94  LPIAKSSVDVLLLHHTMDFAADPHQALREASRCMAPGGKMAIIGFHPVSVMGLARWLLWW 153

Query: 144 HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPG 203
            +P   G+ Y   ++   L+   F +   +   +  P   +   ++  + + +G    P 
Sbjct: 154 KSPGWMGRYYRPNRLTDWLQVLGFEVDGMASGFYTMPLSDRGRSRV-RLLDWLGRFLWPR 212

Query: 204 FAGIYVIEARKILYQGLPITESKKK 228
               Y++ ARK      P+   ++K
Sbjct: 213 HGNTYLLVARKRAGVVRPLATRQRK 237


>gi|89900256|ref|YP_522727.1| hypothetical protein Rfer_1463 [Rhodoferax ferrireducens T118]
 gi|89344993|gb|ABD69196.1| conserved hypothetical protein [Rhodoferax ferrireducens T118]
          Length = 233

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 75/168 (44%), Gaps = 18/168 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA---RMEHT 145
           LP   +S+D V++ H LE A DP   L E+ RVL   GR+++   N   +W    R   +
Sbjct: 50  LPFQANSLDLVVLPHSLELASDPHTTLREVERVLVPEGRVVICGLNPTSLWGFRQRRGRS 109

Query: 146 PF----------GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
           P            +G+   ++++   LR   F + +     + P    +  L+ +   ++
Sbjct: 110 PHRVGSQKLFLPEAGEFIGYWRLRDWLRLLGFEVEVGRFGCYRPAFSSEKWLQRFEWMDR 169

Query: 196 IGNIFGPGFAGIYVIEARKILYQGL----PITESKKKHISSPILVPHT 239
            G  + P    +Y + A K + +G+    P  ++ +   ++P+ V ++
Sbjct: 170 AGARWWPILGSVYFLVAVKRV-RGMTLLSPAWKASRALANAPVSVANS 216


>gi|242240258|ref|YP_002988439.1| methyltransferase type 11 [Dickeya dadantii Ech703]
 gi|242132315|gb|ACS86617.1| Methyltransferase type 11 [Dickeya dadantii Ech703]
          Length = 239

 Score = 45.8 bits (107), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    + ++  LS  W  + G  LL +G            +   +   PA   A    D 
Sbjct: 22  GNLYKETLNTALSPWWSRIFGFHLLKVGALSIEIDSEECTIPHQVNMCPALGRAHVVADP 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           Y           LP A+ S+D  L+ H L ++ DP  +L EI RVL S G +I+
Sbjct: 82  Y----------QLPFAEKSIDACLLAHTLSYSADPHRVLREIDRVLISDGWLII 125


>gi|28899068|ref|NP_798673.1| putative SAM-dependent methyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260366044|ref|ZP_05778516.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus K5030]
 gi|260876850|ref|ZP_05889205.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260897331|ref|ZP_05905827.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|260899807|ref|ZP_05908202.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|28807292|dbj|BAC60557.1| putative SAM-dependent methyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308088290|gb|EFO37985.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308091496|gb|EFO41191.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308107379|gb|EFO44919.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|308115292|gb|EFO52832.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus K5030]
 gi|328474395|gb|EGF45200.1| putative SAM-dependent methyltransferase [Vibrio parahaemolyticus
           10329]
          Length = 251

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 72/149 (48%), Gaps = 14/149 (9%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK---RGM 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N     G+
Sbjct: 77  VIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGCLIITGFNPISFTGL 136

Query: 139 WA----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
            +    R  + P+ SG+ ++  ++   L   N+ +    R   FP T  +    +W+  E
Sbjct: 137 ASLFPWRKNNLPW-SGRMFTSSRINDWLGLLNYQVIHCDRYALFPMTRYR---TMWTWLE 192

Query: 195 K-IGNIFGPGFAGIYVIEARKILYQGLPI 222
             +G+   P    +Y I ARK  Y   PI
Sbjct: 193 NSLGDWASPA-GSLYYIVARKRTYPLKPI 220


>gi|153213815|ref|ZP_01949023.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|229513878|ref|ZP_04403340.1| SAM-dependent methyltransferase [Vibrio cholerae TMA 21]
 gi|229528761|ref|ZP_04418151.1| SAM-dependent methyltransferase [Vibrio cholerae 12129(1)]
 gi|254225774|ref|ZP_04919379.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|262192142|ref|ZP_06050303.1| SAM-dependent methyltransferase [Vibrio cholerae CT 5369-93]
 gi|124115739|gb|EAY34559.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|125621680|gb|EAZ50009.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|229332535|gb|EEN98021.1| SAM-dependent methyltransferase [Vibrio cholerae 12129(1)]
 gi|229349059|gb|EEO14016.1| SAM-dependent methyltransferase [Vibrio cholerae TMA 21]
 gi|262031991|gb|EEY50568.1| SAM-dependent methyltransferase [Vibrio cholerae CT 5369-93]
 gi|327484753|gb|AEA79160.1| SAM-dependent methyltransferase [Vibrio cholerae LMA3894-4]
          Length = 243

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYLIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-FGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|153825347|ref|ZP_01978014.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|149741031|gb|EDM55100.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
          Length = 245

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYLIITGFNPISCIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-FGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|121998365|ref|YP_001003152.1| type 11 methyltransferase [Halorhodospira halophila SL1]
 gi|121589770|gb|ABM62350.1| Methyltransferase type 11 [Halorhodospira halophila SL1]
          Length = 243

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 9/133 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------- 140
            LP    S+D +++ H LEF  +P  +L E ++VL   GR++V+  N  G+W        
Sbjct: 69  QLPFRGQSIDALILSHVLEFNAEPGAVLSEAYQVLAPEGRLMVLTFNPLGLWGARRLWGR 128

Query: 141 -RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
            R    P+G G+ +    +   LR   F         F PP   + + K    +E     
Sbjct: 129 WRSAPVPWG-GRQWLASTVGVHLRRCGFETVARHDLCFRPPIQGERLQKRLDPWEDRLRR 187

Query: 200 FGPGFAGIYVIEA 212
            G   AG+ +  A
Sbjct: 188 LGRFAAGVQITVA 200


>gi|15642233|ref|NP_231866.1| hypothetical protein VC2235 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121586231|ref|ZP_01676021.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121726546|ref|ZP_01679795.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147673588|ref|YP_001217751.1| hypothetical protein VC0395_A1827 [Vibrio cholerae O395]
 gi|153817094|ref|ZP_01969761.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153820871|ref|ZP_01973538.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227082359|ref|YP_002810910.1| hypothetical protein VCM66_2158 [Vibrio cholerae M66-2]
 gi|229507690|ref|ZP_04397195.1| SAM-dependent methyltransferase [Vibrio cholerae BX 330286]
 gi|229512115|ref|ZP_04401594.1| SAM-dependent methyltransferase [Vibrio cholerae B33]
 gi|229607194|ref|YP_002877842.1| SAM-dependent methyltransferase [Vibrio cholerae MJ-1236]
 gi|254849366|ref|ZP_05238716.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255747067|ref|ZP_05421012.1| SAM-dependent methyltransferase [Vibrio cholera CIRS 101]
 gi|262161388|ref|ZP_06030498.1| SAM-dependent methyltransferase [Vibrio cholerae INDRE 91/1]
 gi|262167742|ref|ZP_06035444.1| SAM-dependent methyltransferase [Vibrio cholerae RC27]
 gi|297580877|ref|ZP_06942802.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298500390|ref|ZP_07010195.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656794|gb|AAF95379.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549497|gb|EAX59523.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121630999|gb|EAX63378.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|126512362|gb|EAZ74956.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126521663|gb|EAZ78886.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146315471|gb|ABQ20010.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227010247|gb|ACP06459.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014131|gb|ACP10341.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229352080|gb|EEO17021.1| SAM-dependent methyltransferase [Vibrio cholerae B33]
 gi|229355195|gb|EEO20116.1| SAM-dependent methyltransferase [Vibrio cholerae BX 330286]
 gi|229369849|gb|ACQ60272.1| SAM-dependent methyltransferase [Vibrio cholerae MJ-1236]
 gi|254845071|gb|EET23485.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255735469|gb|EET90869.1| SAM-dependent methyltransferase [Vibrio cholera CIRS 101]
 gi|262023807|gb|EEY42506.1| SAM-dependent methyltransferase [Vibrio cholerae RC27]
 gi|262028699|gb|EEY47353.1| SAM-dependent methyltransferase [Vibrio cholerae INDRE 91/1]
 gi|297534703|gb|EFH73539.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297541083|gb|EFH77137.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 245

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYLIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-FGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|254286456|ref|ZP_04961413.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|150423405|gb|EDN15349.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
          Length = 243

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYLIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-FGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|229522182|ref|ZP_04411599.1| SAM-dependent methyltransferase [Vibrio cholerae TM 11079-80]
 gi|229341107|gb|EEO06112.1| SAM-dependent methyltransferase [Vibrio cholerae TM 11079-80]
          Length = 243

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYLIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENSLGGSNSP-FGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|262393544|ref|YP_003285398.1| SAM-dependent methyltransferase [Vibrio sp. Ex25]
 gi|262337138|gb|ACY50933.1| SAM-dependent methyltransferase [Vibrio sp. Ex25]
          Length = 248

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPLSLTGL 136

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +    R   FP    K    +W+  
Sbjct: 137 ASLLPW-RKHNLPW-SGRMFTSNRINDWLGLLNYQVIHCDRYALFP---MKRYRTMWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI 222
           E  +G+   P    +Y I ARK  Y   PI
Sbjct: 192 ENSLGDWASPA-GSLYYIVARKRTYPLKPI 220


>gi|320103119|ref|YP_004178710.1| type 11 methyltransferase [Isosphaera pallida ATCC 43644]
 gi|319750401|gb|ADV62161.1| Methyltransferase type 11 [Isosphaera pallida ATCC 43644]
          Length = 288

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
            LPLAD++V+ V+    LE   DP   L E  RVL  GGR+I+  PN+
Sbjct: 105 RLPLADAAVEVVVSFETLEHLTDPARFLDECVRVLRPGGRLIISTPNR 152


>gi|225023941|ref|ZP_03713133.1| hypothetical protein EIKCOROL_00808 [Eikenella corrodens ATCC
           23834]
 gi|224942966|gb|EEG24175.1| hypothetical protein EIKCOROL_00808 [Eikenella corrodens ATCC
           23834]
          Length = 230

 Score = 45.4 bits (106), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 59/143 (41%), Gaps = 2/143 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-RMEHTP 146
            LPL   SV  +L+ H LE    P  +L E +RVL   G++++   N   +W   +    
Sbjct: 72  QLPLLSGSVQTLLLPHGLELCAQPEELLRECFRVLLPNGKLVLSGFNPYSLWRFGLPEKQ 131

Query: 147 FG-SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
            G         ++  +L EA F         + PP   +  L+ W   E  GN + P  A
Sbjct: 132 LGLRAHALPLPKVRRMLAEAGFRPDTGRFMAYVPPWENERALQRWHFMELAGNRWWPAAA 191

Query: 206 GIYVIEARKILYQGLPITESKKK 228
             Y + A K +Y   P+ E   K
Sbjct: 192 AAYGLAAVKTVYPLTPLREKAGK 214


>gi|168210215|ref|ZP_02635840.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens B str.
           ATCC 3626]
 gi|168217277|ref|ZP_02642902.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens NCTC
           8239]
 gi|169344291|ref|ZP_02865271.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens C str.
           JGS1495]
 gi|169297549|gb|EDS79651.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens C str.
           JGS1495]
 gi|170711708|gb|EDT23890.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens B str.
           ATCC 3626]
 gi|182380669|gb|EDT78148.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens NCTC
           8239]
          Length = 207

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL   G++++  V   +G WAR E   
Sbjct: 96  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEM-- 153

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
           F +   +++ Q+I+   +A F  +SI +  L
Sbjct: 154 FDTWLGFNYDQLINWFEKAGFKNISIKNTGL 184


>gi|320102021|ref|YP_004177612.1| type 11 methyltransferase [Isosphaera pallida ATCC 43644]
 gi|319749303|gb|ADV61063.1| Methyltransferase type 11 [Isosphaera pallida ATCC 43644]
          Length = 539

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            S  A      LPL D++ D ++    LE  ED    L E  RVL  GG +++ VP  R 
Sbjct: 374 LSELARGDATKLPLGDATADALVATDILEHLEDDRAALIEWKRVLKPGGHLVLTVPAYRF 433

Query: 138 MWARMEH-TPFGSGQPYSWYQMISLLREANF--TLSITSRSLFFP 179
           +W   EH       + Y   ++++  REA F  T S  + SL  P
Sbjct: 434 LWG--EHDVALMHHRRYVASELLARAREAGFEVTRSTYAFSLLLP 476


>gi|168213308|ref|ZP_02638933.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens CPE
           str. F4969]
 gi|170715160|gb|EDT27342.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens CPE
           str. F4969]
          Length = 207

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL   G++++  V   +G WAR E   
Sbjct: 96  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEM-- 153

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
           F +   +++ Q+I+   +A F  +SI +  L
Sbjct: 154 FDTWLGFNYDQLINWFEKAGFKNISIKNTGL 184


>gi|110802464|ref|YP_697501.1| UbiE/COQ5 family methlytransferase [Clostridium perfringens SM101]
 gi|110682965|gb|ABG86335.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens SM101]
          Length = 207

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL   G++++  V   +G WAR E   
Sbjct: 96  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEM-- 153

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
           F +   +++ Q+I+   +A F  +SI +  L
Sbjct: 154 FDTWLGFNYDQLINWFEKAGFKNISIKNTGL 184


>gi|18309157|ref|NP_561091.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens str.
           13]
 gi|18143832|dbj|BAB79881.1| hypothetical protein [Clostridium perfringens str. 13]
          Length = 191

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL   G++++  V   +G WAR E   
Sbjct: 80  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEM-- 137

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
           F +   +++ Q+I+   +A F  +SI +  L
Sbjct: 138 FDTWLGFNYDQLINWFEKAGFKNISIKNTGL 168


>gi|327480858|gb|AEA84168.1| SAM-dependent methyltransferase [Pseudomonas stutzeri DSM 4166]
          Length = 256

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 65/160 (40%), Gaps = 11/160 (6%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
            E   PL + + D V++ H L+F+  P  +L E  R +  GG +++V  N    W  + H
Sbjct: 86  EEQAWPLGEHAADVVVLQHALDFSLSPHGLLREAARGVRPGGHLLIVGINPWSAWG-LRH 144

Query: 145 TPFGSG-------QPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
                G       +P      ++LL    F L       + PP          S  E IG
Sbjct: 145 LVSREGFRQARCIRPSRVGDWLNLL---GFALEKRRFGCYCPPLSSSDWQARLSRLESIG 201

Query: 198 NIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                   G Y++ ARK++    P+ + +++ +   + +P
Sbjct: 202 QQLQAPTGGFYLLVARKLMIGLRPLRQERRERMGKLLPMP 241


>gi|255535474|ref|YP_003095845.1| Glycosyltransferase [Flavobacteriaceae bacterium 3519-10]
 gi|255341670|gb|ACU07783.1| Glycosyltransferase [Flavobacteriaceae bacterium 3519-10]
          Length = 254

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 12/109 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME---- 143
           +LP  D S D V   H LE  ED    + E++RV+  GG  I  VP K  +    E    
Sbjct: 131 DLPFEDESFDIVFCNHVLEHIEDDRKAMSELFRVMKKGGWGIFQVPMKNSLEKTYEDFSI 190

Query: 144 ------HTPFGSGQPYSWY--QMISLLREANFTLSITSRSLFFPPTHKK 184
                    FG      WY     S L+EA F  +I   S  F    ++
Sbjct: 191 KDPKERQKHFGQYDHVRWYGTDYFSRLKEAGFQCNINYYSKQFSDEERR 239


>gi|254413024|ref|ZP_05026796.1| Methyltransferase domain family [Microcoleus chthonoplastes PCC
           7420]
 gi|196180188|gb|EDX75180.1| Methyltransferase domain family [Microcoleus chthonoplastes PCC
           7420]
          Length = 293

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 39  RLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVS-EGNLPLADSSVD 97
           +LL +G +  +   F  K E  +  +    GA  + +  F   A+ S      ++D SVD
Sbjct: 94  KLLEIGSSFGYLLNFFKKDEWHVMGVEPNLGACKYAESNFGIKAIPSILEKAEISDKSVD 153

Query: 98  CVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            VLM+H +E   +P +   E++R+L  GG  +V  P
Sbjct: 154 VVLMMHVIEHLPNPSMTFKEVYRLLKPGGIFVVETP 189


>gi|163752242|ref|ZP_02159443.1| hypothetical protein KT99_11388 [Shewanella benthica KT99]
 gi|161327872|gb|EDP99051.1| hypothetical protein KT99_11388 [Shewanella benthica KT99]
          Length = 239

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    ++ + L++ W  V G  +L LG            + R  +    G GAT     
Sbjct: 15  GENIKASVEQELASWWPRVFGYHMLSLGPLSAELKMPGLPIGRQFSLF-DGDGAT----- 68

Query: 77  YFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                 L +E N LP+ +  +D V+M   LEF  DP+ +L E  RVL SGG + +V
Sbjct: 69  ------LRAEFNALPIQNGVIDAVVMNMLLEFEYDPYKLLRETDRVLISGGYLFIV 118


>gi|241759762|ref|ZP_04757862.1| methyl-transferase [Neisseria flavescens SK114]
 gi|241319770|gb|EER56166.1| methyl-transferase [Neisseria flavescens SK114]
          Length = 219

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 7/135 (5%)

Query: 95  SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-----RMEHTPFGS 149
           SVD +LM H LE +    L+L E +R+L   GR+I+   N + +W        +  P  S
Sbjct: 68  SVDVLLMPHLLEISSAD-LVLQEAFRILKPEGRLILTGFNPKSLWGLSSWFDGKRLPMKS 126

Query: 150 GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYV 209
            Q  +  ++   + +  F +       + P  +    LK W   EK G+ + P  A +Y 
Sbjct: 127 -QCLALAELKRRIADIGFEMEYGQFMDYLPAVNSPSALKFWRFMEKAGDRWWPQCAAVYG 185

Query: 210 IEARKILYQGLPITE 224
           +   K L    P+ E
Sbjct: 186 VVLTKHLIGVHPLPE 200


>gi|146282601|ref|YP_001172754.1| SAM-dependent methyltransferase [Pseudomonas stutzeri A1501]
 gi|145570806|gb|ABP79912.1| SAM-dependent methyltransferase [Pseudomonas stutzeri A1501]
          Length = 256

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 64/155 (41%), Gaps = 11/155 (7%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS 149
           PL + + D V++ H L+F+  P  +L E  R +  GG +++V  N    W  + H     
Sbjct: 91  PLGEHAADVVVLQHALDFSLSPHGLLREAARGVRPGGHLLIVGINPWSAWG-LRHLVSRE 149

Query: 150 G-------QPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           G       +P      ++LL    F L       + PP          S  E IG     
Sbjct: 150 GFRQARCIRPSRVGDWLNLL---GFALEKRRFGCYCPPLSSSDWQARLSRLESIGQRLQA 206

Query: 203 GFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
              G Y++ ARK++    P+ + +++ +   + +P
Sbjct: 207 PTGGFYLLVARKLMIGLRPLRQERRERMGKLLPMP 241


>gi|168205663|ref|ZP_02631668.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens E str.
           JGS1987]
 gi|170662844|gb|EDT15527.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens E str.
           JGS1987]
          Length = 207

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL   G++++  V   +G WAR E   
Sbjct: 96  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWAREEM-- 153

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
           F +   +++ Q+I+   +A F  +SI +  L
Sbjct: 154 FDTWLGFNYDQLINWFEKAGFKNISIKNTGL 184


>gi|78485272|ref|YP_391197.1| hypothetical protein Tcr_0927 [Thiomicrospira crunogena XCL-2]
 gi|78363558|gb|ABB41523.1| hypothetical protein Tcr_0927 [Thiomicrospira crunogena XCL-2]
          Length = 261

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 66/146 (45%), Gaps = 16/146 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPL   S+D V++ H LE   DP+ +L ++  VL + G +++   N  G   R+    FG
Sbjct: 85  LPLKSDSIDVVVLPHTLEAVTDPYHILRQVDDVLIAEGNVLITGFNPAG--CRIMRNLFG 142

Query: 149 SGQPYSWYQMISLLREANFT--LSITSRSL-FFPPTHKKCIL------KLWS---VFEKI 196
             +PY  ++  +L+R       L++    +     T   C++      K W+    FE++
Sbjct: 143 EHRPY--FKKANLIRAHRIIDWLNVLGYDIEMVSYTSPSCLMKSDSSEKRWAWVESFERL 200

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPI 222
               G  F   Y I A+K +    P+
Sbjct: 201 LEKMGLNFGNTYCILAKKRVSSPTPV 226


>gi|87308492|ref|ZP_01090633.1| SAM-dependent methyltransferase UbiE/COQ5 family protein
           [Blastopirellula marina DSM 3645]
 gi|87289049|gb|EAQ80942.1| SAM-dependent methyltransferase UbiE/COQ5 family protein
           [Blastopirellula marina DSM 3645]
          Length = 294

 Score = 45.4 bits (106), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           +PL D+SVDCV+    +  A+D   +  EI RVL SGGR+ V
Sbjct: 131 MPLDDNSVDCVISNCVINLADDKGAVFQEIARVLKSGGRVAV 172


>gi|242278347|ref|YP_002990476.1| methyltransferase type 12 [Desulfovibrio salexigens DSM 2638]
 gi|242121241|gb|ACS78937.1| Methyltransferase type 12 [Desulfovibrio salexigens DSM 2638]
          Length = 292

 Score = 45.4 bits (106), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 8/106 (7%)

Query: 92  ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ 151
            D   DC++M   LE  E+P  +L     +L  GG + + VPN  G    M H+    G 
Sbjct: 166 CDKKFDCLVMCDVLEHLENPVAILRSCQSLLNPGGILFIQVPNLTGFRLPMGHS---WGL 222

Query: 152 PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
           P+  +Q        N   SI  ++ FFP  ++  IL +   +E  G
Sbjct: 223 PHHIWQF-----NPNSLKSILQKAGFFPQEYQTGILGVIGSYENGG 263


>gi|182415782|ref|YP_001820848.1| methyltransferase type 11 [Opitutus terrae PB90-1]
 gi|177842996|gb|ACB77248.1| Methyltransferase type 11 [Opitutus terrae PB90-1]
          Length = 284

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
            NLP  D+S+  V+  H LE   +P     E +RVL  GG + VVVP++R  W
Sbjct: 59  ANLPFRDNSLAYVVSSHVLEHTANPVAAFAEWYRVLRPGGIIYVVVPDRRYTW 111


>gi|331035479|gb|AEC53036.1| glycosyl transferase [Synechococcus phage S-CRM01]
          Length = 417

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 5/89 (5%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP--NKRGMWARMEHTP 146
           +PL D+SV  +   H LE  +DP   + EI RVL  GG   + VP  + RG W    H  
Sbjct: 287 IPLEDNSVGVLNASHVLEHLKDPIKSMREIHRVLHHGGWAFIEVPSTDGRGAWQDPTHVS 346

Query: 147 FGSGQPYSWY---QMISLLREANFTLSIT 172
           F +   + +Y   Q    +R  +    + 
Sbjct: 347 FWNQNSFWYYTQKQQADFIRNTDIRFMVN 375


>gi|254448766|ref|ZP_05062223.1| methyltransferase type 11, putative [gamma proteobacterium
           HTCC5015]
 gi|198261607|gb|EDY85895.1| methyltransferase type 11, putative [gamma proteobacterium
           HTCC5015]
          Length = 240

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM------- 142
           PL   S+D + +++ L+ A +P  +LH   + L   G +++V  N   +W  +       
Sbjct: 73  PLPGGSLDSLTLMYSLDVAREPHRVLHMADQWLAGSGYLVIVGFNPYSLWGLLRWVMRWF 132

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           + TP+ +G  YS +++   L+  N+ +   +     PP  +    +L   +E+  +   P
Sbjct: 133 QTTPWKAGF-YSVHRIRDWLKVLNYDIHYHTSFGHTPPLERVYQSRLCRPYERFMSWLLP 191

Query: 203 GFAGIYVIEARKILYQGLPITESKKKHISSPI 234
               + +I A++ LY   P T  +  H+  P+
Sbjct: 192 RMGAVNIIVAKRPLYPMTP-TRQRLTHLEKPV 222


>gi|83312119|ref|YP_422383.1| hypothetical protein amb3020 [Magnetospirillum magneticum AMB-1]
 gi|82946960|dbj|BAE51824.1| hypothetical protein [Magnetospirillum magneticum AMB-1]
          Length = 216

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           LP  D+SVD  L+ H +E   DP  ++ E+WR+   G +M + VP+
Sbjct: 66  LPFEDNSVDEFLLSHLIEHIPDPLPLMQELWRIARPGAKMQIRVPH 111


>gi|290509927|ref|ZP_06549297.1| methyltransferase [Klebsiella sp. 1_1_55]
 gi|289776643|gb|EFD84641.1| methyltransferase [Klebsiella sp. 1_1_55]
          Length = 240

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N   +    +  PF
Sbjct: 83  HLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFNPVSLMGLRKLVPF 142

Query: 148 -GSGQPYSWYQMISLLREANF 167
             +G PY+  +M +L+R+ ++
Sbjct: 143 LRNGTPYN-SRMFTLMRQLDW 162


>gi|261346346|ref|ZP_05973990.1| SAM-dependent methyltransferase [Providencia rustigianii DSM 4541]
 gi|282565660|gb|EFB71195.1| SAM-dependent methyltransferase [Providencia rustigianii DSM 4541]
          Length = 241

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 81/207 (39%), Gaps = 17/207 (8%)

Query: 16  LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPD 75
            G+    A+   L+  W  + G  LL LG+          +++     +P         D
Sbjct: 21  FGEHYRQALDIQLAPWWQKIFGFHLLKLGH-------LSTEIQTKQCMIPHQFSLGE--D 71

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
                 A   E  LP AD ++D  +M H L ++ +P  +L E+ RVL   G +I+   N 
Sbjct: 72  SNIFDVAAAPEA-LPFADKTIDACVMSHMLAYSNNPHWILREVDRVLIDDGWLIISGFNP 130

Query: 136 RGMWARMEHTP-FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
             +    +  P     QPY   +    LR  ++   +    L+    H+ C +  W   +
Sbjct: 131 FSLAGMAKLVPILRKQQPYC-SRFFPSLRVFDWLGLLNYEVLY----HQNCQVIPWMSPD 185

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLP 221
           K  N  G G   I VI ARK  Y   P
Sbjct: 186 KRINKCG-GVGVISVIVARKRTYPLTP 211


>gi|254228410|ref|ZP_04921836.1| hypothetical protein VEx25_1492 [Vibrio sp. Ex25]
 gi|151938998|gb|EDN57830.1| hypothetical protein VEx25_1492 [Vibrio sp. Ex25]
          Length = 267

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N   +   
Sbjct: 96  VIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPLSLTGL 155

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +    R   FP    K    +W+  
Sbjct: 156 ASLLPW-RKHNLPW-SGRMFTSNRINDWLGLLNYQVIHCDRYALFP---MKRYRTMWTWL 210

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI 222
           E  +G+   P    +Y I ARK  Y   PI
Sbjct: 211 ENSLGDWASPA-GSLYYIVARKRTYPLKPI 239


>gi|149928048|ref|ZP_01916296.1| phospholipid methyltransferase [Limnobacter sp. MED105]
 gi|149823236|gb|EDM82472.1| phospholipid methyltransferase [Limnobacter sp. MED105]
          Length = 223

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 6/117 (5%)

Query: 19  CTTDAISKVLSTTWDDVTGCRL-LGLGYAIPFFSCFHGKVERTLAFMPAGQG---ATNWP 74
           C   AI++         TG  L +G+G  +        KVE+ +   PA Q    A    
Sbjct: 34  CGMKAINRQRQKVVPKATGLVLEIGIGTGLNMRHYDASKVEKIIGLDPAMQMHRLAKKRI 93

Query: 75  DQYFSSTALVS--EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           DQ   S  L+      +PL D+S+D ++M + L    +P   L E+ RVL  GG+++
Sbjct: 94  DQTGLSVELMGLPAEKIPLPDASIDTIVMTYTLCTIPEPLQALKEMRRVLKPGGKLL 150


>gi|206576287|ref|YP_002240304.1| putative methyltransferase [Klebsiella pneumoniae 342]
 gi|206565345|gb|ACI07121.1| putative methyltransferase [Klebsiella pneumoniae 342]
          Length = 242

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N   +    +  PF
Sbjct: 85  HLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFNPVSLMGLRKLVPF 144

Query: 148 -GSGQPYSWYQMISLLREANF 167
             +G PY+  +M +L+R+ ++
Sbjct: 145 LRNGTPYN-SRMFTLMRQLDW 164


>gi|153829946|ref|ZP_01982613.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|183179465|ref|ZP_02957676.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|148874581|gb|EDL72716.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|183012876|gb|EDT88176.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 243

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYVIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P F  +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-FGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|269140168|ref|YP_003296869.1| methyltransferase type 11 [Edwardsiella tarda EIB202]
 gi|267985829|gb|ACY85658.1| methyltransferase type 11 [Edwardsiella tarda EIB202]
 gi|304560001|gb|ADM42665.1| SAM-dependent methyltransferase [Edwardsiella tarda FL6-60]
          Length = 240

 Score = 45.1 bits (105), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 86/219 (39%), Gaps = 42/219 (19%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           A+   L+  W  + G  LL LG      +     +   ++  P G+              
Sbjct: 28  ALELRLTPWWPKLFGYHLLKLGALSTDLATDRCTISHQVSVAPEGE----------HLQV 77

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV------------ 130
           +    +LP A  SVD  L+ H L ++ DP  +L E+ RVL   G +I+            
Sbjct: 78  IADPAHLPFAAKSVDACLLAHTLGYSRDPHRVLREVDRVLVDDGWLIISGFSPLSLLGMG 137

Query: 131 -VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
            +VP  R         P+ S + +S  ++I  L   N+ +   SR     P H+ C+  L
Sbjct: 138 RLVPGLR------RRVPYNS-RMFSMGRLIDWLNLLNYEVLAASRFQVL-PWHQPCVSLL 189

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
              F        P    + +I ARK   + +P+T + ++
Sbjct: 190 SRHF--------PAMGCLMLIVARK---RTVPLTLTPQR 217


>gi|171058654|ref|YP_001791003.1| hypothetical protein Lcho_1971 [Leptothrix cholodnii SP-6]
 gi|170776099|gb|ACB34238.1| conserved hypothetical protein [Leptothrix cholodnii SP-6]
          Length = 273

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 65/160 (40%), Gaps = 13/160 (8%)

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
            GA  WP      + +     LP   +S+D V++ H LE A D    L E+ RVL   GR
Sbjct: 82  DGAAIWPPGPLPLSVMSDYETLPFPSASLDLVVLPHTLELAGDAHQTLREVERVLMPEGR 141

Query: 128 MIVVVPNKRGMWARMEHTP-------FGSGQPYSWYQMIS------LLREANFTLSITSR 174
           ++V+  N   +W   + +        +GSG   S  ++I        LR           
Sbjct: 142 VVVIGFNPASLWGAYQASADVAGRLGWGSGPVSSGTELIGWRRLRDWLRLLGLEFESGRF 201

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             + PP   +  L+  + F+  G+ + P     YV+ A K
Sbjct: 202 GCYRPPFATERWLERCAWFDDAGSRWWPVLGSAYVLVAVK 241


>gi|282163236|ref|YP_003355621.1| ABC transporter ATP binding protein [Methanocella paludicola SANAE]
 gi|282155550|dbj|BAI60638.1| ABC transporter ATP binding protein [Methanocella paludicola SANAE]
          Length = 572

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 55/137 (40%), Gaps = 24/137 (17%)

Query: 22  DAISKVLSTTWDDVTGCRL-----------LGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           DA+S+      D   G  L            GLG A+    C  G   +TLA +     A
Sbjct: 17  DAVSQKYDNAVDGTMGKNLRPTALEKLSQEAGLGRAVEL-GCGTGYFTKTLARVADSVVA 75

Query: 71  TNWPDQYFSST--ALVSEGNLPLA----------DSSVDCVLMVHYLEFAEDPFLMLHEI 118
           T++ +   +     L S GN+             D + D VLM   L +  DP   L E 
Sbjct: 76  TDFCEGMLARAMERLSSAGNITFQKEDCMKTSFPDDTFDTVLMALVLNYIPDPAAALAEA 135

Query: 119 WRVLTSGGRMIVVVPNK 135
            R+L  GGR+I+V P+ 
Sbjct: 136 RRILKPGGRLIIVNPDN 152


>gi|59801037|ref|YP_207749.1| hypothetical protein NGO0609 [Neisseria gonorrhoeae FA 1090]
 gi|194098868|ref|YP_002001932.1| hypothetical protein NGK_1307 [Neisseria gonorrhoeae NCCP11945]
 gi|239999154|ref|ZP_04719078.1| hypothetical protein Ngon3_06705 [Neisseria gonorrhoeae 35/02]
 gi|240013938|ref|ZP_04720851.1| hypothetical protein NgonD_04688 [Neisseria gonorrhoeae DGI18]
 gi|240016380|ref|ZP_04722920.1| hypothetical protein NgonFA_04284 [Neisseria gonorrhoeae FA6140]
 gi|240080499|ref|ZP_04725042.1| hypothetical protein NgonF_04182 [Neisseria gonorrhoeae FA19]
 gi|240113133|ref|ZP_04727623.1| hypothetical protein NgonM_06101 [Neisseria gonorrhoeae MS11]
 gi|240115889|ref|ZP_04729951.1| hypothetical protein NgonPID1_06539 [Neisseria gonorrhoeae PID18]
 gi|240118187|ref|ZP_04732249.1| hypothetical protein NgonPID_06966 [Neisseria gonorrhoeae PID1]
 gi|240121507|ref|ZP_04734469.1| hypothetical protein NgonPI_07018 [Neisseria gonorrhoeae PID24-1]
 gi|240123735|ref|ZP_04736691.1| hypothetical protein NgonP_07329 [Neisseria gonorrhoeae PID332]
 gi|240125926|ref|ZP_04738812.1| hypothetical protein NgonSK_06867 [Neisseria gonorrhoeae SK-92-679]
 gi|240128438|ref|ZP_04741099.1| hypothetical protein NgonS_07381 [Neisseria gonorrhoeae SK-93-1035]
 gi|254493928|ref|ZP_05107099.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260440296|ref|ZP_05794112.1| hypothetical protein NgonDG_04246 [Neisseria gonorrhoeae DGI2]
 gi|268594987|ref|ZP_06129154.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596633|ref|ZP_06130800.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599215|ref|ZP_06133382.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601562|ref|ZP_06135729.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268603901|ref|ZP_06138068.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682364|ref|ZP_06149226.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684522|ref|ZP_06151384.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686832|ref|ZP_06153694.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043589|ref|ZP_06569305.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398901|ref|ZP_06643066.1| hypothetical protein NGNG_00085 [Neisseria gonorrhoeae F62]
 gi|59717932|gb|AAW89337.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934158|gb|ACF29982.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512968|gb|EEH62313.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548376|gb|EEZ43794.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550421|gb|EEZ45440.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583346|gb|EEZ48022.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585693|gb|EEZ50369.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588032|gb|EEZ52708.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622648|gb|EEZ55048.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268624806|gb|EEZ57206.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627116|gb|EEZ59516.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012052|gb|EFE04041.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610315|gb|EFF39425.1| hypothetical protein NGNG_00085 [Neisseria gonorrhoeae F62]
 gi|317164442|gb|ADV07983.1| hypothetical protein NGTW08_1015 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 221

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 56/133 (42%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD   D +L+ H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVFADMLLLPHTLECGV-PSQILSEAHRILKPSGRLMLTGFNPYSLWGFCR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +A F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGVRLPEKRFCLPLP----ELKRQLADAGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|325968924|ref|YP_004245116.1| methyltransferase type 11 [Vulcanisaeta moutnovskia 768-28]
 gi|323708127|gb|ADY01614.1| Methyltransferase type 11 [Vulcanisaeta moutnovskia 768-28]
          Length = 216

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 71/156 (45%), Gaps = 12/156 (7%)

Query: 26  KVLSTTWDDVTGCRLL---GLGYAIPFFSCF-HGKVERTLAFMPAGQGATNWPDQYFSST 81
           K + T   +V    +L   GLG  I   S F  G+V   +   PA   A    D+     
Sbjct: 23  KHVDTAESEVKAVSMLVPKGLGIEIGVGSGFFAGRVGIPMGLEPAIAMAELARDRGIDVV 82

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV-VVP--NKRGM 138
             V E ++PL DSS D  ++V  + F +DP   L E+ R+L  GGR+I  +VP  +  G 
Sbjct: 83  VGVGE-SMPLRDSSFDYTVIVVTICFLDDPKKTLTEVHRILRPGGRLITCIVPRDSDHGR 141

Query: 139 W----ARMEHTPFGSGQPYSWYQMISLLREANFTLS 170
           +     R  H  + +   Y+  ++  +L    F++S
Sbjct: 142 YYMELGRKGHRFYRAAHFYTVNEIKRILEPLGFSVS 177


>gi|296167245|ref|ZP_06849650.1| methyltransferase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295897421|gb|EFG77022.1| methyltransferase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 248

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 27/45 (60%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           LPL D +VD V+    L+   DP   L E+ RVL  GGR+ V+VP
Sbjct: 151 LPLRDDTVDAVISTAVLQLVPDPAAALGEMARVLRPGGRLAVMVP 195


>gi|262276482|ref|ZP_06054291.1| SAM-dependent methyltransferase [Grimontia hollisae CIP 101886]
 gi|262220290|gb|EEY71606.1| SAM-dependent methyltransferase [Grimontia hollisae CIP 101886]
          Length = 262

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 69/156 (44%), Gaps = 14/156 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------- 140
           +LP  D + D  ++ + L++ +DP  +L EI RV+   G +I+   N   +         
Sbjct: 103 DLPFVDKAFDVCVLANQLDYTDDPHRLLREIDRVMIDDGYLILSGVNPSSLMGIGRLIPW 162

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT-HKKCILKLWSVFEKIGNI 199
           R    P+ +G+ ++  ++   L   N+ +  TS     P T H+ C   +W  FE   + 
Sbjct: 163 RKNKLPW-NGRMFTPLRIRDWLSLLNYEIVDTSCFGLLPATRHRTC--GVW--FENACSE 217

Query: 200 FGPGFAGIYVIEARKILYQGLPITES-KKKHISSPI 234
             P    +Y I ARK  Y   PI    K K   SP+
Sbjct: 218 LLPVIGSLYFIVARKRTYPLKPIKPKWKLKKQLSPV 253


>gi|167949087|ref|ZP_02536161.1| generic methyl-transferase [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 167

 Score = 45.1 bits (105), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 67/167 (40%), Gaps = 19/167 (11%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           EL+ +++   G+   +    ++      + G  ++ LG              R    +  
Sbjct: 4   ELQAWFARMPGQVLAEQEQALIEEWGSSLFGYHVVQLGAPAATMDLLATSPARHRILLSK 63

Query: 67  GQGATNWPDQYFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
             GA        +S AL+ +   LP A  SVD V++ H L+++ DP   L E+ R+L   
Sbjct: 64  EDGAGG------ASPALIGDCTRLPFATDSVDGVVLPHTLDYSTDPHQALREVERILIPE 117

Query: 126 GRMIVVVPNKRGMWA-------RMEHTP-----FGSGQPYSWYQMIS 160
           GR+++   N   +W        R    P     FG+G+   W  ++ 
Sbjct: 118 GRVLITGFNPWSLWGMWQLFRLRRRQPPWCGHFFGAGRIQDWLSLLG 164


>gi|256831037|ref|YP_003159765.1| type 11 methyltransferase [Desulfomicrobium baculatum DSM 4028]
 gi|256580213|gb|ACU91349.1| Methyltransferase type 11 [Desulfomicrobium baculatum DSM 4028]
          Length = 511

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           ++P+ D+S D VL+   LE  E+P L L E  RVL  GGRM ++ P
Sbjct: 355 SIPVPDASFDIVLLAEVLEHLENPELALQECARVLRPGGRMYILSP 400


>gi|325136199|gb|EGC58807.1| hypothetical protein NMBM0579_0933 [Neisseria meningitidis M0579]
          Length = 221

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 13/135 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGIPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSIGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIYVI 210
            G+ + P  A +Y +
Sbjct: 174 AGDRWWPQCAAVYAL 188


>gi|83592864|ref|YP_426616.1| ArsR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83575778|gb|ABC22329.1| transcriptional regulator, ArsR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 337

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 18/108 (16%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV--VVPNKRGMWARMEHT- 145
           LP A +S D +++   L FAEDP  ++ E  RVL  GGR+ +  + P++R    R EH  
Sbjct: 208 LPFAAASFDGIVIHQVLHFAEDPAAVIAEAARVLRPGGRLAIADLAPHQREEL-REEHNH 266

Query: 146 ---PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
               F +G+   W   + L+  A   L +  R L         +++LW
Sbjct: 267 RRLGFSAGEITGWCAGVGLV--ARDCLDLAGREL---------VVRLW 303


>gi|14521286|ref|NP_126761.1| methlytransferase [Pyrococcus abyssi GE5]
 gi|5458504|emb|CAB49992.1| Methlytransferase, putative [Pyrococcus abyssi GE5]
          Length = 311

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP  D+S++C+LMV  + F +DP   + E +RVL   G +I+   ++     R      
Sbjct: 88  DLPFPDNSLECILMVTTICFVDDPEKAIKEAYRVLKPNGHIIIGFIDRESKIGREYEKNK 147

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
                +     +S  ++++LL    F +    ++LF
Sbjct: 148 DKSVFYREANFFSTQEIVNLLERNGFKVEKIVQTLF 183


>gi|325204298|gb|ADY99751.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 221

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPSGRLMLTGFNPYSLWGFSC 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRRLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|269966275|ref|ZP_06180364.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269829190|gb|EEZ83435.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 267

 Score = 44.7 bits (104), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--- 138
           ++++G  LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N   +   
Sbjct: 96  VIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYVIITGFNPLSLTGL 155

Query: 139 -----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                W R  + P+ SG+ ++  ++   L   N+ +    R   FP    K    +W+  
Sbjct: 156 ASLLPW-RKHNLPW-SGRMFTSNRIKDWLGLLNYQVIHCDRYALFP---MKRYRTMWTWL 210

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI 222
           E  +G+   P    +Y I ARK  Y   PI
Sbjct: 211 ENSLGDWASPA-GSLYYIVARKRTYPLKPI 239


>gi|332662374|ref|YP_004445162.1| type 11 methyltransferase [Haliscomenobacter hydrossis DSM 1100]
 gi|332331188|gb|AEE48289.1| Methyltransferase type 11 [Haliscomenobacter hydrossis DSM 1100]
          Length = 256

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 13/100 (13%)

Query: 39  RLLGLGYA-IPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNL----PLAD 93
           +LL LG   +PF+  +  K+   +          +W +   ++  L    +L    PL D
Sbjct: 62  KLLDLGAGMVPFYGMYKDKISENVCI--------DWANSLHANPHLDVVADLNQPFPLPD 113

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            + D +L    LE   DPF  + E  RVL  GG ++++VP
Sbjct: 114 DTFDSILCSDVLEHIADPFAFMRETARVLKPGGDLMLMVP 153


>gi|121635009|ref|YP_975254.1| hypothetical protein NMC1233 [Neisseria meningitidis FAM18]
 gi|218768319|ref|YP_002342831.1| hypothetical protein NMA1506 [Neisseria meningitidis Z2491]
 gi|304387406|ref|ZP_07369597.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|120866715|emb|CAM10467.1| hypothetical protein NMC1233 [Neisseria meningitidis FAM18]
 gi|121052327|emb|CAM08657.1| hypothetical protein NMA1506 [Neisseria meningitidis Z2491]
 gi|304338499|gb|EFM04618.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|319410564|emb|CBY90932.1| putative methyltransferase [Neisseria meningitidis WUE 2594]
 gi|325132502|gb|EGC55195.1| hypothetical protein NMBM6190_0907 [Neisseria meningitidis M6190]
 gi|325138276|gb|EGC60845.1| hypothetical protein NMBES14902_1004 [Neisseria meningitidis
           ES14902]
          Length = 221

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPSGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|322418971|ref|YP_004198194.1| type 11 methyltransferase [Geobacter sp. M18]
 gi|320125358|gb|ADW12918.1| Methyltransferase type 11 [Geobacter sp. M18]
          Length = 273

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 45/106 (42%), Gaps = 18/106 (16%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM----- 142
            LP  D S D VL  H LE   +    L ++ RVL  GG ++V VPN+  + ARM     
Sbjct: 134 ELPFPDGSFDIVLCNHVLEHVHEYRRALDQLARVLHPGGLLVVGVPNEGCLLARMRNHVF 193

Query: 143 --------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
                   +H  F +GQ          L  + F L+   R  FF P
Sbjct: 194 QRSILRSTDHVNFFTGQALE-----GALLASGFRLAKLHREGFFLP 234


>gi|108797075|ref|YP_637272.1| methyltransferase type 11 [Mycobacterium sp. MCS]
 gi|119866160|ref|YP_936112.1| methyltransferase type 11 [Mycobacterium sp. KMS]
 gi|126432697|ref|YP_001068388.1| methyltransferase type 11 [Mycobacterium sp. JLS]
 gi|108767494|gb|ABG06216.1| Methyltransferase type 11 [Mycobacterium sp. MCS]
 gi|119692249|gb|ABL89322.1| Methyltransferase type 11 [Mycobacterium sp. KMS]
 gi|126232497|gb|ABN95897.1| Methyltransferase type 11 [Mycobacterium sp. JLS]
          Length = 235

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           LPL D SVD V+ V  L+   DP   + E+ RVL  G RM V+VP   G  AR+
Sbjct: 138 LPLRDESVDAVVSVAMLQLIPDPSAAMAEMVRVLRPGRRMAVMVPTA-GQMARL 190


>gi|117920811|ref|YP_870003.1| type 11 methyltransferase [Shewanella sp. ANA-3]
 gi|117613143|gb|ABK48597.1| Methyltransferase type 11 [Shewanella sp. ANA-3]
          Length = 244

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A+S  L+  W  V G  LL LG      S     V    +              
Sbjct: 19  GPALQQAVSDKLADWWPRVFGYHLLKLGPLSADLSSMASPVAHHFSLCSE---------- 68

Query: 77  YFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
              + +L+ +  +LPL +  +D VLM   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 69  --PNASLIGDFCHLPLQNGVIDAVLMSLLLEFEADPYRILRETDRVLIAGGYLFIV 122


>gi|325144562|gb|EGC66861.1| hypothetical protein NMBM01240013_0975 [Neisseria meningitidis
           M01-240013]
 gi|325205929|gb|ADZ01382.1| conserved hypothetical protein [Neisseria meningitidis M04-240196]
          Length = 221

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPSGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRRLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|325128406|gb|EGC51289.1| hypothetical protein NMXN1568_0859 [Neisseria meningitidis N1568]
          Length = 221

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPSGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|239908684|ref|YP_002955426.1| hypothetical protein DMR_40490 [Desulfovibrio magneticus RS-1]
 gi|239798551|dbj|BAH77540.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 666

 Score = 44.7 bits (104), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           ++PL D   DC +    LE   DP  +L EI RVL  GG +    P    +W  +   P 
Sbjct: 513 SIPLPDGGADCAMATEVLEHCPDPASVLREIRRVLVPGGTLFFTTP---FLWP-IHDAPH 568

Query: 148 GSGQPYSWYQMISLLREANFT 168
              + Y+ Y +  LL EA FT
Sbjct: 569 DHYR-YTPYALRRLLEEAEFT 588


>gi|283779303|ref|YP_003370058.1| methyltransferase type 11 [Pirellula staleyi DSM 6068]
 gi|283437756|gb|ADB16198.1| Methyltransferase type 11 [Pirellula staleyi DSM 6068]
          Length = 282

 Score = 44.7 bits (104), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 51/113 (45%), Gaps = 9/113 (7%)

Query: 35  VTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST---ALVSEGN--L 89
           V+G +LL +G A  FF        R   F   GQ  + W   +   T    +VS  +  L
Sbjct: 81  VSGGKLLDIGCAAGFFL----DEARKAGFSVVGQDVSRWARHFARDTLGLEVVSSVDEIL 136

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           P   +S  CV +   LE   DP  +LH++  +L  GG ++V    +  + AR+
Sbjct: 137 PAQRASFRCVTLFQLLEHDPDPRALLHKVHALLQPGGVLVVETWRRDSLIARL 189


>gi|294141158|ref|YP_003557136.1| hypothetical protein SVI_2387 [Shewanella violacea DSS12]
 gi|293327627|dbj|BAJ02358.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 246

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 92/218 (42%), Gaps = 22/218 (10%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     ++ + L + W  V G  +L LG      +     + R  +    G GA+   D 
Sbjct: 19  GAQIKASVEQELESWWPKVFGYHMLSLGPLSAELNMPGLPIGRQFSLF-DGDGASLRAD- 76

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK- 135
            F++        LP+ +  +D V+M   LEF  DP+ +L E  RVL SGG + +V  N  
Sbjct: 77  -FNA--------LPIQNGVIDAVVMNMLLEFEHDPYKLLRETDRVLISGGYLFIVGFNPL 127

Query: 136 ------RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 + +    +  P+  G+ ++  ++   L    + +    R +     H    ++ 
Sbjct: 128 SPAFIGKALPKYQDKLPW-CGRFFTPSRVKDWLGLLGYQVVADERIIHH---HLLSEMRS 183

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
            S+++     + PG   +Y+I ARK+     PI E +K
Sbjct: 184 ESIWQNALKAWLPGTGSVYLIVARKLETPLTPIHERQK 221


>gi|302551176|ref|ZP_07303518.1| LOW QUALITY PROTEIN: glycosyl transferase [Streptomyces
           viridochromogenes DSM 40736]
 gi|302468794|gb|EFL31887.1| LOW QUALITY PROTEIN: glycosyl transferase [Streptomyces
           viridochromogenes DSM 40736]
          Length = 235

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           ++    ++ G LP AD S D VL    +E   DP   L EI R+L  GG +++  PN
Sbjct: 82  YAVRGELTGGGLPFADGSADAVLFSEVIEHLVDPDAALDEIRRILRPGGHLMLSTPN 138


>gi|119898347|ref|YP_933560.1| hypothetical protein azo2056 [Azoarcus sp. BH72]
 gi|119670760|emb|CAL94673.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 254

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 62/141 (43%), Gaps = 7/141 (4%)

Query: 81  TALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
            A+VS  + LP A +S+D V++ H LEFA  P  +L E+ RVL   G +++   N   +W
Sbjct: 76  VAVVSRSDELPFATASLDLVVLPHVLEFARRPHHVLREVERVLVPEGSVVITGFNPFSLW 135

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS------LFFPPTHKKCILKLWSVF 193
                    +G+     Q +S LR  ++   +   S       + P   +   ++ W   
Sbjct: 136 GLRRLAARRNGELPWQGQYLSALRVKDWLTLLGFESQGAGFGCYIPAVSRPEWIERWRFM 195

Query: 194 EKIGNIFGPGFAGIYVIEARK 214
           ++ G  + P     Y ++  K
Sbjct: 196 DRAGVRWWPVCGAAYAMQGIK 216


>gi|254512832|ref|ZP_05124898.1| Methyltransferase domain family protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221532831|gb|EEE35826.1| Methyltransferase domain family protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 199

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM- 142
           +S   LP AD S+D V+  H LE   DP   L E  RV+ +GG +  ++P+  G   R+ 
Sbjct: 74  LSGATLPFADDSIDRVIATHVLEHILDPVTALTEWVRVIRTGGVLSPILPSDPGFAWRIG 133

Query: 143 -----EHTPFGSGQPYSWYQMIS 160
                    + +G PY +Y  + 
Sbjct: 134 RLFGPRKRGYAAGLPYDYYMSVE 156


>gi|148242271|ref|YP_001227428.1| SAM-dependent methyltransferase [Synechococcus sp. RCC307]
 gi|147850581|emb|CAK28075.1| Possible SAM-dependent methyltransferase [Synechococcus sp. RCC307]
          Length = 214

 Score = 44.3 bits (103), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           L  +  LPL D+SVD  L+V   ++ + P  + HE+WRVL    ++IV   N+
Sbjct: 96  LNRDQQLPLEDASVDACLIVAGWQYLQQPEAVAHELWRVLRPDSQLIVAFSNR 148


>gi|239939458|ref|ZP_04691395.1| putative methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|239985946|ref|ZP_04706610.1| putative methyltransferase [Streptomyces roseosporus NRRL 11379]
 gi|291442888|ref|ZP_06582278.1| ubiE/COQ5 methyltransferase family protein [Streptomyces
           roseosporus NRRL 15998]
 gi|291345835|gb|EFE72739.1| ubiE/COQ5 methyltransferase family protein [Streptomyces
           roseosporus NRRL 15998]
          Length = 241

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +  G LPLAD   D VL    LE   DP   L E+ RVL  GG +++  PN
Sbjct: 95  LEHGGLPLADGCADAVLFSEILEHLVDPDQALDELRRVLRPGGHLMLSTPN 145


>gi|119719939|ref|YP_920434.1| methyltransferase type 11 [Thermofilum pendens Hrk 5]
 gi|119525059|gb|ABL78431.1| Methyltransferase type 11 [Thermofilum pendens Hrk 5]
          Length = 222

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 43/101 (42%), Gaps = 9/101 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           N PL   S D   MV  LEF EDP L L  IW  L SGG + V+   +   W ++     
Sbjct: 95  NAPLR-PSFDFAYMVTVLEFLEDPALSLTRIWEALKSGGLLAVLYVERDSKWGKLYSELA 153

Query: 148 GSGQP--------YSWYQMISLLREANFTLSITSRSLFFPP 180
             G          YS  ++  LL  A F +    +SL + P
Sbjct: 154 EKGADPVLARARFYSQPEVDKLLSAAGFEVREHLKSLDYEP 194


>gi|167037059|ref|YP_001664637.1| type 11 methyltransferase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039773|ref|YP_001662758.1| type 11 methyltransferase [Thermoanaerobacter sp. X514]
 gi|256752098|ref|ZP_05492965.1| Methyltransferase type 11 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914983|ref|ZP_07132298.1| Methyltransferase type 11 [Thermoanaerobacter sp. X561]
 gi|307724903|ref|YP_003904654.1| type 11 methyltransferase [Thermoanaerobacter sp. X513]
 gi|320115474|ref|YP_004185633.1| type 11 methyltransferase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166854013|gb|ABY92422.1| Methyltransferase type 11 [Thermoanaerobacter sp. X514]
 gi|166855893|gb|ABY94301.1| Methyltransferase type 11 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256749007|gb|EEU62044.1| Methyltransferase type 11 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888707|gb|EFK83854.1| Methyltransferase type 11 [Thermoanaerobacter sp. X561]
 gi|307581964|gb|ADN55363.1| Methyltransferase type 11 [Thermoanaerobacter sp. X513]
 gi|319928565|gb|ADV79250.1| Methyltransferase type 11 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 209

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 15/133 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           NLP  D+S D VLMV  + F +D      E +RVL + G +++   ++     ++     
Sbjct: 86  NLPFEDNSFDLVLMVTTVCFVDDVLKSFKECFRVLKNNGTILIGFVDRESTIGKIYQANK 145

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
                +     YS  +++ LL EA F     S+++F          KL  + EK    +G
Sbjct: 146 EKSLFYKEATFYSTSEIVELLYEAGFKNFNFSQTIF---------KKLDEIKEKEPVRYG 196

Query: 202 PGFAGIYVIEARK 214
            G     VI A+K
Sbjct: 197 FGKGSFIVISAKK 209


>gi|114326963|ref|YP_744120.1| SAM-dependent methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315137|gb|ABI61197.1| SAM-dependent methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 261

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV----VPNKRGMWARM 142
           G+LP  D S DCV   + L    DP  +L E+ RV   GGR++V+     P  +  + RM
Sbjct: 111 GSLPFEDGSFDCVTTRYSLHHMTDPGRILAEMKRVCCEGGRVVVIDATPAPESQTAYDRM 170

Query: 143 E 143
           E
Sbjct: 171 E 171


>gi|120554455|ref|YP_958806.1| methyltransferase type 11 [Marinobacter aquaeolei VT8]
 gi|120324304|gb|ABM18619.1| Methyltransferase type 11 [Marinobacter aquaeolei VT8]
          Length = 269

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 10/127 (7%)

Query: 16  LGKCTTDAISKVLSTTWDDVTGCRLL--GLGYAIPFFSCFHGKVERTLAFMPAGQGATNW 73
           LG+    +   VL      +TG R L  GL + +P  S       + +   PA      W
Sbjct: 24  LGRSLLASQRAVLDKELQGLTGARQLQVGLSHRLPLASGT--DFAQKIITCPA------W 75

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
                   A+     LP    S+D V++ H  +F+ DP  +L E  RVL   GR+ +V  
Sbjct: 76  HAHMPEGVAVCDADELPFPGDSMDLVILHHTADFSPDPHQVLRESARVLRGEGRIALVGF 135

Query: 134 NKRGMWA 140
           N   +W 
Sbjct: 136 NPLSLWG 142


>gi|57640639|ref|YP_183117.1| SAM-dependent methyltransferase [Thermococcus kodakarensis KOD1]
 gi|57158963|dbj|BAD84893.1| SAM-dependent methyltransferase, UbiE/COQ5 family [Thermococcus
           kodakarensis KOD1]
          Length = 209

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM--EHT 145
           NLP  + S+D +LMV  + F +DP   L E +RVL  GG +I+   ++     R   EH 
Sbjct: 86  NLPFEEDSMDYLLMVTTICFVDDPEKALKEAYRVLKPGGALIIGFVDRNSPIGRFYEEHK 145

Query: 146 P----FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
                +   + +S  +++ LL++  F      ++LF
Sbjct: 146 NESVFYKEARFFSTEELLELLKKVGFREFEIVQTLF 181


>gi|238750482|ref|ZP_04611983.1| hypothetical protein yrohd0001_21950 [Yersinia rohdei ATCC 43380]
 gi|238711413|gb|EEQ03630.1| hypothetical protein yrohd0001_21950 [Yersinia rohdei ATCC 43380]
          Length = 239

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +          N  +Q
Sbjct: 22  GEYYRSAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQV----------NVGEQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 72  GKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125


>gi|182440257|ref|YP_001827976.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468773|dbj|BAG23293.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 241

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +  G LPLAD   D VL    LE   DP   L E+ RVL  GG +++  PN
Sbjct: 95  LEHGGLPLADGCADAVLFSEILEHLVDPDQALDELRRVLRPGGHLMLSTPN 145


>gi|326391285|ref|ZP_08212826.1| Methyltransferase type 11 [Thermoanaerobacter ethanolicus JW 200]
 gi|325992680|gb|EGD51131.1| Methyltransferase type 11 [Thermoanaerobacter ethanolicus JW 200]
          Length = 209

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 15/133 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           NLP  D+S D VLMV  + F +D      E +RVL + G +++   ++     ++     
Sbjct: 86  NLPFEDNSFDLVLMVTTVCFVDDVLKSFKECFRVLKNSGTILIGFVDRESTIGKIYQANK 145

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
                +     YS  +++ LL EA F     S+++F          KL  + EK    +G
Sbjct: 146 EKSLFYKEATFYSTSEIVELLYEAGFKNFNFSQTIF---------KKLDEIKEKEPVRYG 196

Query: 202 PGFAGIYVIEARK 214
            G     VI A+K
Sbjct: 197 FGKGSFIVISAKK 209


>gi|326780919|ref|ZP_08240184.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
 gi|326661252|gb|EGE46098.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
          Length = 241

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +  G LPLAD   D VL    LE   DP   L E+ RVL  GG +++  PN
Sbjct: 95  LEHGGLPLADGCADAVLFSEILEHLVDPDQALDELRRVLRPGGHLMLSTPN 145


>gi|296120904|ref|YP_003628682.1| methyltransferase type 11 [Planctomyces limnophilus DSM 3776]
 gi|296013244|gb|ADG66483.1| Methyltransferase type 11 [Planctomyces limnophilus DSM 3776]
          Length = 228

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 13/103 (12%)

Query: 34  DVTGCR---LLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLP 90
           D++ C+   + G G+  P+   F G  E     +    G T+      S         +P
Sbjct: 34  DLSACKSVLICGAGHD-PYRHLFQGAQEYVCLDIEEVPGVTDVVADVLS---------MP 83

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
             D   DCV+    +E   DPF +  +I RVL  GGR+++ VP
Sbjct: 84  FEDGRFDCVVATECMEHIADPFTLCSQITRVLKPGGRVVLSVP 126


>gi|119775018|ref|YP_927758.1| hypothetical protein Sama_1883 [Shewanella amazonensis SB2B]
 gi|119767518|gb|ABM00089.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 240

 Score = 44.3 bits (103), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 43/109 (39%), Gaps = 11/109 (10%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           A+   L+  W  V G  LL +G            +   ++   A  G             
Sbjct: 20  AVENTLNAWWPKVFGYHLLKMGAFSSAIDTHRCSISHQISLDCAPGGGVQ---------- 69

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                 LP  ++ +D  LM   LEF EDP+ +L E  RVL SGG + +V
Sbjct: 70  -ADFHQLPFQNACIDAALMSLLLEFEEDPYRILRETDRVLISGGYLFIV 117


>gi|313158241|gb|EFR57643.1| methyltransferase domain protein [Alistipes sp. HGB5]
          Length = 257

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 28/46 (60%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            +PLAD SVD +L  H LE   D    LHE++R+L  GG  I++ P
Sbjct: 134 QIPLADDSVDVILCNHLLEHVADDRRALHELYRILKPGGWGILLSP 179


>gi|307293918|ref|ZP_07573762.1| Methyltransferase type 11 [Sphingobium chlorophenolicum L-1]
 gi|306880069|gb|EFN11286.1| Methyltransferase type 11 [Sphingobium chlorophenolicum L-1]
          Length = 302

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query: 50  FSCFHGKVERTLA-FMPAGQ--GAT--NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHY 104
           F C  G   R +   +P G   G+   + P +  +    +    L   +S+ D V+ +H 
Sbjct: 107 FGCGSGHFTRLIGDLLPDGDVIGSDFFDDPPKELTDRYYIPIAQLSSLESNFDVVIAMHV 166

Query: 105 LEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           LE  +D   +L  I R+++S GR+++ VPN   +WA++
Sbjct: 167 LEHDDDIATLLTRISRMVSSDGRLVIEVPNVDCLWAKL 204


>gi|33598344|ref|NP_885987.1| hypothetical protein BPP3835 [Bordetella parapertussis 12822]
 gi|33603254|ref|NP_890814.1| hypothetical protein BB4279 [Bordetella bronchiseptica RB50]
 gi|33566902|emb|CAE39118.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33577378|emb|CAE34643.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 256

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 58/146 (39%), Gaps = 7/146 (4%)

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           Q + +    +   LP    SVD +++ H  E AE P L+L E+ RVL   GR+++   N 
Sbjct: 76  QGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNP 135

Query: 136 RGMWARMEHTP-FGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILK 188
             +W      P   +  P      ++L R  +      F +       + P       L+
Sbjct: 136 WSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLR 195

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARK 214
            W   E+ G  +      +YV+ A K
Sbjct: 196 RWRFMERYGQRWWGLGGAVYVVTATK 221


>gi|121594112|ref|YP_986008.1| type 11 methyltransferase [Acidovorax sp. JS42]
 gi|120606192|gb|ABM41932.1| Methyltransferase type 11 [Acidovorax sp. JS42]
          Length = 259

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 93/240 (38%), Gaps = 20/240 (8%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV--E 58
           M  +I+ L  ++ +  G+       +       D+ G   L LG  +P            
Sbjct: 1   MTGEIIGLHHWFDTAPGRYLLAWEQERYDELVADIFGYHALQLG--MPGLQALRSNRMPH 58

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           R LA MP  +      D       L     LP A++S+D + + H LE + DP   L E+
Sbjct: 59  RWLAVMPP-ELLLERSDAQEPPALLADAVALPFAEASLDLLALPHTLELSVDPHTALREV 117

Query: 119 WRVLTSGGRMIVVVPNKRGMW------ARMEHTPFGSGQPY--------SWYQMISLLRE 164
            RVL   G++++   N   +W      +R+       G+ +        S  ++   LR 
Sbjct: 118 HRVLVPEGKVVISGLNPLSLWGLRQRRSRLYQRCGAGGRLFLPDVGEFISPGRLRDWLRL 177

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L   S   + P       L+ +   + +G  + P F   YVI A K + QG+ + E
Sbjct: 178 LGFELESMSFGCYRPAVAGDRWLQRYGWMDALGARWWPIFGAAYVIVAVKRV-QGMRLLE 236


>gi|33594119|ref|NP_881763.1| hypothetical protein BP3212 [Bordetella pertussis Tohama I]
 gi|33564193|emb|CAE43478.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332383535|gb|AEE68382.1| hypothetical protein BPTD_3172 [Bordetella pertussis CS]
          Length = 256

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 58/146 (39%), Gaps = 7/146 (4%)

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           Q + +    +   LP    SVD +++ H  E AE P L+L E+ RVL   GR+++   N 
Sbjct: 76  QGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNP 135

Query: 136 RGMWARMEHTP-FGSGQPYSWYQMISLLREAN------FTLSITSRSLFFPPTHKKCILK 188
             +W      P   +  P      ++L R  +      F +       + P       L+
Sbjct: 136 WSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLR 195

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARK 214
            W   E+ G  +      +YV+ A K
Sbjct: 196 RWRFMERYGQRWWGLGGAVYVVTATK 221


>gi|238799156|ref|ZP_04642609.1| hypothetical protein ymoll0001_39780 [Yersinia mollaretii ATCC
           43969]
 gi|238716997|gb|EEQ08860.1| hypothetical protein ymoll0001_39780 [Yersinia mollaretii ATCC
           43969]
          Length = 239

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +    +G+        
Sbjct: 22  GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQVNVGESGK-------- 73

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 74  --NMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125


>gi|15606491|ref|NP_213871.1| hypothetical protein aq_1270 [Aquifex aeolicus VF5]
 gi|2983718|gb|AAC07281.1| hypothetical protein aq_1270 [Aquifex aeolicus VF5]
          Length = 200

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
             AL    NLP    + D V +V  + F E+P  +L E  RVL   G++ + +  K   W
Sbjct: 64  KVALAKGENLPFKSETFDSVFLVVTICFVENPKQVLKEAHRVLKRDGKLYLGLILKESKW 123

Query: 140 ARMEHTPFGSGQP-------YSWYQMISLLRE 164
           A+       +G P       YS++++  ++++
Sbjct: 124 AKFYEEKAKNGHPFYKHARFYSFFELKEMVKD 155


>gi|118580353|ref|YP_901603.1| type 11 methyltransferase [Pelobacter propionicus DSM 2379]
 gi|118503063|gb|ABK99545.1| Methyltransferase type 11 [Pelobacter propionicus DSM 2379]
          Length = 213

 Score = 44.3 bits (103), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 22/134 (16%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM------ 142
           LP  D+S D  LMV  + F +D      E WR+L  GG +++   ++     R+      
Sbjct: 87  LPFDDNSFDFALMVTVVCFLDDVARAFREAWRILKLGGVLVIGFIDRGSELGRIYEQKKG 146

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP--PTHKKCILKLWSVFEKIGNIF 200
           + T +     YS  +++ +LRE  FT   + R    P  PT         ++ E  G+  
Sbjct: 147 QSTFYRDATFYSVSELVEVLRETGFT-DFSFRQTLLPGEPTDA-------TILEGFGD-- 196

Query: 201 GPGFAGIYVIEARK 214
                G  VI AR+
Sbjct: 197 ----GGFVVIRARR 206


>gi|239996321|ref|ZP_04716845.1| SAM-dependent methyltransferase [Alteromonas macleodii ATCC 27126]
          Length = 285

 Score = 44.3 bits (103), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 30/42 (71%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP A++S+D  L+ + L+FA+DP  +L E+ RV+T  G +I+
Sbjct: 120 LPFAENSIDGFLLANELDFAQDPHEILREVDRVITQNGYVII 161


>gi|261392422|emb|CAX49967.1| putative methyltransferase [Neisseria meningitidis 8013]
 gi|325142418|gb|EGC64822.1| hypothetical protein NMB9615945_0916 [Neisseria meningitidis
           961-5945]
          Length = 221

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|303244960|ref|ZP_07331284.1| Methyltransferase type 11 [Methanothermococcus okinawensis IH1]
 gi|302484671|gb|EFL47611.1| Methyltransferase type 11 [Methanothermococcus okinawensis IH1]
          Length = 210

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 49/122 (40%), Gaps = 10/122 (8%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
            NLP    S D VL ++ LE  +D    ++EI RVL + G  I VV N       +    
Sbjct: 77  SNLPFKTGSFDLVLCINVLEHIKDYKNAINEIKRVLKNNGTAIFVVVNSESF---INEDI 133

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW--SVFEKIGNIFGPGF 204
           F     Y     +       F L       F PP     ILK+   S+ EKI NIF  G 
Sbjct: 134 FNDFTIYHKPLCLKDFDIEGFYLKDYKTFYFIPP-----ILKILPTSILEKILNIFYKGL 188

Query: 205 AG 206
            G
Sbjct: 189 DG 190


>gi|74317682|ref|YP_315422.1| methyl-transferase [Thiobacillus denitrificans ATCC 25259]
 gi|74057177|gb|AAZ97617.1| methyl-transferase [Thiobacillus denitrificans ATCC 25259]
          Length = 245

 Score = 43.9 bits (102), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 8/133 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP    S+D +L+ H LEF+ +P  +L E  RVL   GR+++   N R +W  +     G
Sbjct: 75  LPFQSQSLDLLLLPHVLEFSANPHQVLREAERVLRPEGRLVLAGFNPRSLWG-LARIAQG 133

Query: 149 SGQPYSW---YQMISLLREANFTLSIT----SRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
             + Y W   +  IS +++    L +     S   + PP +++  L+     E  G+ + 
Sbjct: 134 GERGYPWNGNFLNISRVKDWMVLLGLEVAGGSMCCYRPPINRENWLRRLRFMEPAGDRWW 193

Query: 202 PGFAGIYVIEARK 214
               G+Y ++A K
Sbjct: 194 AMGGGVYFLQAVK 206


>gi|167903945|ref|ZP_02491150.1| glycosyl transferase, group 1 [Burkholderia pseudomallei NCTC
           13177]
          Length = 1741

 Score = 43.9 bits (102), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           S  N+PL D+SVD V+    +E  +    M+ EI RVL  GG +I+  PNK
Sbjct: 116 SAANIPLGDASVDLVVSFETIEHHDQHEAMIREIRRVLRPGGLVIISSPNK 166


>gi|91200947|emb|CAJ74003.1| hypothetical protein kuste3244 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 233

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 19/129 (14%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN--------------- 134
           P+  +  D + +  ++E   D   ++ E WR+L + G +I+  PN               
Sbjct: 97  PIKSNQFDVIFLGEFVEHILDTDFIMCESWRILKNNGSLILSTPNLVSLENRIRSIFGYH 156

Query: 135 KRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
            R M  R+     G  + Y+  ++I+ L+E  F + ++++++      KK  +KL   F 
Sbjct: 157 PRFMDFRLSENSIGHCRYYTITKLITQLKENGFEI-LSAKTINASLMTKKREIKLPGFFN 215

Query: 195 KIG---NIF 200
           KIG   NIF
Sbjct: 216 KIGLGTNIF 224


>gi|163853089|ref|YP_001641132.1| hypothetical protein Mext_3685 [Methylobacterium extorquens PA1]
 gi|163664694|gb|ABY32061.1| hypothetical protein Mext_3685 [Methylobacterium extorquens PA1]
          Length = 194

 Score = 43.9 bits (102), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 77  YFSSTALVSEGNLP------LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           YF  +A+   G +       ++D++ D V+  H +E  E+P   +    RVL  GGR I+
Sbjct: 14  YFGGSAVEKNGFIDAQTFSGVSDNAFDFVISAHVIEHLENPIGSIRNAIRVLRPGGRHIL 73

Query: 131 VVPNKRGMWAR 141
           VVP++R  + R
Sbjct: 74  VVPDRRHTFDR 84


>gi|114047732|ref|YP_738282.1| type 11 methyltransferase [Shewanella sp. MR-7]
 gi|113889174|gb|ABI43225.1| Methyltransferase type 11 [Shewanella sp. MR-7]
          Length = 240

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A++  L+  W  V G  LL LG      S     V    +              
Sbjct: 19  GPALQQAVADKLADWWPRVFGYHLLKLGPLSAELSSMASPVAHHFSLCSE---------- 68

Query: 77  YFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
              + +L+ +  +LPL +  +D VLM   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 69  --PNASLIGDFCHLPLQNGVIDAVLMSLLLEFEADPYRILRETDRVLIAGGYLFIV 122


>gi|15677163|ref|NP_274316.1| hypothetical protein NMB1296 [Neisseria meningitidis MC58]
 gi|7226537|gb|AAF41672.1| hypothetical protein NMB1296 [Neisseria meningitidis MC58]
 gi|316984087|gb|EFV63065.1| methyltransferase type 11 [Neisseria meningitidis H44/76]
 gi|325134461|gb|EGC57106.1| hypothetical protein NMBM13399_0904 [Neisseria meningitidis M13399]
 gi|325140478|gb|EGC62999.1| hypothetical protein NMBCU385_0870 [Neisseria meningitidis CU385]
 gi|325200077|gb|ADY95532.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
          Length = 221

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRRLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|291439824|ref|ZP_06579214.1| ubiE/COQ5 methyltransferase family protein [Streptomyces ghanaensis
           ATCC 14672]
 gi|291342719|gb|EFE69675.1| ubiE/COQ5 methyltransferase family protein [Streptomyces ghanaensis
           ATCC 14672]
          Length = 235

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           ++ G LP A +S D VL    LE   DP   L EI RVL  GG +++  PN
Sbjct: 89  LTGGGLPFASASADAVLFSEVLEHLVDPDAALDEIRRVLRPGGHLMLSTPN 139


>gi|238790135|ref|ZP_04633912.1| hypothetical protein yfred0001_34910 [Yersinia frederiksenii ATCC
           33641]
 gi|238721804|gb|EEQ13467.1| hypothetical protein yfred0001_34910 [Yersinia frederiksenii ATCC
           33641]
          Length = 239

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +          N  +Q
Sbjct: 22  GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQV----------NVGEQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 72  GKNMQVLASPYQLPFAEKSVDACLLSHTLAYASDPHRILREVDRVLIDDGWLVI 125


>gi|313125402|ref|YP_004035666.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Halogeometricum borinquense DSM 11551]
 gi|312291767|gb|ADQ66227.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Halogeometricum borinquense DSM 11551]
          Length = 262

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 85/199 (42%), Gaps = 41/199 (20%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGY-----------AIPF 49
           +  D  E RQ  + +  +   D   +++  T D   G R+L +G            A+  
Sbjct: 5   LEYDEKEARQEAAIYRTQAAADR-RELVRETLDLQRGDRVLSIGCGPGFEPAELAGAVGE 63

Query: 50  FSCFHGKVERTLAFMP-AGQGATNWPDQYFSSTALVSEGN---LPLADSSVDCVLMVHYL 105
               HG ++R+ A +  A Q   + P       A +S+GN   LP+AD S D  + V   
Sbjct: 64  SGYVHG-IDRSEAMLTLANQRCDDLP------QAALSKGNALDLPVADESFDAAVAVQVF 116

Query: 106 EFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM-W-----ARME--------HTPFGSGQ 151
           E+ +     ++E+ RVL  GGR +V   +   + W     ARME        H P+    
Sbjct: 117 EYLDRVDAAVNELARVLRPGGRAVVCDADFDSLVWRSPNPARMERVLDAFDDHCPW---- 172

Query: 152 PYSWYQMISLLREANFTLS 170
           P+   ++  LLR+A  T+ 
Sbjct: 173 PHLGSRLAPLLRDAGLTIE 191


>gi|78065466|ref|YP_368235.1| hypothetical protein Bcep18194_A3993 [Burkholderia sp. 383]
 gi|77966211|gb|ABB07591.1| hypothetical protein Bcep18194_A3993 [Burkholderia sp. 383]
          Length = 292

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDP-----------FLMLHEIWRVLTSGGRMIVVVPNKRG 137
           LP AD+SVD V+    +E   D            F  L E++RVL  GGR ++  PN   
Sbjct: 100 LPFADNSVDNVICTEVIEHISDISYRQATTLNGIFFFLDEVYRVLRVGGRALISTPNATS 159

Query: 138 MWA 140
           +WA
Sbjct: 160 LWA 162


>gi|318606884|emb|CBY28382.1| sam-dependent methyltransferase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 239

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +          N  +Q
Sbjct: 22  GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQV----------NVGEQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 72  GKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125


>gi|226305859|ref|YP_002765819.1| methyltransferase [Rhodococcus erythropolis PR4]
 gi|226184976|dbj|BAH33080.1| putative methyltransferase [Rhodococcus erythropolis PR4]
          Length = 282

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
             LPLAD+SVD V+    +E   D    L E +RVL  GG +++  PN R  ++    TP
Sbjct: 118 AELPLADNSVDVVVNFQVIEHLWDQGQFLRECFRVLAPGGELLISTPN-RITFSPGRDTP 176

Query: 147 FG--SGQPYSWYQMISLLREANFTLSI 171
                 +  +  +M  LL +A F + +
Sbjct: 177 LNPFHTRELNAAEMTELLEDAGFRVQL 203


>gi|238921064|ref|YP_002934579.1| hypothetical protein NT01EI_3195 [Edwardsiella ictaluri 93-146]
 gi|238870633|gb|ACR70344.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 234

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 84/219 (38%), Gaps = 42/219 (19%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           A+   L+  W  + G  LL LG      +     +   ++  P G+              
Sbjct: 22  ALELRLTPWWPKLFGYHLLKLGTLSTDLATDRCTISHQVSVAPEGEHLQ----------V 71

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV------------ 130
           +    +LP A  SVD  L+ H L ++ DP  +L E+ RVL   G +I+            
Sbjct: 72  IAEPAHLPFAAKSVDACLLAHTLGYSHDPHRVLREVDRVLVDDGWLIISGFSPLSLLGMG 131

Query: 131 -VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
            +VP  R         P+ S   +S  ++I  L   N+ +   SR     P H  C+  L
Sbjct: 132 KLVPGLR------RRLPYSSRM-FSMGRLIDWLNLLNYEVLAASRFQVL-PWHNPCVSLL 183

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
              F        P    + +I ARK   + +P+T + ++
Sbjct: 184 SRHF--------PAMGCLMLIVARK---RTVPLTLTPQR 211


>gi|113970497|ref|YP_734290.1| type 11 methyltransferase [Shewanella sp. MR-4]
 gi|113885181|gb|ABI39233.1| Methyltransferase type 11 [Shewanella sp. MR-4]
          Length = 244

 Score = 43.9 bits (102), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A++  L+  W  V G  LL LG      S     V    +              
Sbjct: 19  GPALQQAVADKLADWWPRVFGYHLLKLGPLSAELSSMASPVAHHFSLCSE---------- 68

Query: 77  YFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
              + +L+ +  +LPL +  +D VLM   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 69  --PNASLIGDFCHLPLQNGVIDAVLMSLLLEFEADPYRILRETDRVLIAGGYLFIV 122


>gi|319638533|ref|ZP_07993295.1| methyl-transferase [Neisseria mucosa C102]
 gi|317400282|gb|EFV80941.1| methyl-transferase [Neisseria mucosa C102]
          Length = 219

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 95  SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-----RMEHTPFGS 149
           SVD +LM H LE +    L+L E +R+L   GR+I+   N + +W        E  P  S
Sbjct: 68  SVDVLLMPHLLEVSSAD-LVLQEAFRILKPEGRLILTGFNPKSLWGLSSWFDGEKLPLKS 126

Query: 150 GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYV 209
               +  ++   + +  F +       + P  +    LK W   EK G+ + P  A +Y 
Sbjct: 127 -HCLALAKLKRKIADVGFEMEYGQFMDYLPAVNSLSALKFWRFMEKAGDRWWPQCAAVYG 185

Query: 210 IEARKILYQGLPITE 224
           +   K L    P+ E
Sbjct: 186 MVLTKHLIGVHPLPE 200


>gi|258621019|ref|ZP_05716053.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258627373|ref|ZP_05722157.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262166314|ref|ZP_06034051.1| SAM-dependent methyltransferase [Vibrio mimicus VM223]
 gi|258580411|gb|EEW05376.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258586407|gb|EEW11122.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|262026030|gb|EEY44698.1| SAM-dependent methyltransferase [Vibrio mimicus VM223]
          Length = 245

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 12/170 (7%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +IV   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYVIVTGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLGVLNYQVVECDQYALFPMQKYR---PFWTWL 191

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E         F  +Y I ARK      PI ++ + K   SP+ V + V++
Sbjct: 192 ENGIGESSTAFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGVNYRVNS 241


>gi|332162778|ref|YP_004299355.1| hypothetical protein YE105_C3158 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667008|gb|ADZ43652.1| hypothetical protein YE105_C3158 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 239

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +          N  +Q
Sbjct: 22  GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQV----------NVGEQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 72  GKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125


>gi|295696861|ref|YP_003590099.1| Methyltransferase type 11 [Bacillus tusciae DSM 2912]
 gi|295412463|gb|ADG06955.1| Methyltransferase type 11 [Bacillus tusciae DSM 2912]
          Length = 227

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           +LP    S D  L    LEF  DP   LHE +RV+  GGR++V    K G WA
Sbjct: 94  HLPFQPDSFDLALSNVTLEFVADPKAALHEAYRVVKPGGRLVVGFIAKLGPWA 146


>gi|239931449|ref|ZP_04688402.1| hypothetical protein SghaA1_24740 [Streptomyces ghanaensis ATCC
           14672]
          Length = 254

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           ++ G LP A +S D VL    LE   DP   L EI RVL  GG +++  PN
Sbjct: 108 LTGGGLPFASASADAVLFSEVLEHLVDPDAALDEIRRVLRPGGHLMLSTPN 158


>gi|307610220|emb|CBW99778.1| hypothetical protein LPW_15441 [Legionella pneumophila 130b]
          Length = 247

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 71  TNWPDQYFSSTALV----SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
           + W    FSST  +    S   LPL   ++DCV++   LE   + F ++ EI R+L   G
Sbjct: 64  SKWIASPFSSTNRIHLECSLNQLPLNRDTLDCVIVPLTLEPFGNNFSLIDEIDRILKPMG 123

Query: 127 RMIVVVPNKRGMWARMEH----TPFGSG--QPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +I +  N   +W           +G+   +  S + +  +  +  +     +   + PP
Sbjct: 124 FLIFLCINPWSLWGGAMKWGVLNCYGNRTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT-----ESKKKHISS 232
            + + ++K  + F++IG +  P  +G Y    +K  Y    +T     ES KK   S
Sbjct: 184 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEYISPSLTIEPSIESVKKEYDS 240


>gi|253988340|ref|YP_003039696.1| hypothetical protein PAU_00859 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779790|emb|CAQ82951.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 238

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 87/213 (40%), Gaps = 19/213 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A+ + L   W  + G  LL +G            +   +     G+      D 
Sbjct: 22  GEYYRAALERQLQPWWQKIFGFHLLKIGNLSAEIDSKECPIFNQINVGKEGKNMQVITDP 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           Y          +LP  +  VD  L+ H L +++DP  +L E+ RV+   G +I+   N  
Sbjct: 82  Y----------HLPFEEKCVDACLLSHMLAYSDDPHRLLREVDRVMIDDGWLIISGFNSL 131

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
            +    +  P     QPY    M SL+R+ ++ LS+ +  + +    +   +  W     
Sbjct: 132 SLLGLGKLVPGLWRYQPYC-SHMFSLMRQLDW-LSLLNYEVLYRGNFQ---VLPWRNETG 186

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
             N + P F  + +I ARK   + LP+T ++ K
Sbjct: 187 FFNRYFPVFGCVSLIIARK---RTLPLTLNQIK 216


>gi|161870170|ref|YP_001599340.1| hypothetical protein NMCC_1209 [Neisseria meningitidis 053442]
 gi|161595723|gb|ABX73383.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 205

 Score = 43.9 bits (102), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 43  MSAENMALADVSADMLLFPHTLE-GGIPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 101

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 102 WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSIGQIRFWRFMEK 157

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 158 AGDRWWPQCAAVY 170


>gi|33863287|ref|NP_894847.1| hypothetical protein PMT1016 [Prochlorococcus marinus str. MIT
           9313]
 gi|33640736|emb|CAE21191.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 215

 Score = 43.9 bits (102), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 21/130 (16%)

Query: 8   LRQFYSSFLGKCTT--DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           L Q Y   +  C+T  D +S  +S   DDV   R++G           HG  E+ L    
Sbjct: 40  LTQLYREKIPPCSTVLDLMSSWVSHLPDDVIYDRVIG-----------HGLNEKELV--- 85

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
               A N  D ++     +++  +PL D S+D  L++   ++ + P  M  E+ RV  S 
Sbjct: 86  ----ANNRLDSHWVQNFNLNQS-IPLKDESIDATLIIAGWQYLQQPEDMAEELLRVTRSK 140

Query: 126 GRMIVVVPNK 135
           G++IV   N+
Sbjct: 141 GQVIVAFSNR 150


>gi|254282360|ref|ZP_04957328.1| phosphatidylethanolamine N-methyltransferase [gamma proteobacterium
           NOR51-B]
 gi|219678563|gb|EED34912.1| phosphatidylethanolamine N-methyltransferase [gamma proteobacterium
           NOR51-B]
          Length = 173

 Score = 43.5 bits (101), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-RGMWAR 141
           L    NLPL D+  DCV   + L    DP  ++HE+ RV    G++I+V   K  G+W+ 
Sbjct: 62  LADAENLPLPDNHFDCVTAPYVLSVTPDPSALMHEMRRVCKPNGKIIIVNHFKGAGIWSF 121

Query: 142 MEH 144
            E 
Sbjct: 122 AEQ 124


>gi|317490806|ref|ZP_07949242.1| methyltransferase domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920353|gb|EFV41676.1| methyltransferase domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 240

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 88/220 (40%), Gaps = 26/220 (11%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A+ + L+  W  + G  LL +G      S     +   ++    G       D 
Sbjct: 22  GEYYRAALEQQLTPWWPKLFGYHLLKIGPLSSQISTEKCGISHQVSIGEKGDNMQVIADP 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           Y           LP +  SVD  L+ H L FA DP  ML E+ RVL   G +I+   N  
Sbjct: 82  Y----------RLPFSAKSVDACLLSHTLSFASDPHRMLREVDRVLIDDGWLILTGFNPT 131

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
            +    +  P      PYS  +M S++R  ++   +    L+      +C +  W+   +
Sbjct: 132 SLVGLGKLVPGLRKRLPYS-SRMFSMMRMLDWLQLLNYEVLY----EHRCQILPWN---R 183

Query: 196 IGNIF----GPGFAGIYVIEARKILYQGLPITESKKKHIS 231
            G +F     P    + +I ARK   + +P+T +  +  S
Sbjct: 184 RGGLFIGKHLPVLGCLSIIVARK---RTIPLTPTSLRERS 220


>gi|262170794|ref|ZP_06038472.1| SAM-dependent methyltransferase [Vibrio mimicus MB-451]
 gi|261891870|gb|EEY37856.1| SAM-dependent methyltransferase [Vibrio mimicus MB-451]
          Length = 245

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 12/170 (7%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +IV   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYVIVTGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLGVLNYQVVECDQYALFPMQKYR---PFWTWL 191

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E         F  +Y I ARK      PI ++ + K   SP+ V + V++
Sbjct: 192 ENGIGESSTAFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGVNYRVNS 241


>gi|16759248|ref|NP_454865.1| hypothetical protein STY0283 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142977|ref|NP_806319.1| hypothetical protein t2603 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213021401|ref|ZP_03335848.1| hypothetical protein Salmonelentericaenterica_00876 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213162308|ref|ZP_03348018.1| hypothetical protein Salmoneentericaenterica_20863 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213428415|ref|ZP_03361165.1| hypothetical protein SentesTyphi_24458 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580946|ref|ZP_03362772.1| hypothetical protein SentesTyph_06974 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612766|ref|ZP_03370592.1| hypothetical protein SentesTyp_09779 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213646367|ref|ZP_03376420.1| hypothetical protein SentesTy_02924 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852642|ref|ZP_03382174.1| hypothetical protein SentesT_07074 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828782|ref|ZP_06546541.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25359108|pir||AD0534 conserved hypothetical protein STY0283 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501539|emb|CAD08716.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138609|gb|AAO70179.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 240

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 71/159 (44%), Gaps = 18/159 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK------RGMWAR 141
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N       R +   
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVLV 142

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
           +  TP     PY+  +M +L+R+ ++   +    L +   H   +L       ++ N   
Sbjct: 143 LRKTP-----PYN-SRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHI 193

Query: 202 PGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           P    + +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 194 PALGCLQLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|293392717|ref|ZP_06637036.1| SAM-dependent methyltransferase [Serratia odorifera DSM 4582]
 gi|291424834|gb|EFE98044.1| SAM-dependent methyltransferase [Serratia odorifera DSM 4582]
          Length = 239

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            LP AD SVD  LM   L +A+DP  ML E+ R+L   G +++   N
Sbjct: 83  RLPFADKSVDACLMAQALSYADDPHRMLREVDRILIDDGWLVLSTFN 129


>gi|229493407|ref|ZP_04387196.1| methyltransferase type 11 [Rhodococcus erythropolis SK121]
 gi|229319723|gb|EEN85555.1| methyltransferase type 11 [Rhodococcus erythropolis SK121]
          Length = 277

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 3/85 (3%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPLAD+SVD V+    +E   D    L E +RVL  GG +++  PN R  ++    TP  
Sbjct: 120 LPLADNSVDVVVNFQVIEHLWDQGQFLRECFRVLAPGGELLISTPN-RITFSPGRDTPLN 178

Query: 149 --SGQPYSWYQMISLLREANFTLSI 171
               +  +  +M  LL +A F + +
Sbjct: 179 PFHTRELNASEMTELLEDAGFRVQL 203


>gi|123441271|ref|YP_001005258.1| hypothetical protein YE0920 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088232|emb|CAL11021.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 239

 Score = 43.5 bits (101), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +          N  +Q
Sbjct: 22  GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQV----------NVGEQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 72  GKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125


>gi|297526089|ref|YP_003668113.1| Methyltransferase type 11 [Staphylothermus hellenicus DSM 12710]
 gi|297255005|gb|ADI31214.1| Methyltransferase type 11 [Staphylothermus hellenicus DSM 12710]
          Length = 216

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 8/102 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP  D   D V++V  + F  DP  ML EI RVL   G ++  V  K   W    +    
Sbjct: 90  LPFIDGYFDTVIVVVTICFVNDPLKMLAEINRVLKKNGTLVTCVVPKDSSWGIYYNWLKN 149

Query: 149 SGQP--------YSWYQMISLLREANFTLSITSRSLFFPPTH 182
           SG+         Y+  ++  +L    F +  T  +L +PP +
Sbjct: 150 SGKSLFYRYARFYTIQELFYMLSITGFIVKDTCSTLSYPPGN 191


>gi|325198449|gb|ADY93905.1| conserved hypothetical protein [Neisseria meningitidis G2136]
          Length = 188

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 26  MSAENMALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSR 84

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 85  WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSLGQIRFWRFMEK 140

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 141 AGDRWWPQCAAVY 153


>gi|71737504|ref|YP_273948.1| hypothetical protein PSPPH_1711 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558057|gb|AAZ37268.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 253

 Score = 43.5 bits (101), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 63/159 (39%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  M
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWG-M 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H       G  +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDALGKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMP 241


>gi|161615577|ref|YP_001589542.1| hypothetical protein SPAB_03352 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364941|gb|ABX68709.1| hypothetical protein SPAB_03352 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 240

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 6/153 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP A  SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFAGKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 200 QLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 229


>gi|261380508|ref|ZP_05985081.1| methyl-transferase [Neisseria subflava NJ9703]
 gi|284796761|gb|EFC52108.1| methyl-transferase [Neisseria subflava NJ9703]
          Length = 219

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 7/141 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-----RME 143
           L     SVD +LM H LE +    L+L E +R+L   GR+I+   N + +W        +
Sbjct: 62  LAFETHSVDVLLMPHLLEISSAD-LVLQEAFRILKPEGRLILTGFNPKSLWGLSSWFDGK 120

Query: 144 HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPG 203
             P  S Q  +  ++   +    F +       + P  +    LK W   EK G+ + P 
Sbjct: 121 RLPTKS-QCLALAELKRKIAAIGFEMEYGQFMDYLPAVNSPSTLKFWRFMEKAGDRWWPQ 179

Query: 204 FAGIYVIEARKILYQGLPITE 224
            A +Y +   K L    P+ E
Sbjct: 180 CAAVYGVVLTKHLIGVHPLPE 200


>gi|238762658|ref|ZP_04623627.1| hypothetical protein ykris0001_8320 [Yersinia kristensenii ATCC
           33638]
 gi|238698963|gb|EEP91711.1| hypothetical protein ykris0001_8320 [Yersinia kristensenii ATCC
           33638]
          Length = 239

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 48/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +          N  +Q
Sbjct: 22  GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQV----------NVGEQ 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 72  GKNMQVLASPYQLPFAEKSVDACLLSHTLAYATDPHRILREVDRVLIDDGWLVI 125


>gi|119471756|ref|ZP_01614116.1| hypothetical protein ATW7_08896 [Alteromonadales bacterium TW-7]
 gi|119445379|gb|EAW26667.1| hypothetical protein ATW7_08896 [Alteromonadales bacterium TW-7]
          Length = 258

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 70/173 (40%), Gaps = 18/173 (10%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P  Y    A + E  LP  + SVD  ++ H LE+  DP  +L E  R L  GG +++   
Sbjct: 71  PGPYTGVVADIDE--LPFYEHSVDACILSHCLEYHSDPHHILREAHRTLIPGGYVLITGF 128

Query: 134 NKRGMWARMEHTPFGSGQPYSW-------YQMISLLREANFTLSITSRSLF--FPPTHKK 184
           N   +    +  PF SGQ   W        ++   L    F +    R ++      ++ 
Sbjct: 129 NPLSLCGLAQMLPF-SGQKLPWTGRFFTPARVKDWLNLLGFEIVSDERFIYSSLARGNRL 187

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
              + W  F K      P    +Y++ ARK +    P+T  K K  + P  VP
Sbjct: 188 SRFEFWRAFAK--QYLKP-MGSVYMLVARKRV---APLTPIKPKWHARPQFVP 234


>gi|197284135|ref|YP_002150007.1| hypothetical protein PMI0226 [Proteus mirabilis HI4320]
 gi|194681622|emb|CAR40648.1| conserved hypothetical protein [Proteus mirabilis HI4320]
          Length = 211

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
            + S   LP  + SVD  LM H L+++ DP  +L E  RVL   G +I+   N   +   
Sbjct: 51  VMASLNYLPFENKSVDVCLMAHVLDYSADPHWLLREADRVLVDDGWIILSSFNPISLLGI 110

Query: 142 MEHTP-FGSGQPYSWYQMISLLREANF 167
            + TP     QPY + +M SL R+ ++
Sbjct: 111 GKCTPILRHKQPY-YCRMFSLRRQVDW 136


>gi|218782924|ref|YP_002434242.1| methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01]
 gi|218764308|gb|ACL06774.1| Methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01]
          Length = 201

 Score = 43.5 bits (101), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 41/92 (44%), Gaps = 10/92 (10%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV-PNKRGMW--ARMEH 144
           NLP  D S  C+   +   F   P   L E +RVL  GGRM V+  P  RG W   RM  
Sbjct: 106 NLPWDDGSFTCLAAANVFFFLPRPDAALREFYRVLAPGGRMAVITHPAGRGRWIAERM-- 163

Query: 145 TPFGSGQPYSWYQMISLLREANFT-LSITSRS 175
                   Y+  QM  +  EA FT +  T+R 
Sbjct: 164 ----GMHLYTNEQMQDMALEAGFTQVECTTRK 191


>gi|253580785|ref|ZP_04858048.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847855|gb|EES75822.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 393

 Score = 43.5 bits (101), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 49/112 (43%), Gaps = 11/112 (9%)

Query: 37  GCRLLGLGYA-----IPFFSCFHGKVERTLAFMPAG-----QGATNWPDQYFSSTALVSE 86
           G R+L LG           S   GKV  TL+ + +G     + A    D  FS  A    
Sbjct: 178 GMRILELGCGDGVLWTQNISSLPGKVSVTLSDLSSGMLRDARRAIGRKDSRFSFEAFDC- 236

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
             +P  D S D V+  H L + ED   +  EI RVLT GG++I     K+ M
Sbjct: 237 ARIPHEDRSFDLVIANHVLFYCEDISAVCSEIQRVLTPGGKLICSTYGKKHM 288


>gi|289522449|ref|ZP_06439303.1| UbiE/COQ5 methyltransferase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289504285|gb|EFD25449.1| UbiE/COQ5 methyltransferase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 233

 Score = 43.5 bits (101), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           +LP  D + D  + +  LEF+ D    L EI+RVL  GGRM++ +      W+R
Sbjct: 99  DLPFEDETFDAAVSLSALEFSSDLKKTLSEIYRVLKPGGRMVIGLIGGGSAWSR 152


>gi|217420529|ref|ZP_03452034.1| glycosyltransferase, group 1 [Burkholderia pseudomallei 576]
 gi|217395941|gb|EEC35958.1| glycosyltransferase, group 1 [Burkholderia pseudomallei 576]
          Length = 1736

 Score = 43.5 bits (101), Expect = 0.027,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           S  N+PL D+SVD V+    +E  +    M+ EI RVL  GG +++  PNK
Sbjct: 111 SAANIPLGDASVDLVVSFETIEHHDQHEAMIREIRRVLRPGGLVVISSPNK 161


>gi|89094531|ref|ZP_01167470.1| generic methyl-transferase [Oceanospirillum sp. MED92]
 gi|89081267|gb|EAR60500.1| generic methyl-transferase [Oceanospirillum sp. MED92]
          Length = 260

 Score = 43.5 bits (101), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
            +PLA  SVD V++ H L+F++ P  +L E  R+L  GG +++V  N    W 
Sbjct: 90  EIPLAHESVDVVVLHHALDFSDAPHQVLREASRILRPGGHVVIVGFNPMSYWG 142


>gi|312129611|ref|YP_003996951.1| methyltransferase type 11 [Leadbetterella byssophila DSM 17132]
 gi|311906157|gb|ADQ16598.1| Methyltransferase type 11 [Leadbetterella byssophila DSM 17132]
          Length = 258

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 73  WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           +PD YF++  L        AD+S D V+    +E  +D    L E WRVL  GG++++  
Sbjct: 77  YPDHYFNTVDLPYLNEF--ADNSFDFVVTFQVIEHIQDDHKFLQEAWRVLKPGGKILLTT 134

Query: 133 PNK 135
            NK
Sbjct: 135 VNK 137


>gi|307352210|ref|YP_003893261.1| type 11 methyltransferase [Methanoplanus petrolearius DSM 11571]
 gi|307155443|gb|ADN34823.1| Methyltransferase type 11 [Methanoplanus petrolearius DSM 11571]
          Length = 550

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           S   L    +LP+    VD ++    +E    P  M+ EI RVL  GG +++  PN+   
Sbjct: 405 SDYILADAEHLPVRSGKVDKIICAEIIEHLISPDKMVSEIKRVLNKGGEIVITTPNEFSF 464

Query: 139 WARMEH--TPFGSGQPY 153
           W   E     FG G+ Y
Sbjct: 465 WGVYEMMWDLFGRGRNY 481


>gi|227357999|ref|ZP_03842341.1| type 11 methyltransferase [Proteus mirabilis ATCC 29906]
 gi|227161734|gb|EEI46766.1| type 11 methyltransferase [Proteus mirabilis ATCC 29906]
          Length = 237

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           + S   LP  + SVD  LM H L+++ DP  +L E  RVL   G +I+   N   +    
Sbjct: 78  MASLNYLPFENKSVDVCLMAHVLDYSADPHWLLREADRVLVDDGWIILSSFNPISLLGIG 137

Query: 143 EHTP-FGSGQPYSWYQMISLLREANF 167
           + TP     QPY + +M SL R+ ++
Sbjct: 138 KCTPILRHKQPY-YCRMFSLRRQVDW 162


>gi|222111166|ref|YP_002553430.1| type 11 methyltransferase [Acidovorax ebreus TPSY]
 gi|221730610|gb|ACM33430.1| Methyltransferase type 11 [Acidovorax ebreus TPSY]
          Length = 252

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 66/150 (44%), Gaps = 15/150 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW------ARM 142
           LP A++S+D + + H LE + DP   L E+ RVL   G++++   N   +W      +R+
Sbjct: 81  LPFAEASLDLLALPHTLELSVDPHTALREVHRVLVPEGKVVISGLNPLSLWGLRQRRSRL 140

Query: 143 EHTPFGSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
                  G+ +        S  ++   LR   F L   S   + P       L+ +   +
Sbjct: 141 YQRCGAGGRLFLPDVGEFISPGRLRDWLRLLGFELESMSFGCYRPAVAGDRWLQRYGWMD 200

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPITE 224
            +G  + P F   YVI A K + QG+ + E
Sbjct: 201 ALGARWWPIFGAAYVIVAVKRV-QGMRLLE 229


>gi|119476001|ref|ZP_01616353.1| generic methyl-transferase [marine gamma proteobacterium HTCC2143]
 gi|119450628|gb|EAW31862.1| generic methyl-transferase [marine gamma proteobacterium HTCC2143]
          Length = 268

 Score = 43.1 bits (100), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN---K 135
           S+  L     LP A+ S+D V++ H  EF ++P  +L EI RV+   GR+IVV  N    
Sbjct: 79  SADVLSDFEQLPFANESLDIVIVHHVQEFIDNPHQLLREINRVVVPHGRVIVVGFNPWSP 138

Query: 136 RGMWARMEHTPFGS 149
            G+++R+ H   GS
Sbjct: 139 LGVFSRVGHWLPGS 152


>gi|261211355|ref|ZP_05925643.1| SAM-dependent methyltransferase [Vibrio sp. RC341]
 gi|260839310|gb|EEX65936.1| SAM-dependent methyltransferase [Vibrio sp. RC341]
          Length = 245

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 12/170 (7%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYVIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +        FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLGVLNYQVIACDHYALFPMQKYR---PFWTWL 191

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E         F  +Y I ARK      PI ++ + K   SP+ V + V++
Sbjct: 192 ENGLGESSTAFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGVNYRVNS 241


>gi|297157316|gb|ADI07028.1| hypothetical protein SBI_03907 [Streptomyces bingchenggensis BCW-1]
          Length = 353

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +LPLAD+SVD       L+   DP  +L E  RVL  GGR+++  P+
Sbjct: 186 DLPLADASVDRARTDRTLQHVTDPAQVLAETRRVLRPGGRLVMAEPD 232


>gi|24374105|ref|NP_718148.1| hypothetical protein SO_2562 [Shewanella oneidensis MR-1]
 gi|24348592|gb|AAN55592.1|AE015697_14 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 244

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A++  L+  W  V G  LL  G      S     V    +   A          
Sbjct: 19  GCALQQAVADKLADWWPRVFGYHLLKFGPLSAEISSMASPVAHHFSLCSAP--------- 69

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
             +++ +    +LPL +  +D V+M   LEF  DP+ +L EI RVL +GG + +V
Sbjct: 70  --NASLMGDFCHLPLQNGVIDAVVMSLLLEFEADPYRILREIDRVLIAGGYLFIV 122


>gi|110834084|ref|YP_692943.1| hypothetical protein ABO_1223 [Alcanivorax borkumensis SK2]
 gi|110647195|emb|CAL16671.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 258

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/158 (21%), Positives = 72/158 (45%), Gaps = 7/158 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM-----WARME 143
           LP+A +SVD +L+ H ++F+ DP  +L E  R +  GG++ ++  +   +     W    
Sbjct: 94  LPIAKNSVDVLLLHHTMDFSADPHQVLREAARCMAPGGKIAIIGFHPLSIMGLARWLLWW 153

Query: 144 HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPG 203
            +P   G+ Y   ++   L+   F +   +   +  P   +   ++  + + +G    P 
Sbjct: 154 KSPGWMGRYYRPNRLTDWLQVLGFEVDGMASGFYTMPLSDRGRSRV-RMLDWLGRYLWPR 212

Query: 204 FAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
               Y++ ARK      P+  S+++ +    +VP  V+
Sbjct: 213 HGNTYLLVARKRAGVVRPLA-SRQRRVPRNAVVPVPVA 249


>gi|325000547|ref|ZP_08121659.1| methyltransferase type 11 [Pseudonocardia sp. P1]
          Length = 263

 Score = 43.1 bits (100), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 22  DAISKVLSTTWDDVT----GCRLLGLGYAIPFFSCFHGKVERTLA--FMPA--GQGATNW 73
           + + + ++   D VT    GC   G GY     +   G   R LA  + PA        +
Sbjct: 37  EVVYEAIAADCDGVTVLEAGC---GEGYGADLLA---GTAHRVLALDYDPATVAHVRARY 90

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P    +   LV+   LPL D+SVD V+ +  +E   D    L E  RVL  GGR++V  P
Sbjct: 91  PRVVVARANLVA---LPLPDASVDVVVSLQVIEHLWDQERFLGECRRVLRPGGRLLVSTP 147

Query: 134 NK 135
           N+
Sbjct: 148 NR 149


>gi|283781585|ref|YP_003372340.1| methyltransferase type 11 [Pirellula staleyi DSM 6068]
 gi|283440038|gb|ADB18480.1| Methyltransferase type 11 [Pirellula staleyi DSM 6068]
          Length = 772

 Score = 43.1 bits (100), Expect = 0.032,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 26/45 (57%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           P+AD SV  V+    LE   DP  +L E  R+L  GGR+I  VPN
Sbjct: 303 PIADHSVHAVVSFETLEHVADPESLLAEFRRILVPGGRIIASVPN 347


>gi|332992537|gb|AEF02592.1| SAM-dependent methyltransferase [Alteromonas sp. SN2]
          Length = 276

 Score = 43.1 bits (100), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 30/43 (69%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            LP +++S+D  L+ + L+FA+DP  +L E+ RV+T  G +I+
Sbjct: 109 QLPFSENSIDGFLLANELDFAQDPHEILREVDRVITQSGYVII 151


>gi|54294436|ref|YP_126851.1| hypothetical protein lpl1505 [Legionella pneumophila str. Lens]
 gi|53754268|emb|CAH15745.1| hypothetical protein lpl1505 [Legionella pneumophila str. Lens]
          Length = 247

 Score = 43.1 bits (100), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 71  TNWPDQYFSSTALV----SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
           + W    FSST  +    S   LPL   ++DC+++   LE   + F ++ EI R+L   G
Sbjct: 64  SKWIASPFSSTNRIHLECSLNQLPLNRDTLDCIIVPLTLEPFGNNFSLIDEIDRILKPMG 123

Query: 127 RMIVVVPNKRGMWARMEH----TPFGSG--QPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +I +  N   +W           +G+   +  S + +  +  +  +     +   + PP
Sbjct: 124 FLIFLCINPWSLWGGAMKWGLLNCYGNRTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT-----ESKKKHISS 232
            + + ++K  + F++IG +  P  +G Y    +K  Y    +T     ES KK   S
Sbjct: 184 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEYISPSLTIEPSIESVKKEYDS 240


>gi|290960731|ref|YP_003491913.1| SAM-dependent methyltransferase [Streptomyces scabiei 87.22]
 gi|260650257|emb|CBG73373.1| putative SAM-dependent methyltransferase [Streptomyces scabiei
           87.22]
          Length = 252

 Score = 43.1 bits (100), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +++G LPL   S D VL    +E   DP   L EI RVL  GG +++  PN
Sbjct: 106 LTDGGLPLRGESADAVLFSEVIEHLVDPDAALDEIRRVLRPGGHLMLSTPN 156


>gi|319947210|ref|ZP_08021444.1| methyltransferase domain protein [Streptococcus australis ATCC
           700641]
 gi|319747258|gb|EFV99517.1| methyltransferase domain protein [Streptococcus australis ATCC
           700641]
          Length = 236

 Score = 43.1 bits (100), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 1/112 (0%)

Query: 27  VLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSE 86
           +L     D+ G R+L  G      +    K  + LA  P  +       ++     + S 
Sbjct: 23  ILFDQLQDIKGKRVLDFGSGFGLVANHLAKENQVLAVEPNEEMVALRAQEHSYQQLVGSL 82

Query: 87  GNLP-LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
             L  L D+S D +L  + LE+ ED  L+L E  R+L  GG + +V  N+ G
Sbjct: 83  DQLASLEDASFDVILCHNVLEYVEDRKLVLEEFTRLLKPGGLLSIVKHNEVG 134


>gi|296314517|ref|ZP_06864458.1| hypothetical protein NEIPOLOT_01527 [Neisseria polysaccharea ATCC
           43768]
 gi|296838829|gb|EFH22767.1| hypothetical protein NEIPOLOT_01527 [Neisseria polysaccharea ATCC
           43768]
          Length = 221

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 55/132 (41%), Gaps = 11/132 (8%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
           +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMALADVSADMLLFPHTLECGA-PSQILSEAHRILKPSGRVMLTGFNPHSLWG--- 114

Query: 144 HTPFGSGQPYSWYQMISLLR-------EANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
            + +  G+     +    LR       +  F + +    ++ PP      +  W   EK 
Sbjct: 115 FSRWFDGERLPEKRFCLTLRGLKRQLADTGFDIELGKFMVYLPPVSSPGQIHFWQFMEKA 174

Query: 197 GNIFGPGFAGIY 208
           G+ + P  A +Y
Sbjct: 175 GDRWWPQCAAVY 186


>gi|226365210|ref|YP_002782993.1| glycosyltransferase [Rhodococcus opacus B4]
 gi|226243700|dbj|BAH54048.1| putative glycosyltransferase [Rhodococcus opacus B4]
          Length = 643

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           +LP  DS+ D V   H +E   DP   L E+ RVL  GG + V  PN+  M
Sbjct: 494 DLPFPDSNFDAVFYHHVIEHVADPAASLRELARVLRPGGLLYVGTPNRHRM 544


>gi|189423428|ref|YP_001950605.1| ArsR family transcriptional regulator [Geobacter lovleyi SZ]
 gi|189419687|gb|ACD94085.1| transcriptional regulator, ArsR family [Geobacter lovleyi SZ]
          Length = 310

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            +LPL D SVDC ++   L  A DP  +L EI RVLT GG +++ 
Sbjct: 202 NHLPLPDRSVDCAILNMVLHHAADPPSVLAEIRRVLTGGGSLLLA 246


>gi|14590962|ref|NP_143037.1| hypothetical protein PH1134 [Pyrococcus horikoshii OT3]
 gi|3257551|dbj|BAA30234.1| 310aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 310

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM----WARME 143
           +LP  DSS+ C+LMV  + F +D    + E +RVL  GG +++   +K       + R +
Sbjct: 90  DLPFPDSSLSCILMVTTICFVDDVEKSIKEAYRVLKPGGYIVIGFIDKNSKIGKEYERNK 149

Query: 144 HTP--FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
                +   + +S  ++IS+L  + F +    ++LF
Sbjct: 150 DKSVFYREAKFFSTEEVISILERSGFKVEKIVQTLF 185


>gi|288937009|ref|YP_003441068.1| methyltransferase type 11 [Klebsiella variicola At-22]
 gi|288891718|gb|ADC60036.1| Methyltransferase type 11 [Klebsiella variicola At-22]
          Length = 240

 Score = 43.1 bits (100), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N   +    +  P 
Sbjct: 83  HLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFNPVSLMGLRKLVPL 142

Query: 147 FGSGQPYSWYQMISLLREANF 167
             +G PY+  +M +L+R+ ++
Sbjct: 143 LRNGTPYN-SRMFTLMRQLDW 162


>gi|213422239|ref|ZP_03355305.1| hypothetical protein Salmonentericaenterica_32668 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 161

 Score = 43.1 bits (100), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 72/165 (43%), Gaps = 18/165 (10%)

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK------ 135
            L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N       
Sbjct: 5   VLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLMGL 64

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
           R +   +  TP     PY+  +M +L+R+ ++   +    L +   H   +L       +
Sbjct: 65  RKLVLVLRKTP-----PYN-SRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGR 115

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + N   P    + +I ARK   + +P+T +  +H  S   +  TV
Sbjct: 116 LLNTHIPALGCLQLIVARK---RTIPLTLNPLRHNKSKTPIRQTV 157


>gi|325496139|gb|EGC93998.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           fergusonii ECD227]
          Length = 230

 Score = 43.1 bits (100), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 73  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 132

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 133 LRKNSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 181

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 182 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 212


>gi|297199451|ref|ZP_06916848.1| glycosyl transferase [Streptomyces sviceus ATCC 29083]
 gi|297147406|gb|EDY57043.2| glycosyl transferase [Streptomyces sviceus ATCC 29083]
          Length = 245

 Score = 42.7 bits (99), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            LP  DSSVD VL    +E   DP   L EI R+L  GG +++  PN
Sbjct: 103 GLPFKDSSVDAVLFSEVVEHLVDPDAALDEIRRILRPGGHLMLSTPN 149


>gi|218887335|ref|YP_002436656.1| methyltransferase type 11 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|218758289|gb|ACL09188.1| Methyltransferase type 11 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 212

 Score = 42.7 bits (99), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 84  VSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EGN LPL D +VD      YL  AEDP   L E+ R++  GGR+++
Sbjct: 95  VCEGNALPLPDGAVDHAFANMYLHHAEDPGAALREMARIVRPGGRVVL 142


>gi|238784819|ref|ZP_04628820.1| hypothetical protein yberc0001_30750 [Yersinia bercovieri ATCC
           43970]
 gi|238714235|gb|EEQ06246.1| hypothetical protein yberc0001_30750 [Yersinia bercovieri ATCC
           43970]
          Length = 221

 Score = 42.7 bits (99), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 55/138 (39%), Gaps = 11/138 (7%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    AI + L   W    G  LL +G+     +     +   +     G+       Q
Sbjct: 4   GEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCVISHQVNVGERGKNM-----Q 58

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
            F+S        LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++   N  
Sbjct: 59  VFASPY-----QLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVISNFNPM 113

Query: 137 GMWARMEHTP-FGSGQPY 153
            M    +  P     QPY
Sbjct: 114 SMLGAGKFIPILRQRQPY 131


>gi|126178833|ref|YP_001046798.1| methyltransferase type 11 [Methanoculleus marisnigri JR1]
 gi|125861627|gb|ABN56816.1| Methyltransferase type 11 [Methanoculleus marisnigri JR1]
          Length = 191

 Score = 42.7 bits (99), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM----- 142
           ++P+ D S    LMV  + F +DP L   EI RVL  GG +++    + G  AR      
Sbjct: 86  SIPIRDGSCSSALMVTVICFLDDPVLAFEEIHRVLVPGGTLVLGFIERDGEVARKYLHEK 145

Query: 143 -EHTPFGSGQPYSWYQMISLLREANFTLS-ITSRSLFFPPTHKK 184
            +H      + YS  ++  LL    F ++ + SR+ F     +K
Sbjct: 146 GKHRFLSRARLYSSDEVRQLLGRTGFRVAEVDSRAGFLVIAARK 189


>gi|228475537|ref|ZP_04060255.1| membrane-associated protein [Staphylococcus hominis SK119]
 gi|314935530|ref|ZP_07842882.1| membrane-associated protein [Staphylococcus hominis subsp. hominis
           C80]
 gi|228270319|gb|EEK11754.1| membrane-associated protein [Staphylococcus hominis SK119]
 gi|313656095|gb|EFS19835.1| membrane-associated protein [Staphylococcus hominis subsp. hominis
           C80]
          Length = 255

 Score = 42.7 bits (99), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 64/136 (47%), Gaps = 14/136 (10%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------RGMWA 140
           NLP   ++ D V+ +  +E   +P  +++E++RVL + G +I++ PNK       + +  
Sbjct: 108 NLPYPQNTFDTVISLGVIEHFLNPDKVMNEMYRVLKTNGHLILMTPNKYSFGILDKKIKI 167

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK--CILKLWSVFEKIGN 198
            ++   FG    YS   +  +  +  F   + SR      T K      KL S  ++I N
Sbjct: 168 LLKVWKFGYQTEYSVNDLEKIANKYGF--KVVSRKTELRKTFKNDSISFKLISSIDQILN 225

Query: 199 IFGPGF---AGIYVIE 211
           +F   F   + IY+I+
Sbjct: 226 VFNKNFGFYSYIYLIK 241


>gi|218547663|ref|YP_002381454.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           fergusonii ATCC 35469]
 gi|218355204|emb|CAQ87811.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|323975920|gb|EGB71015.1| methyltransferase domain-containing protein [Escherichia coli
           TW10509]
 gi|324111225|gb|EGC05208.1| methyltransferase domain-containing protein [Escherichia fergusonii
           B253]
          Length = 240

 Score = 42.7 bits (99), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKNSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|170722632|ref|YP_001750320.1| hypothetical protein PputW619_3468 [Pseudomonas putida W619]
 gi|169760635|gb|ACA73951.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 257

 Score = 42.7 bits (99), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 66/158 (41%), Gaps = 3/158 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR- 141
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG +++V  N    W   
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGHLLIVGINPWSSWGIR 143

Query: 142 --MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
               H      +  S  ++   L    F L       + PP       +  + +E++   
Sbjct: 144 HFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASPAWQQRLAGWERVAGG 203

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           +     G+Y++ ARK++    P+ + +++ +   + +P
Sbjct: 204 WQSSGGGVYLLVARKMVVGLRPLRQERREPMGKLLPLP 241


>gi|84496601|ref|ZP_00995455.1| hypothetical protein JNB_03740 [Janibacter sp. HTCC2649]
 gi|84383369|gb|EAP99250.1| hypothetical protein JNB_03740 [Janibacter sp. HTCC2649]
          Length = 246

 Score = 42.7 bits (99), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LP  D+S  CV+    +E   DP   L EI RVL  GG +I+  PN    WA     P 
Sbjct: 82  RLPFEDASFACVVAGEIIEHVPDPDHFLREIRRVLEPGGHLIISTPNMVS-WANRILVPL 140

Query: 148 G 148
           G
Sbjct: 141 G 141


>gi|182624810|ref|ZP_02952590.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens D str.
           JGS1721]
 gi|177910020|gb|EDT72422.1| methyltransferase, UbiE/COQ5 family [Clostridium perfringens D str.
           JGS1721]
          Length = 207

 Score = 42.7 bits (99), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D + M   L    +P   + E+ RVL   G++++  V   +G W R E   
Sbjct: 96  NLPLFDDSIDLIFMNMALHHVANPDKAIKEMNRVLKPNGKVVITDVLEHKGEWVREEMFD 155

Query: 147 FGSGQPYSWYQMISLLREANF-TLSITSRSL 176
              G  +++ Q+I+   +A F  +SI +  L
Sbjct: 156 IWLG--FNYDQLINWFEKAGFKNISIKNTGL 184


>gi|330752338|emb|CBL87291.1| protein containing methyltransferase domain [uncultured
           Sphingobacteria bacterium]
          Length = 253

 Score = 42.7 bits (99), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP  DSS D +     +E  ED    + EI RVLT  G+  + VP  + +W+  +    
Sbjct: 92  DLPFKDSSFDVICGFDVVEHIEDDEKAIREINRVLTPNGQYFLTVPAFQFLWSNHDVVN- 150

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRS---LFFPPTHKKCILKL 189
              + Y+    +SLL      +S +S     LFFP    + IL L
Sbjct: 151 HHFRRYTQKSFLSLLYSNGLNVSFSSYFNFWLFFPIATVRFILNL 195


>gi|262044052|ref|ZP_06017132.1| SAM-dependent methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259038624|gb|EEW39815.1| SAM-dependent methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 222

 Score = 42.7 bits (99), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N   +    +  P 
Sbjct: 65  HLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFNPVSLMGLRKLVPV 124

Query: 147 FGSGQPYSWYQMISLLREANF 167
              G PY+  +M +L+R+ ++
Sbjct: 125 LRKGTPYN-SRMFTLMRQLDW 144


>gi|307267366|ref|ZP_07548861.1| Methyltransferase type 11 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917624|gb|EFN47903.1| Methyltransferase type 11 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 209

 Score = 42.7 bits (99), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           NLP  D+S D VLMV  + F +D      E +RVL + G +++   ++     ++     
Sbjct: 86  NLPFGDNSFDLVLMVTTVCFVDDVLKSFKECFRVLKNNGTILIGFVDRESTIGKIYQANK 145

Query: 147 -----FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
                +     YS  +++ LL EA F     S+++F
Sbjct: 146 EKSLFYKEATFYSTSEIVELLYEAGFKNFNFSQTIF 181


>gi|51246944|ref|YP_066828.1| hypothetical protein DP3092 [Desulfotalea psychrophila LSv54]
 gi|50877981|emb|CAG37821.1| unknown protein [Desulfotalea psychrophila LSv54]
          Length = 300

 Score = 42.7 bits (99), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 11/95 (11%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           L     LPLAD+S+D  L +  LE    P +ML E +RVL +G R I       G  A +
Sbjct: 145 LADAQALPLADNSIDFALSLAVLEHLPHPEIMLREAFRVLKNGARFI-------GSVAFL 197

Query: 143 EHTPFGSGQPYSWYQ--MISLLREANFTLSITSRS 175
           +  PF  G  Y +    + S+L +  F + + + S
Sbjct: 198 Q--PFHDGSYYHFTHLGLYSMLHDIGFEVELIAPS 230


>gi|268315637|ref|YP_003289356.1| Methyltransferase type 11 [Rhodothermus marinus DSM 4252]
 gi|262333171|gb|ACY46968.1| Methyltransferase type 11 [Rhodothermus marinus DSM 4252]
          Length = 219

 Score = 42.7 bits (99), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV-----PNKRGMWARME 143
           LP  D   + VL+V  L F +DP   L E +RVL  GG +++       P  R    R  
Sbjct: 87  LPFPDRRFEAVLLVTTLCFVDDPRQALREAYRVLRPGGFLVIGFVDRDSPPGRRYLERHR 146

Query: 144 HTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +PF    + +S  ++ +L++E  F   +  ++LF  P
Sbjct: 147 ESPFYREARFFSASEIAALMQEVGFGELVWRQTLFSDP 184


>gi|169831840|ref|YP_001717822.1| type 11 methyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638684|gb|ACA60190.1| Methyltransferase type 11 [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 235

 Score = 42.7 bits (99), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +    LP  D +VD V++   LE  ++ F + HEI RV+   G++IV VPN   +  R+
Sbjct: 74  IERDRLPFDDGTVDVVIVNQVLEHIKEIFWVFHEITRVVPVSGKVIVGVPNLASLHNRV 132


>gi|85374847|ref|YP_458909.1| transcriptional regulator [Erythrobacter litoralis HTCC2594]
 gi|84787930|gb|ABC64112.1| predicted transcriptional regulator [Erythrobacter litoralis
           HTCC2594]
          Length = 330

 Score = 42.7 bits (99), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV---VPNKRGMWARMEHT 145
           LP ADS+ D VL    L FA DP   L E  RV+   GR+ +V         +  + +H 
Sbjct: 216 LPFADSAFDTVLFHQVLHFAHDPARALAEAARVIRPKGRIAIVDFAAHTHEELREQFQHA 275

Query: 146 PFGSGQPYSWYQMISLLREANFT 168
             G    ++  QM  LL  A FT
Sbjct: 276 RLG----FADAQMRELLGNAGFT 294


>gi|182415810|ref|YP_001820876.1| methyltransferase type 11 [Opitutus terrae PB90-1]
 gi|177843024|gb|ACB77276.1| Methyltransferase type 11 [Opitutus terrae PB90-1]
          Length = 276

 Score = 42.7 bits (99), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           LP  D+S D V+    L   +D  L L E  RVL  GGR+++ VP  R +W+
Sbjct: 125 LPFGDASFDAVVSADVLYHLDDDALALREYARVLRPGGRIVINVPAHRWLWS 176


>gi|163847076|ref|YP_001635120.1| type 11 methyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222524909|ref|YP_002569380.1| type 11 methyltransferase [Chloroflexus sp. Y-400-fl]
 gi|163668365|gb|ABY34731.1| Methyltransferase type 11 [Chloroflexus aurantiacus J-10-fl]
 gi|222448788|gb|ACM53054.1| Methyltransferase type 11 [Chloroflexus sp. Y-400-fl]
          Length = 278

 Score = 42.7 bits (99), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 14/100 (14%)

Query: 39  RLLGLG-----YAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLAD 93
           RLL +G     YA+ +       +   + F P G GA +          +     LP AD
Sbjct: 47  RLLDVGCGKRSYALIYERHVELSIGTEVQFSPHGTGAAD---------LIGYAEELPFAD 97

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           +S D +L    LE    PF +L E+ R+L  GG +I+  P
Sbjct: 98  ASFDTILCTEVLEHTRHPFQVLTELARLLKPGGHLILSTP 137


>gi|255525181|ref|ZP_05392124.1| Methyltransferase type 11 [Clostridium carboxidivorans P7]
 gi|296187434|ref|ZP_06855829.1| methyltransferase domain protein [Clostridium carboxidivorans P7]
 gi|255511140|gb|EET87437.1| Methyltransferase type 11 [Clostridium carboxidivorans P7]
 gi|296047956|gb|EFG87395.1| methyltransferase domain protein [Clostridium carboxidivorans P7]
          Length = 209

 Score = 42.7 bits (99), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARMEHTP 146
           NLPL D S+D V +   L    D    + E++RVL   G +++  V    G WAR E   
Sbjct: 96  NLPLFDKSIDRVFINMALHHIFDAKKAIEEMFRVLKKDGAVVITDVEEHNGEWARTEMHD 155

Query: 147 FGSGQPYSWYQMISLLREANFT 168
              G  +S  Q+ S L+EA F+
Sbjct: 156 EWLG--FSHEQIKSWLKEAGFS 175


>gi|152968803|ref|YP_001333912.1| putative methyltransferase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|330005757|ref|ZP_08305369.1| methyltransferase domain protein [Klebsiella sp. MS 92-3]
 gi|150953652|gb|ABR75682.1| putative methyltransferase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|328536125|gb|EGF62513.1| methyltransferase domain protein [Klebsiella sp. MS 92-3]
          Length = 222

 Score = 42.7 bits (99), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N   +    +  P 
Sbjct: 65  HLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFNPVSLMGLRKLVPV 124

Query: 147 FGSGQPYSWYQMISLLREANF 167
              G PY+  +M +L+R+ ++
Sbjct: 125 LRKGTPYN-SRMFTLMRQLDW 144


>gi|238893206|ref|YP_002917940.1| putative methyltransferase [Klebsiella pneumoniae NTUH-K2044]
 gi|238545522|dbj|BAH61873.1| putative methyltransferase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 242

 Score = 42.7 bits (99), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N   +    +  P 
Sbjct: 85  HLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFNPVSLMGLRKLVPV 144

Query: 147 FGSGQPYSWYQMISLLREANF 167
              G PY+  +M +L+R+ ++
Sbjct: 145 LRKGTPYN-SRMFTLMRQLDW 164


>gi|118594821|ref|ZP_01552168.1| generic methyl-transferase [Methylophilales bacterium HTCC2181]
 gi|118440599|gb|EAV47226.1| generic methyl-transferase [Methylophilales bacterium HTCC2181]
          Length = 226

 Score = 42.7 bits (99), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 11/153 (7%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
           S  +LP    S+D ++  H+LE   +      E +RV+  GGR++++  N          
Sbjct: 64  SSMHLPFEKDSIDLIISQHHLEKIGNIQAHFSEFFRVIIPGGRVVILSFNPFSFAGLRNL 123

Query: 145 TPFGSGQPYSWYQMISL------LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
           T F +  P++  + ISL      L+E  FT+    R + + P           +FE +G 
Sbjct: 124 TCFDNFSPWN-QKFISLSAAQKILKEEGFTVE-EGRMVDYQPLFSDNA-SAHKLFEDVGA 180

Query: 199 IFGPGFAGIYVIEARKILYQGLPITE--SKKKH 229
            + P F  +Y I ARK +    P+    +K KH
Sbjct: 181 RWLPLFGNVYFIVARKDVVGVTPLRPKWNKMKH 213


>gi|157413805|ref|YP_001484671.1| hypothetical protein P9215_14721 [Prochlorococcus marinus str. MIT
           9215]
 gi|157388380|gb|ABV51085.1| Hypothetical protein P9215_14721 [Prochlorococcus marinus str. MIT
           9215]
          Length = 251

 Score = 42.7 bits (99), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 78  FSSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           FS++  ++ G   N+P  D+S D  + +H +E + DP   L E++RV   GG + + VP
Sbjct: 137 FSASPRITTGDMHNMPFDDNSFDATIAIHSMEHSYDPSKSLGEMFRVTKEGGVICIEVP 195


>gi|260914300|ref|ZP_05920769.1| metallothionein SmtA [Pasteurella dagmatis ATCC 43325]
 gi|260631401|gb|EEX49583.1| metallothionein SmtA [Pasteurella dagmatis ATCC 43325]
          Length = 238

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 54/118 (45%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+   +A+S      +  + G +LL LG       C      + L      +    +  Q
Sbjct: 23  GEHYCNALSDYFYNWFPKILGNQLLKLGGLSAEIPCDCFLTHQILLSPNINERLYTFSKQ 82

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
             +S    +  +LP  ++SV+ V++ + L F++DP  +L E+ RVLT  G + + + N
Sbjct: 83  KNTSVIQANMTDLPFVENSVNGVVLANILHFSQDPHQILREVERVLTEDGYLFLSLFN 140


>gi|110634379|ref|YP_674587.1| ArsR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110285363|gb|ABG63422.1| transcriptional regulator, ArsR family [Chelativorans sp. BNC1]
          Length = 337

 Score = 42.7 bits (99), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 82  ALVSEGNL---PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNKR 136
           A V +G++   P+   + D V +   L + EDP   + E  R+L  GGR+++V   P+  
Sbjct: 206 AQVRQGDIYAPPVERGAHDLVTIHQVLHYLEDPAAAIREAARLLKPGGRLVIVDFAPHNL 265

Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP--THKKCILKLWSVFE 194
             + R EH     G  ++  Q+   L+EA   L  T+RS F P   T K   +K+W   +
Sbjct: 266 D-FLREEHAHLRLG--FADRQIAEWLKEAELDLE-TTRS-FVPEGGTKKGLTVKMWLAHD 320

Query: 195 K 195
           +
Sbjct: 321 R 321


>gi|145221333|ref|YP_001132011.1| methyltransferase type 11 [Mycobacterium gilvum PYR-GCK]
 gi|145213819|gb|ABP43223.1| Methyltransferase type 11 [Mycobacterium gilvum PYR-GCK]
          Length = 236

 Score = 42.7 bits (99), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LPL+D SVD V+ +  L+   +P   + E+ RVL SG R+ V+VP      A + + P 
Sbjct: 138 DLPLSDESVDGVVSIAMLQLIPEPARAVAEMVRVLRSGRRVAVMVPTAGPAAAALRYLPH 197

Query: 148 GSGQPYSWYQMISLLREANFT 168
                +   ++  +      T
Sbjct: 198 AGAHSFGDDELADVFEGLGLT 218


>gi|120599052|ref|YP_963626.1| type 11 methyltransferase [Shewanella sp. W3-18-1]
 gi|120559145|gb|ABM25072.1| Methyltransferase type 11 [Shewanella sp. W3-18-1]
          Length = 244

 Score = 42.7 bits (99), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 11/115 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A+++ L+  W  V G  LL LG      S     V    + + + Q A+     
Sbjct: 19  GAALQFAVAEKLAHWWPRVFGYHLLKLGPLSAALSSMESPVAHHFS-LSSSQDAS----- 72

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                 +    +LPL +  +D V+M   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 73  -----IIGDFCHLPLQNGVIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYLFIV 122


>gi|319426195|gb|ADV54269.1| Methyltransferase type 11 [Shewanella putrefaciens 200]
          Length = 244

 Score = 42.4 bits (98), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 11/115 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A+++ L+  W  V G  LL LG      S     V    + + + Q A+     
Sbjct: 19  GAALEFAVAEKLAHWWPRVFGYHLLKLGPLSAALSSMESPVAHHFS-LSSSQDAS----- 72

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                 +    +LPL +  +D V+M   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 73  -----IIGDFCHLPLQNGVIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYLFIV 122


>gi|330861139|emb|CBX71402.1| uncharacterized protein yafS [Yersinia enterocolitica W22703]
          Length = 203

 Score = 42.4 bits (98), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%)

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 30  VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 89


>gi|323699823|ref|ZP_08111735.1| Methyltransferase type 11 [Desulfovibrio sp. ND132]
 gi|323459755|gb|EGB15620.1| Methyltransferase type 11 [Desulfovibrio desulfuricans ND132]
          Length = 238

 Score = 42.4 bits (98), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 6/97 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME---- 143
           N+P +D+  D  L+   LEFA++P  ML E  RV   G  ++V   NK  ++  M     
Sbjct: 93  NMPFSDNEFDYALLWSVLEFADNPEAMLAEAARVAEKG--LLVGFLNKNSLYYYMNIRGT 150

Query: 144 HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +       ++W +M  L+R+A       +RS+   P
Sbjct: 151 DSSMAGAHWFTWCEMQDLVRKATGFAPTLARSVLAGP 187


>gi|317401162|gb|EFV81810.1| hypothetical protein HMPREF0005_01219 [Achromobacter xylosoxidans
           C54]
          Length = 273

 Score = 42.4 bits (98), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPL D S+D V+    +E   +  L L E  RVL  GG +++  PN   +  R+ +  F 
Sbjct: 78  LPLPDDSIDIVVCQEGIEHLPNQLLALQEFHRVLKPGGTLVITTPNISNLVGRLANLVFE 137

Query: 149 S 149
           S
Sbjct: 138 S 138


>gi|146292877|ref|YP_001183301.1| type 11 methyltransferase [Shewanella putrefaciens CN-32]
 gi|145564567|gb|ABP75502.1| Methyltransferase type 11 [Shewanella putrefaciens CN-32]
          Length = 244

 Score = 42.4 bits (98), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 11/115 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G     A+++ L+  W  V G  LL LG      S     V    + + + Q A+     
Sbjct: 19  GAALEFAVAEKLAHWWPRVFGYHLLKLGPLSAALSSMESPVAHHFS-LSSSQDAS----- 72

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
                 +    +LPL +  +D V+M   LEF  DP+ +L E  RVL +GG + +V
Sbjct: 73  -----IIGDFCHLPLQNGVIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYLFIV 122


>gi|238794445|ref|ZP_04638055.1| hypothetical protein yinte0001_6340 [Yersinia intermedia ATCC
           29909]
 gi|238726240|gb|EEQ17784.1| hypothetical protein yinte0001_6340 [Yersinia intermedia ATCC
           29909]
          Length = 239

 Score = 42.4 bits (98), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 70  EQGTNMQVLASPYQLPFAEKSVDACLLSHSLAYATDPHRILREVDRVLIDDGWLVI 125


>gi|124022782|ref|YP_001017089.1| hypothetical protein P9303_10751 [Prochlorococcus marinus str. MIT
           9303]
 gi|123963068|gb|ABM77824.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9303]
          Length = 215

 Score = 42.4 bits (98), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 21/130 (16%)

Query: 8   LRQFYSSFLGKCTT--DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           L + Y   +  C+T  D +S  +S   DDV   R++G           HG  E+ L    
Sbjct: 40  LTRLYREKIPSCSTVLDLMSSWVSHLPDDVIYDRVIG-----------HGLNEKELV--- 85

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
               A N  D ++     +++  +PL D S+D  L++   ++ + P  M  E+ RV  S 
Sbjct: 86  ----ANNRLDSHWVQNFNLNQS-IPLKDESIDATLIIAGWQYLQQPEDMAEELLRVTRSK 140

Query: 126 GRMIVVVPNK 135
           G++IV   N+
Sbjct: 141 GQVIVAFSNR 150


>gi|332535811|ref|ZP_08411544.1| SAM-dependent methyltransferase in cluster with
           hydroxyacylglutathione hydrolase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332034789|gb|EGI71327.1| SAM-dependent methyltransferase in cluster with
           hydroxyacylglutathione hydrolase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 261

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P  Y    A + E  LP  + S+D  ++ H LE+  DP  +L E  R L  GG ++V   
Sbjct: 71  PGPYTGVVADIDE--LPFYEHSIDACILSHCLEYHSDPHHILREAHRTLIPGGYILVTGF 128

Query: 134 NKRGMWARMEHTPFGSGQPYSW 155
           N   +    +  PF SGQ   W
Sbjct: 129 NPFSLCGLAQMLPF-SGQKLPW 149


>gi|257373002|ref|YP_003175776.1| methyltransferase type 11 [Halomicrobium mukohataei DSM 12286]
 gi|257167726|gb|ACV49418.1| Methyltransferase type 11 [Halomicrobium mukohataei DSM 12286]
          Length = 186

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 48/97 (49%), Gaps = 23/97 (23%)

Query: 83  LVSEG--NLPLADSSVDCVL-MVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           LV+ G  +LPLA  S+D     + Y EFA++    L EI RVLT GGR++V        W
Sbjct: 86  LVTSGVADLPLATDSLDAAFSTMTYHEFADEA--ALAEIARVLTDGGRLVVA------DW 137

Query: 140 ARMEHTPFGSG-------QPYSWYQMISLLREANFTL 169
           A       GSG       + ++  Q    LR+A FT+
Sbjct: 138 A-----ASGSGDAGPPLDERFTASQATDALRDAGFTI 169


>gi|293407667|gb|ADE44321.1| putative glycosyl transferase [Burkholderia pseudomallei]
          Length = 594

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           S  ++PL D+SVD V+    +E  +    M+ EI RVL  GG +I+  PNK
Sbjct: 116 SAADIPLDDASVDLVVSFETIEHHDQHEAMIREIKRVLRPGGLLIISSPNK 166


>gi|254392168|ref|ZP_05007356.1| methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|294812384|ref|ZP_06771027.1| Methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|326440784|ref|ZP_08215518.1| putative methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|197705843|gb|EDY51655.1| methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|294324983|gb|EFG06626.1| Methyltransferase [Streptomyces clavuligerus ATCC 27064]
          Length = 243

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG   NLP  D S D V++   LE   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALNLPFPDDSFDVVIISEVLEHIHDDKGVLAEMVRVLKPGGRIAVTVPRH 126

Query: 135 --KRGMWA 140
             +R  WA
Sbjct: 127 GPERICWA 134


>gi|148265045|ref|YP_001231751.1| methyltransferase type 11 [Geobacter uraniireducens Rf4]
 gi|146398545|gb|ABQ27178.1| transcriptional regulator, ArsR family [Geobacter uraniireducens
           Rf4]
          Length = 305

 Score = 42.4 bits (98), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           +LPL D + DC ++   L  A DP  +L EI RVLT+GG +++ 
Sbjct: 204 HLPLPDKAADCAVLNMVLHHAADPAAVLREIRRVLTAGGVLVLA 247


>gi|325201992|gb|ADY97446.1| conserved hypothetical protein [Neisseria meningitidis M01-240149]
          Length = 221

 Score = 42.4 bits (98), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S  N+ +AD S D +L  H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAENMAVADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFGR 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F    P    ++   L +  F +      ++ PP      ++ W   EK
Sbjct: 118 WFDGERLPEKRFCLPLP----ELKRQLADVGFDIEFGKFMVYLPPVSSIGQIRFWRFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|116621494|ref|YP_823650.1| type 11 methyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116224656|gb|ABJ83365.1| Methyltransferase type 11 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 226

 Score = 42.4 bits (98), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%)

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           Q  S   L   G LP  D S+D V+  H LE    P   L   +RVL +GG +I+ +P+ 
Sbjct: 57  QPVSPDVLADAGQLPFGDGSLDFVIASHILEHLPFPLACLRSWYRVLGAGGVLILKIPDM 116

Query: 136 R 136
           R
Sbjct: 117 R 117


>gi|157155536|ref|YP_001461378.1| putative methyltransferase [Escherichia coli E24377A]
 gi|157077566|gb|ABV17274.1| putative methyltransferase [Escherichia coli E24377A]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKFVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|116623443|ref|YP_825599.1| glycosyl transferase family protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226605|gb|ABJ85314.1| glycosyl transferase, family 2 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 467

 Score = 42.4 bits (98), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           A  +E  LP     +D V+ ++ +E  ED    L  I   L  GGR I++VP  + ++  
Sbjct: 321 AARAEDGLPFR-GQMDTVVCLNVVEHIEDDLSALRNIHAALVEGGRAIILVPEGQSIFCS 379

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           ++    G  + YS  Q+   +REA F +    R
Sbjct: 380 LDEE-LGHFRRYSESQLRGRMREAGFQVEALLR 411


>gi|238759158|ref|ZP_04620326.1| hypothetical protein yaldo0001_25220 [Yersinia aldovae ATCC 35236]
 gi|238702574|gb|EEP95123.1| hypothetical protein yaldo0001_25220 [Yersinia aldovae ATCC 35236]
          Length = 239

 Score = 42.4 bits (98), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 78  LASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125


>gi|119899884|ref|YP_935097.1| hypothetical protein azo3595 [Azoarcus sp. BH72]
 gi|119672297|emb|CAL96211.1| Hypothetical protein predicted by Glimmer/Critica [Azoarcus sp.
           BH72]
          Length = 831

 Score = 42.4 bits (98), Expect = 0.059,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 87  GNLPLA-----DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           G LP A     D + D V+    LE  +DP  +L E  RVL  GGR+I  VPN
Sbjct: 296 GLLPQALASYEDGAFDVVISFETLEHVDDPVALLEEFRRVLAPGGRLIASVPN 348


>gi|32477150|ref|NP_870144.1| ribosomal RNA large subunit methyltransferase A [Rhodopirellula
           baltica SH 1]
 gi|32447698|emb|CAD79299.1| ribosomal RNA large subunit methyltransferase A [Rhodopirellula
           baltica SH 1]
          Length = 273

 Score = 42.4 bits (98), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 9/100 (9%)

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           A  WP+  +      ++ +LP+AD SV CV+ +    F   P     EI RVLT  GR+I
Sbjct: 128 ARGWPEATW--IWANADRSLPVADGSVSCVMSL----FGRRP---ASEIARVLTEDGRLI 178

Query: 130 VVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTL 169
           V VP +  +    EH      +   W +++  +      L
Sbjct: 179 VAVPGEEDLIELREHVQQSGQRRSRWEKVVDEMAAEGLEL 218


>gi|73540424|ref|YP_294944.1| glycosyl transferase family protein [Ralstonia eutropha JMP134]
 gi|72117837|gb|AAZ60100.1| Glycosyl transferase, family 2:Glycosyl transferase, group 1
           [Ralstonia eutropha JMP134]
          Length = 1106

 Score = 42.4 bits (98), Expect = 0.059,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           +P+AD+ VD V+    +E   +   ML EI RVL  GG +I+  PNKR
Sbjct: 70  IPIADACVDVVVSFETIEHLTEQTEMLAEIRRVLRPGGVLIISSPNKR 117


>gi|323171000|gb|EFZ56649.1| methyltransferase domain protein [Escherichia coli LT-68]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|312195807|ref|YP_004015868.1| methyltransferase type 11 [Frankia sp. EuI1c]
 gi|311227143|gb|ADP79998.1| Methyltransferase type 11 [Frankia sp. EuI1c]
          Length = 633

 Score = 42.4 bits (98), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 97  DCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY 156
           D V M HYLE   DP   L      L+ GG +++ VPN   + AR+ + P  SG    W 
Sbjct: 468 DVVSMFHYLEHTRDPRADLDAAITALSPGGHLLIEVPNPESLSARV-YGPLWSG----WL 522

Query: 157 --QMISLLREANFTLSITSRSL 176
             Q + L+   N   ++T+R L
Sbjct: 523 APQHLHLIPADNLVDALTARGL 544


>gi|119510222|ref|ZP_01629360.1| hypothetical protein N9414_10568 [Nodularia spumigena CCY9414]
 gi|119465172|gb|EAW46071.1| hypothetical protein N9414_10568 [Nodularia spumigena CCY9414]
          Length = 313

 Score = 42.4 bits (98), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 86  EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP--NKRGMWARME 143
            G+ P  D+S+D V   + +E   D    ++EIWR+L  GG + + VP  + RG +    
Sbjct: 45  NGHFPFPDNSIDLVKAHNIIEHLPDRIHTMNEIWRILKPGGIVDISVPSTDGRGAFQDPT 104

Query: 144 HTPFGSGQPYSWY 156
           H  F +   + +Y
Sbjct: 105 HVSFWNVNSFMYY 117


>gi|29832276|ref|NP_826910.1| hypothetical protein SAV_5733 [Streptomyces avermitilis MA-4680]
 gi|29609395|dbj|BAC73445.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 244

 Score = 42.4 bits (98), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +++G LP A ++ D VL    +E   DP   L EI RVL  GG +++  PN
Sbjct: 98  LTDGGLPFASATADAVLFSEVIEHLVDPDGALDEIRRVLRPGGHLMLSTPN 148


>gi|242398685|ref|YP_002994109.1| SAM-dependent methyltransferase, UbiE/COQ5 family [Thermococcus
           sibiricus MM 739]
 gi|242265078|gb|ACS89760.1| SAM-dependent methyltransferase, UbiE/COQ5 family [Thermococcus
           sibiricus MM 739]
          Length = 213

 Score = 42.4 bits (98), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 11/81 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP  D S+D +LMV  + F +DP   L E +RVL  GG +I+      G   R  ++P 
Sbjct: 86  SLPFPDESLDYLLMVTTICFVDDPEKALREAYRVLKHGGALII------GFVDR--NSPI 137

Query: 148 GSGQPYSWYQMISLL-REANF 167
             GQ Y   +  S+  REA F
Sbjct: 138 --GQEYERNKEKSVFYREARF 156


>gi|169830857|ref|YP_001716839.1| type 11 methyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637701|gb|ACA59207.1| Methyltransferase type 11 [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 253

 Score = 42.4 bits (98), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           LP +D   D +  V+ L   ++P  +L E+ RVL  GGR+++V P  R
Sbjct: 110 LPFSDGEFDAIACVNVLYAVDEPLFLLQELRRVLREGGRLVLVTPIYR 157


>gi|317402507|gb|EFV83074.1| hypothetical protein HMPREF0005_02307 [Achromobacter xylosoxidans
           C54]
          Length = 259

 Score = 42.4 bits (98), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 62/152 (40%), Gaps = 21/152 (13%)

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           + S   L     LP    SVD +++ H  E   +P  +L E+ RVL   GR+++   N  
Sbjct: 78  WQSRVVLAQPEALPFESQSVDLLILPHAFECTSEPHNVLREVERVLVPEGRVVISGFNPW 137

Query: 137 GMWA---RMEHTPFGSGQPYS----------WYQMISL-LREANFTLSITSRSLFFPPTH 182
            MW    RM        QP S          W++++SL + +++F         + P   
Sbjct: 138 SMWGARTRMPGMEPWLPQPPSSQVSLPRLKDWFKLLSLEVEQSHF-------GCYAPACR 190

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            +  L+ W   E  G  +      +Y++ A K
Sbjct: 191 SEKWLQRWGFLESAGARWWSVGGAVYLVSAVK 222


>gi|225619499|ref|YP_002720756.1| type 11 methyltransferase [Brachyspira hyodysenteriae WA1]
 gi|225214318|gb|ACN83052.1| Methyltransferase type 11 [Brachyspira hyodysenteriae WA1]
          Length = 229

 Score = 42.4 bits (98), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 53/121 (43%), Gaps = 2/121 (1%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQYFSST 81
           A S++++     + G  + G  YA       +  +V  +L    A     N    +    
Sbjct: 41  ANSEIVNKYLTGLKGIEIGGASYADYGIDAINIDRVNISLDSNNAYYLEQNKHSSFIQDI 100

Query: 82  ALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
            ++S G+ LP  D++VD V   H LE   DP   L E +RV    G + +++P+K   + 
Sbjct: 101 DIISNGDDLPFKDNTVDFVFTSHVLEHFFDPIKALKEWYRVTKKDGYIFMIIPHKERTFD 160

Query: 141 R 141
           +
Sbjct: 161 K 161


>gi|31791507|ref|NP_854000.1| hypothetical protein Mb0336c [Mycobacterium bovis AF2122/97]
 gi|121636243|ref|YP_976466.1| hypothetical protein BCG_0368c [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|224988716|ref|YP_002643403.1| hypothetical protein JTY_0338 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|31617093|emb|CAD93200.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121491890|emb|CAL70353.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|224771829|dbj|BAH24635.1| hypothetical protein JTY_0338 [Mycobacterium bovis BCG str. Tokyo
           172]
          Length = 208

 Score = 42.4 bits (98), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARME 143
            LP+AD S+D VL VH   F+ DP   L +I R L  GGR+++  + + + + AR +
Sbjct: 109 TLPVADHSLDKVLGVHNFYFSPDPRASLCDIARALRPGGRLVLTSISDDQPLAARFD 165


>gi|237730197|ref|ZP_04560678.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226905736|gb|EEH91654.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 68/154 (44%), Gaps = 8/154 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +I+   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCSDPHRLLREADRVLIDDGWLILSGFNPVSLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
                PY+  +M +L+R+ ++   +    L +   H   +L       K+ +   P    
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWNKKGGKMLSAHIPALGC 198

Query: 207 IYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + ++ ARK   + +P+T +  K   S   + H V
Sbjct: 199 LQLVVARK---RTIPLTLNPMKQNKSKTPIRHAV 229


>gi|116626198|ref|YP_828354.1| glycosyl transferase family protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116229360|gb|ABJ88069.1| glycosyl transferase, family 2 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 488

 Score = 42.4 bits (98), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
           G+L   ++  D VL ++ LE+ E P  +L  +   L  GG ++V+VPN  G++  ++ + 
Sbjct: 325 GDLAELENCFDTVLCLNVLEYLEHPDAVLDALAATLRPGGALVVLVPNVPGVYGTLDRS- 383

Query: 147 FGSGQPYSWYQMISLLREANFTLS 170
            G  + YS   + +LL    FT+ 
Sbjct: 384 LGHKRRYSRASIGALLVSHGFTVE 407


>gi|47568418|ref|ZP_00239119.1| glycosyl transferase, group 2 family protein, putative [Bacillus
           cereus G9241]
 gi|47554966|gb|EAL13316.1| glycosyl transferase, group 2 family protein, putative [Bacillus
           cereus G9241]
          Length = 229

 Score = 42.4 bits (98), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + NLP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKINLPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|317403781|gb|EFV84261.1| hypothetical protein HMPREF0005_03687 [Achromobacter xylosoxidans
           C54]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q   N PD  FS   + +      +D   D ++M   LE  EDP L+L    R L  GG+
Sbjct: 76  QFRQNTPD--FSGEIIETYFEDYTSDERFDVIVMGFILEHVEDPDLILSRYRRFLKPGGK 133

Query: 128 MIVVVPNKRGMWARM 142
           M V VPN + +  R+
Sbjct: 134 MYVAVPNAKSLNRRL 148


>gi|191171467|ref|ZP_03033016.1| putative methyltransferase [Escherichia coli F11]
 gi|300990974|ref|ZP_07179424.1| methyltransferase domain protein [Escherichia coli MS 200-1]
 gi|190908401|gb|EDV67991.1| putative methyltransferase [Escherichia coli F11]
 gi|300305640|gb|EFJ60160.1| methyltransferase domain protein [Escherichia coli MS 200-1]
 gi|324011828|gb|EGB81047.1| methyltransferase domain protein [Escherichia coli MS 60-1]
          Length = 240

 Score = 42.4 bits (98), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|256391334|ref|YP_003112898.1| methyltransferase type 11 [Catenulispora acidiphila DSM 44928]
 gi|256357560|gb|ACU71057.1| Methyltransferase type 11 [Catenulispora acidiphila DSM 44928]
          Length = 237

 Score = 42.0 bits (97), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN---KRGMWARME- 143
            LP AD + D V+    LE   D  L + E+ RVL  GGR+ V VP    ++  WA  + 
Sbjct: 79  GLPFADGTFDAVVAAEVLEHLPDDRLAMSELVRVLKPGGRLAVTVPRWFPEKVCWALSDA 138

Query: 144 --HTPFGSGQPYSWYQMISLLREAN 166
                 G  + Y   +MI  LR A 
Sbjct: 139 YHEVEGGHIRIYKRREMIDKLRAAG 163


>gi|312970311|ref|ZP_07784492.1| methyltransferase domain protein [Escherichia coli 1827-70]
 gi|310336960|gb|EFQ02098.1| methyltransferase domain protein [Escherichia coli 1827-70]
 gi|323165912|gb|EFZ51694.1| methyltransferase domain protein [Shigella sonnei 53G]
 gi|323181625|gb|EFZ67040.1| methyltransferase domain protein [Escherichia coli 1357]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 73  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 132

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 133 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 181

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 182 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 212


>gi|114776435|ref|ZP_01451480.1| hypothetical protein SPV1_01907 [Mariprofundus ferrooxydans PV-1]
 gi|114553265|gb|EAU55663.1| hypothetical protein SPV1_01907 [Mariprofundus ferrooxydans PV-1]
          Length = 255

 Score = 42.0 bits (97), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME 143
           +++G LP  D+  D V      E  E+   ++ EI+R+L  GG +I+  PN   M +RM 
Sbjct: 79  LNQGALPYPDTHFDLVTFTEVAEHLENYRAIVREIYRILKPGGVVIITTPNVLNMKSRMR 138


>gi|323191552|gb|EFZ76812.1| methyltransferase domain protein [Escherichia coli RN587/1]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 73  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 132

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 133 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 181

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 182 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 212


>gi|317047019|ref|YP_004114667.1| type 11 methyltransferase [Pantoea sp. At-9b]
 gi|316948636|gb|ADU68111.1| Methyltransferase type 11 [Pantoea sp. At-9b]
          Length = 244

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 20/162 (12%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-------KRGMWA 140
            LP    S+D  L+ H L +++DP  +L E+ RVL   G MI+   N        +G+  
Sbjct: 83  QLPFESKSIDACLLAHTLSWSQDPHRVLREVDRVLIDDGWMIISGFNPFSLLGISKGIPG 142

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
                P+ SG+ +S  +++  L   N+ +   +R     P H++          K+ +  
Sbjct: 143 LHGRAPW-SGRMFSQMRLLDWLHLLNYEVVYRTR-FQVVPWHRQG--------GKVISAH 192

Query: 201 GPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
            P    + V+ ARK  +   P+T +K K   S   +  TV+ 
Sbjct: 193 LPALGCLNVVVARKRTF---PLTPTKVKKSLSKTQLRQTVNA 231


>gi|229524238|ref|ZP_04413643.1| SAM-dependent methyltransferase [Vibrio cholerae bv. albensis
           VL426]
 gi|229337819|gb|EEO02836.1| SAM-dependent methyltransferase [Vibrio cholerae bv. albensis
           VL426]
          Length = 245

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 76/171 (44%), Gaps = 14/171 (8%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYVIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ ++  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQKYR---PFWTWL 191

Query: 194 EK-IGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E  +G    P    +Y I ARK      PI ++ + K   SPI V + V++
Sbjct: 192 ENGLGGSNSP-CGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGVNYRVNS 241


>gi|218552788|ref|YP_002385701.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI1]
 gi|218359556|emb|CAQ97096.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI1]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|170680838|ref|YP_001742336.1| putative methyltransferase [Escherichia coli SMS-3-5]
 gi|215485369|ref|YP_002327800.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218557149|ref|YP_002390062.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           coli S88]
 gi|218688083|ref|YP_002396295.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli ED1a]
 gi|218698840|ref|YP_002406469.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI39]
 gi|227884792|ref|ZP_04002597.1| methyltransferase [Escherichia coli 83972]
 gi|256020179|ref|ZP_05434044.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Shigella sp. D9]
 gi|293418307|ref|ZP_06660742.1| yafS protein [Escherichia coli B088]
 gi|300819827|ref|ZP_07100013.1| methyltransferase domain protein [Escherichia coli MS 107-1]
 gi|300905644|ref|ZP_07123390.1| methyltransferase domain protein [Escherichia coli MS 84-1]
 gi|300919147|ref|ZP_07135680.1| methyltransferase domain protein [Escherichia coli MS 115-1]
 gi|300988191|ref|ZP_07178592.1| methyltransferase domain protein [Escherichia coli MS 45-1]
 gi|301050548|ref|ZP_07197421.1| methyltransferase domain protein [Escherichia coli MS 185-1]
 gi|301305770|ref|ZP_07211856.1| methyltransferase domain protein [Escherichia coli MS 124-1]
 gi|306813367|ref|ZP_07447560.1| putative methyltransferase [Escherichia coli NC101]
 gi|312964725|ref|ZP_07778976.1| methyltransferase domain protein [Escherichia coli 2362-75]
 gi|331656203|ref|ZP_08357165.1| methyltransferase domain protein [Escherichia coli TA206]
 gi|331661584|ref|ZP_08362507.1| methyltransferase domain protein [Escherichia coli TA143]
 gi|331681594|ref|ZP_08382230.1| methyltransferase domain protein [Escherichia coli H299]
 gi|170518556|gb|ACB16734.1| putative methyltransferase [Escherichia coli SMS-3-5]
 gi|215263441|emb|CAS07761.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218363918|emb|CAR01583.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli S88]
 gi|218368826|emb|CAR16574.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI39]
 gi|218425647|emb|CAR06434.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli ED1a]
 gi|222032038|emb|CAP74777.1| Uncharacterized protein yafS [Escherichia coli LF82]
 gi|227838233|gb|EEJ48699.1| methyltransferase [Escherichia coli 83972]
 gi|281177433|dbj|BAI53763.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|291324835|gb|EFE64250.1| yafS protein [Escherichia coli B088]
 gi|294492696|gb|ADE91452.1| putative methyltransferase [Escherichia coli IHE3034]
 gi|300297756|gb|EFJ54141.1| methyltransferase domain protein [Escherichia coli MS 185-1]
 gi|300402536|gb|EFJ86074.1| methyltransferase domain protein [Escherichia coli MS 84-1]
 gi|300407505|gb|EFJ91043.1| methyltransferase domain protein [Escherichia coli MS 45-1]
 gi|300413745|gb|EFJ97055.1| methyltransferase domain protein [Escherichia coli MS 115-1]
 gi|300527585|gb|EFK48647.1| methyltransferase domain protein [Escherichia coli MS 107-1]
 gi|300838945|gb|EFK66705.1| methyltransferase domain protein [Escherichia coli MS 124-1]
 gi|305854130|gb|EFM54569.1| putative methyltransferase [Escherichia coli NC101]
 gi|307552060|gb|ADN44835.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli ABU 83972]
 gi|307628305|gb|ADN72609.1| putative methyltransferase [Escherichia coli UM146]
 gi|312290746|gb|EFR18624.1| methyltransferase domain protein [Escherichia coli 2362-75]
 gi|312944816|gb|ADR25643.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|315253527|gb|EFU33495.1| methyltransferase domain protein [Escherichia coli MS 85-1]
 gi|315289703|gb|EFU49096.1| methyltransferase domain protein [Escherichia coli MS 110-3]
 gi|315300180|gb|EFU59417.1| methyltransferase domain protein [Escherichia coli MS 16-3]
 gi|320197300|gb|EFW71916.1| hypothetical protein EcoM_00496 [Escherichia coli WV_060327]
 gi|323945581|gb|EGB41631.1| methyltransferase domain-containing protein [Escherichia coli H120]
 gi|323948753|gb|EGB44653.1| methyltransferase domain-containing protein [Escherichia coli H252]
 gi|323958797|gb|EGB54496.1| methyltransferase domain-containing protein [Escherichia coli H263]
 gi|323963756|gb|EGB59258.1| methyltransferase domain-containing protein [Escherichia coli M863]
 gi|324009119|gb|EGB78338.1| methyltransferase domain protein [Escherichia coli MS 57-2]
 gi|327254932|gb|EGE66542.1| methyltransferase domain protein [Escherichia coli STEC_7v]
 gi|330910059|gb|EGH38569.1| SAM-dependent methyltransferase [Escherichia coli AA86]
 gi|331054451|gb|EGI26460.1| methyltransferase domain protein [Escherichia coli TA206]
 gi|331060006|gb|EGI31970.1| methyltransferase domain protein [Escherichia coli TA143]
 gi|331081168|gb|EGI52330.1| methyltransferase domain protein [Escherichia coli H299]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|77460289|ref|YP_349796.1| hypothetical protein Pfl01_4068 [Pseudomonas fluorescens Pf0-1]
 gi|77384292|gb|ABA75805.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 678

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           +PL D SVD +   H+LE A D    + EI+RV   G ++ ++ P
Sbjct: 43  IPLQDDSVDMLFSSHFLEHARDLMFTMREIYRVCKHGAQVCIIAP 87


>gi|296123896|ref|YP_003631674.1| hypothetical protein Plim_3663 [Planctomyces limnophilus DSM 3776]
 gi|296016236|gb|ADG69475.1| conserved hypothetical protein [Planctomyces limnophilus DSM 3776]
          Length = 262

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
           LA++S D V+  H +E AEDP  ++    RV+  GG + + +P+ RG + R  H P
Sbjct: 106 LANTSQDFVIANHMIEHAEDPVSVIENFLRVVKPGGVIYLTIPDMRGTFDR--HRP 159


>gi|218703462|ref|YP_002410981.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli UMN026]
 gi|293403292|ref|ZP_06647383.1| yafS protein [Escherichia coli FVEC1412]
 gi|293408302|ref|ZP_06652141.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298378906|ref|ZP_06988787.1| yafS protein [Escherichia coli FVEC1302]
 gi|300900031|ref|ZP_07118228.1| methyltransferase domain protein [Escherichia coli MS 198-1]
 gi|301021447|ref|ZP_07185471.1| methyltransferase domain protein [Escherichia coli MS 69-1]
 gi|218430559|emb|CAR11425.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli UMN026]
 gi|291429145|gb|EFF02165.1| yafS protein [Escherichia coli FVEC1412]
 gi|291471480|gb|EFF13963.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298280019|gb|EFI21523.1| yafS protein [Escherichia coli FVEC1302]
 gi|300356436|gb|EFJ72306.1| methyltransferase domain protein [Escherichia coli MS 198-1]
 gi|300398083|gb|EFJ81621.1| methyltransferase domain protein [Escherichia coli MS 69-1]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|193067603|ref|ZP_03048570.1| putative methyltransferase [Escherichia coli E110019]
 gi|192959015|gb|EDV89451.1| putative methyltransferase [Escherichia coli E110019]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 84/222 (37%), Gaps = 31/222 (13%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A+ + L+  +  + G  LL +G      +C    V   +     G       D 
Sbjct: 22  GELYRKALERQLNPWFTKMYGFHLLKIGNLSAEINCEACAVSHQVNVSAQGMPVQEQADP 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                      +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N  
Sbjct: 82  L----------HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPI 131

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKL 189
            +    +  P      PY+  +M +L+R+       NF +   SR    P          
Sbjct: 132 SLMGLRKLVPVLRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP---------- 180

Query: 190 WSVF-EKIGNIFGPGFAGIYVIEARK--ILYQGLPITESKKK 228
           W+    K+ N   P    + +I ARK  I     P+ +SK K
Sbjct: 181 WNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|309700415|emb|CBI99704.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|123966572|ref|YP_001011653.1| hypothetical protein P9515_13391 [Prochlorococcus marinus str. MIT
           9515]
 gi|123200938|gb|ABM72546.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9515]
          Length = 214

 Score = 42.0 bits (97), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           ++PL   SVDC LMV   ++ + P  +  EI R+L++ G++IV   N R  W +
Sbjct: 101 DIPLESGSVDCCLMVAAWQYLQYPEKLTKEIARILSNRGKIIVSFSN-RAFWHK 153


>gi|141450|sp|P20187|YT37_STRFR RecName: Full=Uncharacterized 37.1 kDa protein in transposon TN4556
 gi|1196914|gb|AAA88564.1| unknown protein [Streptomyces fradiae]
          Length = 345

 Score = 42.0 bits (97), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            LPL D S+DC      L+   DP   L E  RVL  GGR+++  P+
Sbjct: 186 TLPLEDGSIDCARTDRVLQHVADPAQALAEARRVLRPGGRLVMGEPD 232


>gi|170021439|ref|YP_001726393.1| methyltransferase type 11 [Escherichia coli ATCC 8739]
 gi|187730232|ref|YP_001879010.1| putative methyltransferase [Shigella boydii CDC 3083-94]
 gi|191167055|ref|ZP_03028877.1| putative methyltransferase [Escherichia coli B7A]
 gi|194438242|ref|ZP_03070334.1| putative methyltransferase [Escherichia coli 101-1]
 gi|209917400|ref|YP_002291484.1| hypothetical protein ECSE_0209 [Escherichia coli SE11]
 gi|253774765|ref|YP_003037596.1| methyltransferase type 11 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254160327|ref|YP_003043435.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli B str. REL606]
 gi|297518676|ref|ZP_06937062.1| putative methyltransferase [Escherichia coli OP50]
 gi|300823398|ref|ZP_07103528.1| methyltransferase domain protein [Escherichia coli MS 119-7]
 gi|300927905|ref|ZP_07143465.1| methyltransferase domain protein [Escherichia coli MS 187-1]
 gi|309797928|ref|ZP_07692308.1| methyltransferase domain protein [Escherichia coli MS 145-7]
 gi|331666454|ref|ZP_08367334.1| methyltransferase domain protein [Escherichia coli TA271]
 gi|169756367|gb|ACA79066.1| Methyltransferase type 11 [Escherichia coli ATCC 8739]
 gi|187427224|gb|ACD06498.1| putative methyltransferase [Shigella boydii CDC 3083-94]
 gi|190902948|gb|EDV62675.1| putative methyltransferase [Escherichia coli B7A]
 gi|194422906|gb|EDX38901.1| putative methyltransferase [Escherichia coli 101-1]
 gi|209910659|dbj|BAG75733.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|242376043|emb|CAQ30728.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BL21(DE3)]
 gi|253325809|gb|ACT30411.1| Methyltransferase type 11 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253972228|gb|ACT37899.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli B str. REL606]
 gi|253976437|gb|ACT42107.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BL21(DE3)]
 gi|300464060|gb|EFK27553.1| methyltransferase domain protein [Escherichia coli MS 187-1]
 gi|300524016|gb|EFK45085.1| methyltransferase domain protein [Escherichia coli MS 119-7]
 gi|308118468|gb|EFO55730.1| methyltransferase domain protein [Escherichia coli MS 145-7]
 gi|320173693|gb|EFW48882.1| hypothetical protein SDB_03795 [Shigella dysenteriae CDC 74-1112]
 gi|320186399|gb|EFW61131.1| hypothetical protein SGF_01403 [Shigella flexneri CDC 796-83]
 gi|323963576|gb|EGB59133.1| methyltransferase domain-containing protein [Escherichia coli H489]
 gi|323972505|gb|EGB67711.1| methyltransferase domain-containing protein [Escherichia coli
           TA007]
 gi|324020675|gb|EGB89894.1| methyltransferase domain protein [Escherichia coli MS 117-3]
 gi|324115457|gb|EGC09399.1| methyltransferase domain-containing protein [Escherichia coli
           E1167]
 gi|331066299|gb|EGI38177.1| methyltransferase domain protein [Escherichia coli TA271]
 gi|332093745|gb|EGI98800.1| methyltransferase domain protein [Shigella boydii 3594-74]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|110640428|ref|YP_668156.1| hypothetical protein ECP_0219 [Escherichia coli 536]
 gi|110342020|gb|ABG68257.1| hypothetical protein YafS [Escherichia coli 536]
 gi|284919983|emb|CBG33038.1| conserved hypothetical protein [Escherichia coli 042]
          Length = 241

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 84  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 143

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 144 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 192

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 193 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 223


>gi|254515894|ref|ZP_05127954.1| Methyltransferase domain family protein [gamma proteobacterium
           NOR5-3]
 gi|219675616|gb|EED31982.1| Methyltransferase domain family protein [gamma proteobacterium
           NOR5-3]
          Length = 887

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 37  GCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLA---- 92
           G R+L LG +    S   G+  + +  +   Q A ++  +   S +  ++ N+  +    
Sbjct: 34  GERILDLGCSQGISSILLGREGKRVLGIDFDQSAIDFAKEKLKSESKDTQNNVAFSTQNF 93

Query: 93  ------DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
                 +++  C+ +   LE   DP  ++   W +L  GGR+I+ VP
Sbjct: 94  LSPEFQEANFSCIFLCEVLEHLLDPGAIVQRSWELLDKGGRIIITVP 140


>gi|114563377|ref|YP_750890.1| methyltransferase type 11 [Shewanella frigidimarina NCIMB 400]
 gi|114334670|gb|ABI72052.1| Methyltransferase type 11 [Shewanella frigidimarina NCIMB 400]
          Length = 259

 Score = 42.0 bits (97), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 46/115 (40%), Gaps = 11/115 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+     I   L+  W  + G   L  G      +  H  + R  +    G  A    D 
Sbjct: 13  GELLQAEIEAKLAPWWPRIFGYHFLKAGALSSQLNSLHCNIARHFSVY-DGSDANIQADP 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           +          +LP+  S++D VL    LEF  DP+ +L E  RVL S G + +V
Sbjct: 72  H----------HLPVQQSAIDAVLSCFLLEFESDPYQILREFDRVLISSGYIFIV 116


>gi|269213591|ref|ZP_05982335.2| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269146051|gb|EEZ72469.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 221

 Score = 42.0 bits (97), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 13/133 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA--- 140
           +S   + LAD S D +L+ H LE    P  +L E  R+L   GR+++   N   +W    
Sbjct: 59  MSAEEMALADISADMLLLPHTLECG-IPSQILSEAHRILKPSGRLMLTGFNPYSLWGLGS 117

Query: 141 -----RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                R+    F      S +++   L +A F +      ++ P       ++ W   EK
Sbjct: 118 WFDGVRLPEKRF----CLSLHELKKQLADAGFDIEYGKFMVYLPAVSSLGKIRFWQFMEK 173

Query: 196 IGNIFGPGFAGIY 208
            G+ + P  A +Y
Sbjct: 174 AGDRWWPQCAAVY 186


>gi|225075627|ref|ZP_03718826.1| hypothetical protein NEIFLAOT_00643 [Neisseria flavescens
           NRL30031/H210]
 gi|224953049|gb|EEG34258.1| hypothetical protein NEIFLAOT_00643 [Neisseria flavescens
           NRL30031/H210]
          Length = 225

 Score = 42.0 bits (97), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 58/141 (41%), Gaps = 7/141 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-----RME 143
           L     SVD +LM H LE +    L+L E +R+L   GR+I+   N + +W        +
Sbjct: 68  LAFETHSVDVLLMPHLLEISSAD-LVLQEAFRILKPEGRLILTGFNPKSLWGLSSWFDGK 126

Query: 144 HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPG 203
             P  S Q  +  ++        F +       + P  +    L+ W   EK G+ + P 
Sbjct: 127 RLPMKS-QCLALAELKRKTVAIGFEMEYGQFMDYLPAVNSPSALRFWQFMEKAGDRWWPQ 185

Query: 204 FAGIYVIEARKILYQGLPITE 224
            A +Y +   K L    P+ E
Sbjct: 186 CAAVYGVVLTKHLIGVHPLPE 206


>gi|238755082|ref|ZP_04616429.1| hypothetical protein yruck0001_22750 [Yersinia ruckeri ATCC 29473]
 gi|238706642|gb|EEP99012.1| hypothetical protein yruck0001_22750 [Yersinia ruckeri ATCC 29473]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 56/142 (39%), Gaps = 17/142 (11%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGY---AIPFFSCFHGKVERTLAFMPAGQGATNW 73
           G+    AI + L   W    G  LL +G     I   SC             A     N 
Sbjct: 13  GEYYRAAIEQQLQPWWPKFFGFHLLKIGQLSAEIASGSC-------------AISHQVNV 59

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            +Q  +   L S   LP A+ SVD  L+ H L ++ DP  +L E  RVL   G +I+   
Sbjct: 60  GEQGRNMQVLASPYQLPFAEKSVDACLLSHSLTYSVDPHRILREADRVLIDDGWLIITAF 119

Query: 134 NKRGMWARMEHTP-FGSGQPYS 154
           N   +    +  P   S QPY+
Sbjct: 120 NPMSLLGVGKLLPVIRSRQPYA 141


>gi|194432811|ref|ZP_03065096.1| putative methyltransferase [Shigella dysenteriae 1012]
 gi|293413468|ref|ZP_06656117.1| yafS protein [Escherichia coli B185]
 gi|194419073|gb|EDX35157.1| putative methyltransferase [Shigella dysenteriae 1012]
 gi|291433526|gb|EFF06499.1| yafS protein [Escherichia coli B185]
 gi|320179850|gb|EFW54796.1| hypothetical protein SGB_02965 [Shigella boydii ATCC 9905]
 gi|320638233|gb|EFX07961.1| hypothetical protein ECO5101_15255 [Escherichia coli O157:H7 str.
           G5101]
 gi|320643617|gb|EFX12761.1| hypothetical protein ECO9389_15429 [Escherichia coli O157:H- str.
           493-89]
 gi|320650353|gb|EFX18830.1| hypothetical protein ECO2687_14976 [Escherichia coli O157:H- str. H
           2687]
 gi|320654628|gb|EFX22629.1| hypothetical protein ECO7815_10227 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660196|gb|EFX27706.1| hypothetical protein ECO5905_08743 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665447|gb|EFX32509.1| hypothetical protein ECOSU61_12455 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323938756|gb|EGB35002.1| methyltransferase domain-containing protein [Escherichia coli
           E1520]
 gi|332097567|gb|EGJ02546.1| methyltransferase domain protein [Shigella dysenteriae 155-74]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|78223384|ref|YP_385131.1| ubiquinone/menaquinone biosynthesis methylase-like protein
           [Geobacter metallireducens GS-15]
 gi|78194639|gb|ABB32406.1| Methylase involved in ubiquinone/menaquinone biosynthesis-like
           protein [Geobacter metallireducens GS-15]
          Length = 345

 Score = 42.0 bits (97), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 84  VSEGNL---PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V++G+L   P  D++ D V++ H +E   +P  +L E +R+L  GG + +V PN   M +
Sbjct: 184 VAQGDLLEQPYGDNTFDAVMISHVIEHVPNPVELLTECYRILKPGGVLSLVTPNVESMGS 243

Query: 141 RM 142
            +
Sbjct: 244 HL 245


>gi|293602511|ref|ZP_06684957.1| family 2 glycosyl transferase [Achromobacter piechaudii ATCC 43553]
 gi|292819273|gb|EFF78308.1| family 2 glycosyl transferase [Achromobacter piechaudii ATCC 43553]
          Length = 251

 Score = 42.0 bits (97), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 86  EGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           EGN   +PL D SVD V+    +E  +    M+ EI RVLT  G MI+  PNK+
Sbjct: 84  EGNAASIPLPDHSVDIVVSFETIEHHDQHEEMMSEIRRVLTPDGLMIMSSPNKQ 137


>gi|323160258|gb|EFZ46215.1| methyltransferase domain protein [Escherichia coli E128010]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 73  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 132

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 133 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 181

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 182 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 212


>gi|313646730|gb|EFS11189.1| methyltransferase domain protein [Shigella flexneri 2a str. 2457T]
 gi|332761996|gb|EGJ92268.1| methyltransferase domain protein [Shigella flexneri 4343-70]
 gi|332764637|gb|EGJ94867.1| methyltransferase domain protein [Shigella flexneri K-671]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 73  HLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 132

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 133 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 181

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 182 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 212


>gi|14601700|ref|NP_148241.1| hypothetical protein APE_1889 [Aeropyrum pernix K1]
 gi|5105581|dbj|BAA80894.1| conserved hypothetical protein [Aeropyrum pernix K1]
          Length = 224

 Score = 42.0 bits (97), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            +P         L+V  L FA+DP  +L E+WRVL  GG ++  +  +   W        
Sbjct: 95  RMPFRSRVFGSALIVVTLCFADDPQELLREVWRVLAWGGVLVSCIVPRDSSWGEYYEAKG 154

Query: 148 GSGQP-YSWYQMI------SLLREANFTLSITSRSLFF 178
            +G P YS  + I      ++L+ A F+L     +L F
Sbjct: 155 RAGHPFYSKARFITNEMHHTMLKNAGFSLERQYATLSF 192


>gi|332095031|gb|EGJ00066.1| methyltransferase domain protein [Shigella boydii 5216-82]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|309787112|ref|ZP_07681724.1| methyltransferase domain protein [Shigella dysenteriae 1617]
 gi|308924690|gb|EFP70185.1| methyltransferase domain protein [Shigella dysenteriae 1617]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWFSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|260842439|ref|YP_003220217.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|257757586|dbj|BAI29083.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O103:H2 str. 12009]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|271969427|ref|YP_003343623.1| type 11 methyltransferase [Streptosporangium roseum DSM 43021]
 gi|270512602|gb|ACZ90880.1| methyltransferase type 11 [Streptosporangium roseum DSM 43021]
          Length = 237

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 56/131 (42%), Gaps = 6/131 (4%)

Query: 39  RLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDC 98
            +L  G  +  F     ++E   +   A   A   P    + T       +P  D+S D 
Sbjct: 30  EVLRRGADVVAFDMDAEELEGVASMFAAMDKAGEVPPGATAETVTGDALKMPFEDASFDR 89

Query: 99  VLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN---KRGMWARME--HT-PFGSGQP 152
           V+    LE   D    + EI+RVL  GGR  + VP+   +R  WA  E  HT P G  + 
Sbjct: 90  VIAAEVLEHIPDDMAAMREIFRVLKPGGRAAITVPSFLPERICWALDEAYHTAPGGHVRI 149

Query: 153 YSWYQMISLLR 163
           Y+  ++ + L+
Sbjct: 150 YTLAELSAKLK 160


>gi|110804260|ref|YP_687780.1| hypothetical protein SFV_0197 [Shigella flexneri 5 str. 8401]
 gi|110613808|gb|ABF02475.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|332754124|gb|EGJ84494.1| methyltransferase domain protein [Shigella flexneri 2747-71]
 gi|333008986|gb|EGK28445.1| methyltransferase domain protein [Shigella flexneri K-218]
 gi|333009686|gb|EGK29136.1| methyltransferase domain protein [Shigella flexneri VA-6]
 gi|333022180|gb|EGK41420.1| methyltransferase domain protein [Shigella flexneri K-304]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|323176525|gb|EFZ62117.1| methyltransferase domain protein [Escherichia coli 1180]
          Length = 230

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 73  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 132

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 133 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 181

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 182 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 212


>gi|74310828|ref|YP_309247.1| hypothetical protein SSON_0227 [Shigella sonnei Ss046]
 gi|331675871|ref|ZP_08376588.1| methyltransferase domain protein [Escherichia coli H591]
 gi|73854305|gb|AAZ87012.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|331076431|gb|EGI47708.1| methyltransferase domain protein [Escherichia coli H591]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 89  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 148

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 149 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 197

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 198 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 228


>gi|24111644|ref|NP_706154.1| hypothetical protein SF0199 [Shigella flexneri 2a str. 301]
 gi|30061765|ref|NP_835936.1| hypothetical protein S0207 [Shigella flexneri 2a str. 2457T]
 gi|82542806|ref|YP_406753.1| hypothetical protein SBO_0202 [Shigella boydii Sb227]
 gi|24050417|gb|AAN41861.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040007|gb|AAP15741.1| hypothetical protein S0207 [Shigella flexneri 2a str. 2457T]
 gi|81244217|gb|ABB64925.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|281599564|gb|ADA72548.1| hypothetical protein SFxv_0211 [Shigella flexneri 2002017]
          Length = 241

 Score = 42.0 bits (97), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 84  HLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 143

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 144 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 192

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 193 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 223


>gi|262404571|ref|ZP_06081126.1| SAM-dependent methyltransferase [Vibrio sp. RC586]
 gi|262349603|gb|EEY98741.1| SAM-dependent methyltransferase [Vibrio sp. RC586]
          Length = 245

 Score = 42.0 bits (97), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 12/170 (7%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG--- 137
           T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +I+   N      
Sbjct: 76  TVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYVIITGFNPISFIG 135

Query: 138 ----MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
               M  R  + P+ SG+ Y+  ++   L   N+ +    +   FP    +     W+  
Sbjct: 136 LASLMPWRKNNLPW-SGRMYTPNRIKDWLSVLNYQVIECDQYALFPMQKYR---PFWTWL 191

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVPHTVST 242
           E            +Y I ARK      PI ++ + K   SP+ V + V++
Sbjct: 192 ENGIGETSSVLGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGVNYRVNS 241


>gi|157159674|ref|YP_001456992.1| putative methyltransferase [Escherichia coli HS]
 gi|193063286|ref|ZP_03044377.1| putative methyltransferase [Escherichia coli E22]
 gi|194427550|ref|ZP_03060098.1| putative methyltransferase [Escherichia coli B171]
 gi|218693675|ref|YP_002401342.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli 55989]
 gi|307314697|ref|ZP_07594295.1| Methyltransferase type 11 [Escherichia coli W]
 gi|157065354|gb|ABV04609.1| putative methyltransferase [Escherichia coli HS]
 gi|192931194|gb|EDV83797.1| putative methyltransferase [Escherichia coli E22]
 gi|194414320|gb|EDX30594.1| putative methyltransferase [Escherichia coli B171]
 gi|218350407|emb|CAU96092.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli 55989]
 gi|306905816|gb|EFN36341.1| Methyltransferase type 11 [Escherichia coli W]
 gi|315059426|gb|ADT73753.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli W]
 gi|320201192|gb|EFW75775.1| hypothetical protein ECoL_01618 [Escherichia coli EC4100B]
 gi|323380015|gb|ADX52283.1| Methyltransferase type 11 [Escherichia coli KO11]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|328951763|ref|YP_004369097.1| Methyltransferase type 11 [Desulfobacca acetoxidans DSM 11109]
 gi|328452087|gb|AEB07916.1| Methyltransferase type 11 [Desulfobacca acetoxidans DSM 11109]
          Length = 207

 Score = 42.0 bits (97), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 26/42 (61%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LPLA  S D VLM+  L F +DP L L E  RVL   GR+I+
Sbjct: 84  LPLAPGSFDVVLMITVLCFLQDPPLALREATRVLKPQGRLII 125


>gi|315445657|ref|YP_004078536.1| methyltransferase family protein [Mycobacterium sp. Spyr1]
 gi|315263960|gb|ADU00702.1| methyltransferase family protein [Mycobacterium sp. Spyr1]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 6/85 (7%)

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           A N PD    ++++    +LP  D + D V   H +E   DP   L E+ RVL  GG + 
Sbjct: 72  AANIPDFELQTSSVQ---DLPFPDDTFDMVFFHHVIEHVTDPAESLRELARVLRPGGIIY 128

Query: 130 VVVPNKR---GMWARMEHTPFGSGQ 151
           V  PN+    G     + TP    Q
Sbjct: 129 VGTPNRHRAIGYLGSFDATPLQKVQ 153


>gi|254389949|ref|ZP_05005171.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294813959|ref|ZP_06772602.1| Methyltransferase type 11 [Streptomyces clavuligerus ATCC 27064]
 gi|326442369|ref|ZP_08217103.1| type 11 methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|197703658|gb|EDY49470.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294326558|gb|EFG08201.1| Methyltransferase type 11 [Streptomyces clavuligerus ATCC 27064]
          Length = 367

 Score = 42.0 bits (97), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 13/114 (11%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM--EHT 145
            LP AD S D       L+  +DP  +L EI RVL  GGR+++  P+    W  +  +H 
Sbjct: 205 RLPFADRSADRARTDRALQHVDDPVRVLAEIRRVLRPGGRLVLGEPD----WDSLTVDHP 260

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSL---FFPPTHKKCILKLWSVFEKI 196
              + + Y+ +    ++R       +   +L   F  P     +L + SVF  +
Sbjct: 261 DRETSRAYTRFVADRVIRNGTLGRELPRLALAAGFTVP----AVLPVVSVFRDV 310


>gi|300936084|ref|ZP_07151026.1| methyltransferase domain protein [Escherichia coli MS 21-1]
 gi|300458759|gb|EFK22252.1| methyltransferase domain protein [Escherichia coli MS 21-1]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|291616381|ref|YP_003519123.1| YafS [Pantoea ananatis LMG 20103]
 gi|291151411|gb|ADD75995.1| YafS [Pantoea ananatis LMG 20103]
 gi|327392832|dbj|BAK10254.1| hypothetical protein YafS [Pantoea ananatis AJ13355]
          Length = 244

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           L +   LP    SVD  L+ H L +++DP  +L E+ RVL   G MI+
Sbjct: 78  LANPAQLPFESKSVDACLLAHTLSWSQDPHRILREVDRVLIDDGWMII 125


>gi|104782588|ref|YP_609086.1| hypothetical protein PSEEN3560 [Pseudomonas entomophila L48]
 gi|95111575|emb|CAK16295.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 259

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 66/158 (41%), Gaps = 3/158 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-- 140
           +  E   PL++ + D V++ H L+F+  P  +L E    +  GG +++V  N    W   
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFSLSPHGLLREAASAVRPGGHLLIVGINPWSSWGIR 143

Query: 141 -RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
               H      +  S  ++   L    F L       + PP       +  + +E++   
Sbjct: 144 HLFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASPAWQQRLAGWERVAGG 203

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           +     G+Y++ ARK++    P+   +++ +   + +P
Sbjct: 204 WQSAGGGVYLLVARKMVVGLRPLRLERREPMGKLLPLP 241


>gi|34496710|ref|NP_900925.1| hypothetical protein CV_1255 [Chromobacterium violaceum ATCC 12472]
 gi|34102565|gb|AAQ58930.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 254

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 57/132 (43%), Gaps = 7/132 (5%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------RM 142
           LP    S+D ++M H L+F   P  +L E  RVL   GR+I+   N   +W         
Sbjct: 75  LPFETRSLDLLVMPHVLDFTTQPHQVLREADRVLMPEGRLILTGFNPLSLWGVRRLIQGK 134

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           E  P+ +G  ++  ++   L      L  ++   + PP  ++  L      E  G  + P
Sbjct: 135 ESAPW-NGSFFTQLRIKDWLALLELELDDSAFMAYAPPFSRQDWLGRCGFMEDAGERWWP 193

Query: 203 GFAGIYVIEARK 214
              G+Y IEA K
Sbjct: 194 LAGGVYGIEAVK 205


>gi|26246157|ref|NP_752196.1| hypothetical protein c0250 [Escherichia coli CFT073]
 gi|91209281|ref|YP_539267.1| hypothetical protein UTI89_C0232 [Escherichia coli UTI89]
 gi|117622495|ref|YP_851408.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli APEC O1]
 gi|237707793|ref|ZP_04538274.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|331645382|ref|ZP_08346486.1| methyltransferase domain protein [Escherichia coli M605]
 gi|331671742|ref|ZP_08372538.1| methyltransferase domain protein [Escherichia coli TA280]
 gi|332281342|ref|ZP_08393755.1| conserved hypothetical protein [Shigella sp. D9]
 gi|26106554|gb|AAN78740.1|AE016755_240 Hypothetical protein yafS [Escherichia coli CFT073]
 gi|91070855|gb|ABE05736.1| hypothetical protein YafS [Escherichia coli UTI89]
 gi|115511619|gb|ABI99693.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli APEC O1]
 gi|226899003|gb|EEH85262.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|331045544|gb|EGI17670.1| methyltransferase domain protein [Escherichia coli M605]
 gi|331070731|gb|EGI42090.1| methyltransferase domain protein [Escherichia coli TA280]
 gi|332103694|gb|EGJ07040.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 89  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 148

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 149 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 197

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 198 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 228


>gi|13476649|ref|NP_108219.1| hypothetical protein mll8033 [Mesorhizobium loti MAFF303099]
 gi|14027411|dbj|BAB53680.1| mll8033 [Mesorhizobium loti MAFF303099]
          Length = 252

 Score = 42.0 bits (97), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           S G+L + D   D  L  H +E   D    L+++ R+LT+ GR ++++P+KR
Sbjct: 71  STGDLSIVDKKFDFCLSSHCVEHQPDLIYHLNQVARILTATGRYLLIIPDKR 122


>gi|312100431|gb|ADQ27825.1| glycosyltransferase [Burkholderia pseudomallei]
          Length = 1706

 Score = 42.0 bits (97), Expect = 0.081,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           S  ++PL D+SVD V+    +E  +    M+ EI RVL  GG +I+  PNK
Sbjct: 118 SAADIPLDDASVDLVVSFETIEHHDQHEAMIREIKRVLRPGGLLIISSPNK 168


>gi|312100417|gb|ADQ27813.1| glycosyltransferase [Burkholderia pseudomallei]
 gi|312100462|gb|ADQ27848.1| putative glycosyltransferase [Burkholderia pseudomallei]
          Length = 1738

 Score = 42.0 bits (97), Expect = 0.081,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           S  ++PL D+SVD V+    +E  +    M+ EI RVL  GG +I+  PNK
Sbjct: 118 SAADIPLDDASVDLVVSFETIEHHDQHEAMIREIKRVLRPGGLLIISSPNK 168


>gi|301326097|ref|ZP_07219493.1| methyltransferase domain protein [Escherichia coli MS 78-1]
 gi|300847157|gb|EFK74917.1| methyltransferase domain protein [Escherichia coli MS 78-1]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|290476064|ref|YP_003468961.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Xenorhabdus bovienii SS-2004]
 gi|289175394|emb|CBJ82197.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Xenorhabdus bovienii SS-2004]
          Length = 238

 Score = 42.0 bits (97), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-RMEHTPF 147
           LP    SVD  L+ H L ++ DP  +L E+ R++T  G +I+   N   +   R    P 
Sbjct: 84  LPFEAKSVDACLLAHMLTYSADPHWLLREVDRIITDDGWLIISGFNPISLLGLRKVLLPI 143

Query: 148 GSGQPYSWYQMISLLREANF 167
              Q Y   QM S+LR+ ++
Sbjct: 144 HRRQAYE-AQMFSMLRQVDW 162


>gi|260853418|ref|YP_003227309.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260866356|ref|YP_003232758.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|300926567|ref|ZP_07142353.1| methyltransferase domain protein [Escherichia coli MS 182-1]
 gi|257752067|dbj|BAI23569.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|257762712|dbj|BAI34207.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|300417425|gb|EFK00736.1| methyltransferase domain protein [Escherichia coli MS 182-1]
 gi|323157952|gb|EFZ44054.1| methyltransferase domain protein [Escherichia coli EPECa14]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|82775599|ref|YP_401946.1| hypothetical protein SDY_0232 [Shigella dysenteriae Sd197]
 gi|81239747|gb|ABB60457.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 89  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 148

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 149 LRKTSPYN-SRMFTLMRQLDWFSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 197

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 198 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 228


>gi|291281030|ref|YP_003497848.1| hypothetical protein G2583_0217 [Escherichia coli O55:H7 str.
           CB9615]
 gi|331651118|ref|ZP_08352143.1| methyltransferase domain protein [Escherichia coli M718]
 gi|209745494|gb|ACI71054.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|209745500|gb|ACI71057.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|290760903|gb|ADD54864.1| hypothetical protein G2583_0217 [Escherichia coli O55:H7 str.
           CB9615]
 gi|331050859|gb|EGI22911.1| methyltransferase domain protein [Escherichia coli M718]
          Length = 246

 Score = 42.0 bits (97), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 89  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 148

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 149 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 197

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 198 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 228


>gi|168750161|ref|ZP_02775183.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4113]
 gi|168757206|ref|ZP_02782213.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4401]
 gi|168763421|ref|ZP_02788428.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4501]
 gi|168769976|ref|ZP_02794983.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4486]
 gi|168776183|ref|ZP_02801190.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4196]
 gi|168782938|ref|ZP_02807945.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4076]
 gi|168789656|ref|ZP_02814663.1| putative methyltransferase [Escherichia coli O157:H7 str. EC869]
 gi|168800385|ref|ZP_02825392.1| putative methyltransferase [Escherichia coli O157:H7 str. EC508]
 gi|195938585|ref|ZP_03083967.1| hypothetical protein EscherichcoliO157_19512 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807621|ref|ZP_03249958.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4206]
 gi|208813101|ref|ZP_03254430.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4045]
 gi|208820247|ref|ZP_03260567.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4042]
 gi|209400502|ref|YP_002268816.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4115]
 gi|217325276|ref|ZP_03441360.1| putative methyltransferase [Escherichia coli O157:H7 str. TW14588]
 gi|254791340|ref|YP_003076177.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|261223756|ref|ZP_05938037.1| hypothetical protein EscherichiacoliO157_04001 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255834|ref|ZP_05948367.1| hypothetical protein EscherichiacoliO157EcO_08383 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|187768438|gb|EDU32282.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4196]
 gi|188015547|gb|EDU53669.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4113]
 gi|188999591|gb|EDU68577.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4076]
 gi|189355698|gb|EDU74117.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4401]
 gi|189361092|gb|EDU79511.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4486]
 gi|189366413|gb|EDU84829.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4501]
 gi|189370727|gb|EDU89143.1| putative methyltransferase [Escherichia coli O157:H7 str. EC869]
 gi|189377314|gb|EDU95730.1| putative methyltransferase [Escherichia coli O157:H7 str. EC508]
 gi|208727422|gb|EDZ77023.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4206]
 gi|208734378|gb|EDZ83065.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4045]
 gi|208740370|gb|EDZ88052.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4042]
 gi|209161902|gb|ACI39335.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4115]
 gi|217321497|gb|EEC29921.1| putative methyltransferase [Escherichia coli O157:H7 str. TW14588]
 gi|254590740|gb|ACT70101.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|320190266|gb|EFW64916.1| hypothetical protein ECoD_01678 [Escherichia coli O157:H7 str.
           EC1212]
 gi|326338811|gb|EGD62630.1| putative methyltransferase [Escherichia coli O157:H7 str. 1044]
          Length = 240

 Score = 42.0 bits (97), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|227822675|ref|YP_002826647.1| transcriptional regulator, ArsR family [Sinorhizobium fredii
           NGR234]
 gi|227341676|gb|ACP25894.1| transcriptional regulator, ArsR family [Sinorhizobium fredii
           NGR234]
          Length = 339

 Score = 41.6 bits (96), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM-WARMEHT- 145
           NLPL   S D V +   L F EDP   + E  R+L  GGR++++     G+ + R EH  
Sbjct: 215 NLPLDGRSFDLVTIHQVLHFLEDPEAAIAEAARMLVPGGRLVIIDFAPHGLEYLRNEHAH 274

Query: 146 ---PFGSGQPYSWYQMISLLREANFTLS 170
               F       W Q   L+ E    L+
Sbjct: 275 ARLGFAHQTMADWLQKAGLMLEKTTDLA 302


>gi|148654940|ref|YP_001275145.1| group 1 glycosyl transferase [Roseiflexus sp. RS-1]
 gi|148567050|gb|ABQ89195.1| glycosyl transferase, group 1 [Roseiflexus sp. RS-1]
          Length = 711

 Score = 41.6 bits (96), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

Query: 37  GCRLLGLGYAIPFFSCFHGKVER-TLAFMPAGQGATNWPDQYF--SSTALVSEGNLPLAD 93
           G  +L  G  +  +  F G++ R  L  +        W ++    +S A V    LP AD
Sbjct: 466 GETVLDCGCGMGVYLMFMGRLRRLNLVGVDGDIARLRWAEREHVPASLAGVDIHRLPFAD 525

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +S D VLM   LE   D    L E++R+L  GG + + VP+
Sbjct: 526 NSFDKVLMSEVLEHLADDRGALREVFRILKPGGILALSVPH 566


>gi|323452007|gb|EGB07882.1| hypothetical protein AURANDRAFT_26716 [Aureococcus anophagefferens]
          Length = 210

 Score = 41.6 bits (96), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 54  HGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFL 113
           +GKV  T   M A + A N     +    L  E  LP AD S D V  V  +++   P  
Sbjct: 73  YGKVVGT--GMNAKELAANTQLTDYVQRDLNKEPTLPFADRSFDVVTCVVSVDYLTQPLA 130

Query: 114 MLHEIWRVLTSGGRMIVVVPNKR------GMWARM 142
           +L E+ RVL  GG++I    N+       GMW  M
Sbjct: 131 VLAEVRRVLRPGGKVIFSQSNRMFMTKAVGMWVSM 165


>gi|311280822|ref|YP_003943053.1| Methyltransferase type 11 [Enterobacter cloacae SCF1]
 gi|308750017|gb|ADO49769.1| Methyltransferase type 11 [Enterobacter cloacae SCF1]
          Length = 240

 Score = 41.6 bits (96), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP AD SVD  L+ H L + +DP  +L E  RVL   G +I+   N   +    +  P  
Sbjct: 84  LPFADKSVDACLLAHTLPWCQDPHRLLREADRVLIDDGWLIMTGFNPVSLMGLRKLAPVL 143

Query: 149 SGQ-PYSWYQMISLLREANF 167
            G  PY+  +M +++R+ ++
Sbjct: 144 RGSMPYN-SRMFTMMRQLDW 162


>gi|303245045|ref|ZP_07331366.1| Methyltransferase type 11 [Methanothermococcus okinawensis IH1]
 gi|302484608|gb|EFL47551.1| Methyltransferase type 11 [Methanothermococcus okinawensis IH1]
          Length = 207

 Score = 41.6 bits (96), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 69/166 (41%), Gaps = 17/166 (10%)

Query: 18  KCTTDAISKVLSTTWDDVTGCRL-LGLG-YAIPFFSCFHGKVERTLAFMPAGQGATNWPD 75
           K   DAI K +  + +   G  + +G G +A P    +  +  +++A +   +G      
Sbjct: 32  KAELDAIKKFIPKSDEKKKGLEIGVGTGRFAKPLGIEYGLEPSKSMAEIAKKRGIN---- 87

Query: 76  QYFSSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
                   V EG   ++P  D S D VLM   L F  DP   L EI R+L   G +I+ +
Sbjct: 88  --------VYEGIAEDIPFDDESYDYVLMTTTLCFLNDPIKGLKEIKRILKPNGVLIIGM 139

Query: 133 PNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            +K     +   +     + Y + +  SL    N+   +  +++ +
Sbjct: 140 IDKNSPLGKFYESKKEKSKFYKYAKFYSLDEVLNWLKELNYKNIIY 185


>gi|327539276|gb|EGF25898.1| ribosomal RNA large subunit methyltransferase A [Rhodopirellula
           baltica WH47]
          Length = 256

 Score = 41.6 bits (96), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           A  WP+  +      ++ +LP+AD SV CV+ +    F   P   + EI RVLT  G++I
Sbjct: 111 AREWPEATW--VWANADRSLPVADGSVSCVMSL----FGRRP---VAEIARVLTGDGKLI 161

Query: 130 VVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTL 169
           V VP +  +    EH      +   W +++  +      L
Sbjct: 162 VAVPGEEDLIELREHVQQSGQRRSRWEKVVDEMAAEGLKL 201


>gi|333010753|gb|EGK30179.1| methyltransferase domain protein [Shigella flexneri K-272]
 gi|333021252|gb|EGK40505.1| methyltransferase domain protein [Shigella flexneri K-227]
          Length = 240

 Score = 41.6 bits (96), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKSK 222


>gi|161504625|ref|YP_001571737.1| hypothetical protein SARI_02740 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865972|gb|ABX22595.1| hypothetical protein SARI_02740 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 240

 Score = 41.6 bits (96), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 6/136 (4%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVMSGFNPVSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P    +M +L+R+ ++   +    L +   H   +L       ++ N   P    +
Sbjct: 143 LRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKQGGRLLNTHIPALGCL 199

Query: 208 YVIEARKILYQGLPIT 223
            +I ARK   + +P+T
Sbjct: 200 QLIVARK---RTIPLT 212


>gi|148979851|ref|ZP_01815729.1| SAM-dependent methyltransferase [Vibrionales bacterium SWAT-3]
 gi|145961543|gb|EDK26844.1| SAM-dependent methyltransferase [Vibrionales bacterium SWAT-3]
          Length = 261

 Score = 41.6 bits (96), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           ++++G NLP  + S D V++ H L+++ DP  +L E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYIIITGFNPFSVTGL 136

Query: 142 MEHTPFG------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
               P+       SG+ Y+  ++   L   N+ +        FP +  +    +W+  E 
Sbjct: 137 ASLMPWRKNSLPWSGRMYTPSRVKDWLGVLNYEVIHCDTYALFPMSKYQA---MWTWLE- 192

Query: 196 IGNIFG--PGFAG-IYVIEARKILYQGLPI 222
             N  G    FAG  Y I ARK  Y   PI
Sbjct: 193 --NALGGCASFAGSQYFIVARKRTYPLKPI 220


>gi|89075027|ref|ZP_01161472.1| hypothetical SAM-dependent methyltransferase [Photobacterium sp.
           SKA34]
 gi|89049266|gb|EAR54830.1| hypothetical SAM-dependent methyltransferase [Photobacterium sp.
           SKA34]
          Length = 254

 Score = 41.6 bits (96), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 16/158 (10%)

Query: 75  DQYFSSTALVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           D++ S   + +E   LP  + S D  L++H L+++ DP  +L E+ RV    G +++   
Sbjct: 69  DKFSSYRNVEAESFELPFVEKSFDACLLIHQLDYSTDPHRLLREVDRVTVDDGYLLLSGN 128

Query: 134 NKRGM--------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT-HKK 184
           N   +        W R +  P+ +G+ Y   ++I  LR  N+ +         P T H  
Sbjct: 129 NPLSVNGFCGLLPWNRNK-APW-NGRMYLSSRVIDWLRLLNYEVIYHETFAVLPSTRHLT 186

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           C   L ++  +  ++ G     +Y I ARK  +   PI
Sbjct: 187 CSAWLENILSEPLSVVG----SLYFIVARKRTFPLRPI 220


>gi|196231066|ref|ZP_03129926.1| Methyltransferase type 11 [Chthoniobacter flavus Ellin428]
 gi|196224896|gb|EDY19406.1| Methyltransferase type 11 [Chthoniobacter flavus Ellin428]
          Length = 239

 Score = 41.6 bits (96), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 14/116 (12%)

Query: 23  AISKVLSTTWDDVTGCRL-LGLGYAIPFFSCF---HGKVERTLAFMPAGQGATNWPDQYF 78
           AI + L  T     G  L +G GY +P+         K ER +          + PD  +
Sbjct: 30  AIVRQLKATLPRFRGTVLDIGCGY-MPYRGLLLAAPSKAERYIGL--------DLPDNLY 80

Query: 79  SSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
               +   G  +PL   +VDC +    LE   DP  +L E +RVL  GG +   VP
Sbjct: 81  QKPDIEWNGQTIPLEPGTVDCAIATELLEHCPDPEAVLREAYRVLKPGGVIFFTVP 136


>gi|162453898|ref|YP_001616265.1| putative methyltransferase [Sorangium cellulosum 'So ce 56']
 gi|161164480|emb|CAN95785.1| putative methyltransferase [Sorangium cellulosum 'So ce 56']
          Length = 389

 Score = 41.6 bits (96), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LPLADSSVD VL    +   ED      EI+RVL  GGR ++
Sbjct: 130 LPLADSSVDVVLSNCVINLCEDKRDAFSEIFRVLKPGGRFVI 171


>gi|87303598|ref|ZP_01086377.1| hypothetical protein WH5701_10634 [Synechococcus sp. WH 5701]
 gi|87281822|gb|EAQ73786.1| hypothetical protein WH5701_10634 [Synechococcus sp. WH 5701]
          Length = 253

 Score = 41.6 bits (96), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           DQ++    L  +  LPLAD+SVD VL+V   ++ + P  +  E+ R+L   G++IV   N
Sbjct: 113 DQHWVQN-LNRDQRLPLADASVDAVLIVAGWQYLQQPEAIAAELLRILRPQGQLIVAFSN 171

Query: 135 K 135
           +
Sbjct: 172 R 172


>gi|332768612|gb|EGJ98793.1| methyltransferase domain protein [Shigella flexneri 2930-71]
          Length = 222

 Score = 41.6 bits (96), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 65  HLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 124

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 125 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 173

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 174 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 204


>gi|313676377|ref|YP_004054373.1| methyltransferase type 11 [Marivirga tractuosa DSM 4126]
 gi|312943075|gb|ADR22265.1| Methyltransferase type 11 [Marivirga tractuosa DSM 4126]
          Length = 259

 Score = 41.6 bits (96), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           +AD+S D V+    +E  +D    L EI RVL  GG+ I+  PNK+    R
Sbjct: 93  IADNSFDTVVSFQVIEHIKDDKSFLKEIHRVLKPGGKAIISTPNKKMTLTR 143


>gi|15799889|ref|NP_285901.1| hypothetical protein Z0237 [Escherichia coli O157:H7 EDL933]
 gi|15829463|ref|NP_308236.1| hypothetical protein ECs0209 [Escherichia coli O157:H7 str. Sakai]
 gi|12512941|gb|AAG54509.1|AE005196_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13359665|dbj|BAB33632.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|209745496|gb|ACI71055.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|209745498|gb|ACI71056.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|209745502|gb|ACI71058.1| hypothetical protein ECs0209 [Escherichia coli]
          Length = 246

 Score = 41.6 bits (96), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 89  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 148

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 149 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 197

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 198 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 228


>gi|320325374|gb|EFW81441.1| hypothetical protein PsgB076_08157 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320327641|gb|EFW83649.1| hypothetical protein PsgRace4_22635 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 253

 Score = 41.6 bits (96), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 62/159 (38%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  M
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWG-M 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H       G  +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDALGKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ +  +  I   I +P
Sbjct: 203 GRQSPGGGFYLLVARKLVVGLRPVRQVCRDPIGKLIPMP 241


>gi|104779542|ref|YP_606040.1| SAM-dependent methyltransferase [Pseudomonas entomophila L48]
 gi|95108529|emb|CAK13223.1| putative SAM-dependent methyltransferase [Pseudomonas entomophila
           L48]
          Length = 240

 Score = 41.6 bits (96), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 71  TNWPDQYFSSTALVSEGNLPLADS--SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             + +Q+  S   + EG     DS  + D ++M   LE  +DP  +L    R L  GGR+
Sbjct: 75  AQFREQFPESPVDIVEGYFEHFDSPRTFDLIVMGFVLEHVDDPQTVLQRFRRFLAPGGRL 134

Query: 129 IVVVPNKRGMWARMEHT 145
            V+VPN   +  R  H 
Sbjct: 135 FVLVPNGESLHRRFGHA 151


>gi|320104106|ref|YP_004179697.1| type 11 methyltransferase [Isosphaera pallida ATCC 43644]
 gi|319751388|gb|ADV63148.1| Methyltransferase type 11 [Isosphaera pallida ATCC 43644]
          Length = 331

 Score = 41.6 bits (96), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LPLAD +VDCV+    +  A D   +  EI RVL  GGR+ +
Sbjct: 145 LPLADGTVDCVISNCVVNLAPDKNAVFREIARVLKPGGRVAI 186


>gi|304395365|ref|ZP_07377248.1| Methyltransferase type 11 [Pantoea sp. aB]
 gi|304356659|gb|EFM21023.1| Methyltransferase type 11 [Pantoea sp. aB]
          Length = 245

 Score = 41.6 bits (96), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 16/158 (10%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           L     LP    SVD  LM H L +++DP  +L E+ RVL   G MI+   N   +    
Sbjct: 78  LADPMQLPFESKSVDACLMAHTLAWSQDPHRVLREVDRVLIDDGWMIISGFNPFSLLGVS 137

Query: 143 EHTPF------GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
           +  P        SG+ +S  +++  L   N+ +   +R     P H++          K+
Sbjct: 138 KMVPGLTRKAPWSGRMFSQMRLLDWLGLLNYEVVYRTRFQVL-PWHRQG--------GKL 188

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
            +   P    + ++ ARK  +  LP T +KK   +S I
Sbjct: 189 ISAHLPALGCLNIVVARKRTFPLLP-TRAKKSLSTSKI 225


>gi|91773578|ref|YP_566270.1| hypothetical protein Mbur_1616 [Methanococcoides burtonii DSM 6242]
 gi|91712593|gb|ABE52520.1| methyltransferase [Methanococcoides burtonii DSM 6242]
          Length = 238

 Score = 41.6 bits (96), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF--LMLHEIWRVLT 123
           A Q  +   + Y    A      LPL   S D V+   ++E  ++    L L E++RVL 
Sbjct: 80  ADQNNSTGNNHYICGDAC----RLPLKSESFDMVIASEFIEHIDEHSISLFLDEVYRVLE 135

Query: 124 SGGRMIVVVPNKRGMWARME 143
            GG +I+  PN   +W  +E
Sbjct: 136 PGGELILTTPNYSSLWPLLE 155


>gi|156740056|ref|YP_001430185.1| group 1 glycosyl transferase [Roseiflexus castenholzii DSM 13941]
 gi|156231384|gb|ABU56167.1| glycosyl transferase group 1 [Roseiflexus castenholzii DSM 13941]
          Length = 710

 Score = 41.6 bits (96), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 3/101 (2%)

Query: 37  GCRLLGLGYAIPFFSCFHGKVER-TLAFMPAGQGATNWPDQYFSSTAL--VSEGNLPLAD 93
           G  +L  G  +  +  F G++ R  L  +        W ++     +L  V    LP AD
Sbjct: 465 GETVLDCGCGMGVYLMFMGRLRRLNLVGVDGDMERLRWAEREHVPASLSNVDIHRLPFAD 524

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +S D VLM   LE   D    L EI+R+L  GG + + VP+
Sbjct: 525 NSFDKVLMSEVLEHLTDDRGALREIFRILKPGGVLALSVPH 565


>gi|284031027|ref|YP_003380958.1| type 11 methyltransferase [Kribbella flavida DSM 17836]
 gi|283810320|gb|ADB32159.1| Methyltransferase type 11 [Kribbella flavida DSM 17836]
          Length = 252

 Score = 41.6 bits (96), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS-CFHGKVERTLAFMPAGQGATNW 73
           F G    D++ ++  + + +++G R+L +G    +F+  F     R  A + +  G  + 
Sbjct: 38  FYGTLAADSVGQL--SAYAELSGARMLDVGGGPGYFADAFRAAGARYYA-IDSDLGELSG 94

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
             +    T L S   LP+ D  VD     + LE   DP+LM  E+ RV   GG
Sbjct: 95  RGEPSPGTVLGSGMALPVGDQQVDICFSSNVLEHVPDPWLMADEMVRVTKPGG 147


>gi|269127860|ref|YP_003301230.1| type 11 methyltransferase [Thermomonospora curvata DSM 43183]
 gi|268312818|gb|ACY99192.1| Methyltransferase type 11 [Thermomonospora curvata DSM 43183]
          Length = 255

 Score = 41.6 bits (96), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A + A   P +  + T       LP  D S D ++    LE   D    + E+ RVL  G
Sbjct: 57  AMRAAGEVPKEATARTVRGDARRLPFPDDSFDKIVASEVLEHIPDDMTAMSELLRVLKPG 116

Query: 126 GRMIVVVPN---KRGMWARME--HT-PFGSGQPYSWYQMISLLR 163
           GR+ V VP+   +R  WA  E  HT P G  + Y+  ++ + L+
Sbjct: 117 GRLAVTVPSWLPERICWALSEDYHTAPGGHVRIYTRAELEAKLK 160


>gi|218710294|ref|YP_002417915.1| SAM-dependent methyltransferase [Vibrio splendidus LGP32]
 gi|218323313|emb|CAV19490.1| SAM-dependent methyltransferase [Vibrio splendidus LGP32]
          Length = 262

 Score = 41.6 bits (96), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           ++++G NLP  + S D V++ H L+++ DP  +L E+ RV+   G +I+   N   +   
Sbjct: 78  VIADGYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYIIITGFNPFSVTGL 137

Query: 142 MEHTPFG------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
               P+       SG+ Y+  ++   L   N+ +        FP +  +    +W+  E 
Sbjct: 138 ASLMPWRKNSLPWSGRMYTPNRIKDWLGVLNYEVIHCDTYALFPMSKYQA---MWTWLE- 193

Query: 196 IGNIFG--PGFAG-IYVIEARKILYQGLPI 222
             N  G    FAG  Y I ARK  Y   PI
Sbjct: 194 --NSLGSCASFAGSQYFIVARKRTYPLKPI 221


>gi|302038320|ref|YP_003798642.1| putative methyltransferase [Candidatus Nitrospira defluvii]
 gi|300606384|emb|CBK42717.1| putative Methyltransferase [Candidatus Nitrospira defluvii]
          Length = 338

 Score = 41.6 bits (96), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 84  VSEGNLP---LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V +G+L      + + D VL  H LE    P  +L E+WR++   GR++++ PN   + A
Sbjct: 178 VRQGDLASMAYPERTFDTVLFSHVLEHVHAPLPLLREVWRIVDWEGRVVILCPNAGSLEA 237

Query: 141 RM 142
           R+
Sbjct: 238 RL 239


>gi|86146865|ref|ZP_01065184.1| SAM-dependent methyltransferase [Vibrio sp. MED222]
 gi|85835317|gb|EAQ53456.1| SAM-dependent methyltransferase [Vibrio sp. MED222]
          Length = 261

 Score = 41.6 bits (96), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 68/150 (45%), Gaps = 16/150 (10%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           ++++G NLP  + S D V++ H L+++ DP  +L E+ RV+   G +I+   N   +   
Sbjct: 77  VIADGYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYIIITGFNPFSVTGL 136

Query: 142 MEHTPFG------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
               P+       SG+ Y+  ++   L   N+ +        FP +  +    +W+  E 
Sbjct: 137 ASLMPWRKNSLPWSGRMYTPNRIKDWLGVLNYEVIHCDTYALFPMSKYQA---MWTWLE- 192

Query: 196 IGNIFG--PGFAG-IYVIEARKILYQGLPI 222
             N  G    FAG  Y I ARK  Y   PI
Sbjct: 193 --NSLGSCASFAGSQYFIVARKRTYPLKPI 220


>gi|55377569|ref|YP_135419.1| hypothetical protein rrnAC0720 [Haloarcula marismortui ATCC 43049]
 gi|55230294|gb|AAV45713.1| ubiE/COQ5 methyltransferase familiy protein [Haloarcula marismortui
           ATCC 43049]
          Length = 264

 Score = 41.6 bits (96), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 18/98 (18%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV----------VPN-- 134
           G+LP+AD SVD  + V   E+ E     + E+ RVL  GG  +V            PN  
Sbjct: 98  GDLPVADESVDAAVAVQVFEYLETVSSAVAELARVLRPGGSAVVCDADFASLVWRSPNPE 157

Query: 135 --KRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLS 170
              R + A  +H P    QP    ++  +LREA  T+ 
Sbjct: 158 RMARVLRAFDDHCP----QPRLGSRLAPVLREAGLTVD 191


>gi|322419700|ref|YP_004198923.1| type 11 methyltransferase [Geobacter sp. M18]
 gi|320126087|gb|ADW13647.1| Methyltransferase type 11 [Geobacter sp. M18]
          Length = 217

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM-- 142
           S  +LPLAD+S D  +MV  + F +D      E WR+L  GG ++V   ++     R   
Sbjct: 89  SAESLPLADNSFDFAVMVTVVCFLDDVAKAFQETWRILKPGGTLVVGFIDRESELGRTCS 148

Query: 143 --EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
             +   +   + YS  ++   L +A F+   + R   FP
Sbjct: 149 QKKSVFYRDARFYSVGELAEWLAKAGFS-GFSCRQTLFP 186


>gi|300778409|ref|ZP_07088267.1| SAM-dependent methyltransferase [Chryseobacterium gleum ATCC 35910]
 gi|300503919|gb|EFK35059.1| SAM-dependent methyltransferase [Chryseobacterium gleum ATCC 35910]
          Length = 255

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 38/93 (40%), Gaps = 12/93 (12%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME---- 143
           +LP  + S D V   H LE  ED    + E++RVL  GG  I+ VP K  +    E    
Sbjct: 131 DLPFENESFDIVFCNHVLEHIEDDAKAMSELYRVLKPGGWGILQVPMKNSLEKTYEDFTI 190

Query: 144 ------HTPFGSGQPYSWYQM--ISLLREANFT 168
                    FG      WY M     LR+A F 
Sbjct: 191 KDPKERQKHFGQYDHVRWYGMDYFDRLRKAGFE 223


>gi|156743814|ref|YP_001433943.1| type 11 methyltransferase [Roseiflexus castenholzii DSM 13941]
 gi|156235142|gb|ABU59925.1| Methyltransferase type 11 [Roseiflexus castenholzii DSM 13941]
          Length = 281

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
           LPL D++ D V+    +E  + P  +LHEI RVL  GG  +V V N+R 
Sbjct: 115 LPLPDATFDAVVCWDVIEHVQSPDQVLHEIARVLRPGGVALVTVINRRA 163


>gi|118462307|ref|YP_884344.1| methyltransferase type 11 [Mycobacterium avium 104]
 gi|118163594|gb|ABK64491.1| methyltransferase type 11 [Mycobacterium avium 104]
          Length = 248

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           LPL D++VD  +    L+   +P   L EI RVL  GGR+ V+VP
Sbjct: 151 LPLRDNTVDAAVSTAVLQLVPNPQAALVEIARVLRPGGRLAVMVP 195


>gi|156935273|ref|YP_001439189.1| hypothetical protein ESA_03126 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533527|gb|ABU78353.1| hypothetical protein ESA_03126 [Cronobacter sakazakii ATCC BAA-894]
          Length = 238

 Score = 41.6 bits (96), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 12/139 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP A  SVD  L+ H L +  DP  +L+E  RVL   G +I+   N   +    +  PF
Sbjct: 83  HLPFAAKSVDACLLAHTLPWCPDPHRLLNEADRVLIDDGWLIMTGFNPVSLLGAAKLLPF 142

Query: 148 GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG---PGF 204
              +     +M +++R+ ++ LS+ +  L +   + +C +  W    + G +     P  
Sbjct: 143 VRKRAPVNSRMFTMMRQMDW-LSLLNFELLY---YSRCQVLPWC--RQGGKMLTRHLPAL 196

Query: 205 AGIYVIEARKILYQGLPIT 223
             + V+ ARK   + +P+T
Sbjct: 197 GCLQVMVARK---RTIPLT 212


>gi|103485532|ref|YP_615093.1| ArsR family transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98975609|gb|ABF51760.1| transcriptional regulator, ArsR family [Sphingopyxis alaskensis
           RB2256]
          Length = 328

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK----RGMWAR 141
            LP+ D+SVD +++   L FA +P  ++ E  RVL  GG +++V   P++    R + A 
Sbjct: 208 ELPVGDASVDSIVIHQALHFAHEPDRVIAEASRVLRGGGHLLIVDFAPHEDEELRTLAAH 267

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLS 170
                F   Q   W+    LL E   TL 
Sbjct: 268 A-RLGFSDAQIRGWFASAGLLLETTQTLE 295


>gi|283851613|ref|ZP_06368892.1| Methyltransferase type 11 [Desulfovibrio sp. FW1012B]
 gi|283572943|gb|EFC20924.1| Methyltransferase type 11 [Desulfovibrio sp. FW1012B]
          Length = 282

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            L  AD++ D V+     E   DP+    E+WRVL+ GGR +  VP   G
Sbjct: 128 RLSFADAAFDLVVTQDIFEHVADPWRAFDEVWRVLSPGGRHVFTVPLHEG 177


>gi|89889313|ref|ZP_01200824.1| putative methyltransferase/ glycosyltransferase [Flavobacteria
           bacterium BBFL7]
 gi|89517586|gb|EAS20242.1| putative methyltransferase/ glycosyltransferase [Flavobacteria
           bacterium BBFL7]
          Length = 257

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP--NKRGM 138
           NLP  D+S D +L  H LE   D    + E++RVL  GG+ I+ +P  N R +
Sbjct: 131 NLPFEDNSYDFILCNHVLEHIPDDETAMKELYRVLKPGGKAILQIPLENDRDV 183


>gi|188495421|ref|ZP_03002691.1| putative methyltransferase [Escherichia coli 53638]
 gi|188490620|gb|EDU65723.1| putative methyltransferase [Escherichia coli 53638]
          Length = 240

 Score = 41.6 bits (96), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLLWCTDPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|311746391|ref|ZP_07720176.1| probable 3-demethylubiquinone-9 3-O-methyltransferase [Algoriphagus
           sp. PR1]
 gi|126575277|gb|EAZ79609.1| probable 3-demethylubiquinone-9 3-O-methyltransferase [Algoriphagus
           sp. PR1]
          Length = 257

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-----KRGMWARMEHT 145
           + D+  D V+    +E  E+  L L EI+RVL  GG+ I+  PN      R  W   E+T
Sbjct: 92  IGDNLFDTVVSFQVIEHIENDRLFLEEIYRVLKPGGKAIISTPNINHTLSRNPWHVREYT 151

Query: 146 P 146
           P
Sbjct: 152 P 152


>gi|168698605|ref|ZP_02730882.1| hypothetical protein GobsU_03729 [Gemmata obscuriglobus UQM 2246]
          Length = 181

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 73  WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           +PD+       +  G + L D+  DCV+ V  +E  E+P     E+ R++  GG ++V  
Sbjct: 23  FPDEGAFHLTDLDSGRVALPDAVADCVVAVETIEHLENPRAFARELVRLVKPGGWVVVTT 82

Query: 133 PNK 135
           PN+
Sbjct: 83  PNQ 85


>gi|331640663|ref|ZP_08341810.1| methyltransferase domain protein [Escherichia coli H736]
 gi|331040037|gb|EGI12245.1| methyltransferase domain protein [Escherichia coli H736]
 gi|332341541|gb|AEE54875.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 246

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 83/222 (37%), Gaps = 31/222 (13%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           GK    A+ + L+  +  + G  LL +G      +C    V   +     G       D 
Sbjct: 28  GKLYRKALERQLNPWFTKMYGFHLLKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADP 87

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                      +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N  
Sbjct: 88  L----------HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPI 137

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKL 189
                 +  P      PY+  +M +L+R+       NF +   SR    P          
Sbjct: 138 SFMGLRKLVPVLRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP---------- 186

Query: 190 WSVF-EKIGNIFGPGFAGIYVIEARK--ILYQGLPITESKKK 228
           W+    K+ N   P    + +I ARK  I     P+ +SK K
Sbjct: 187 WNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK 228


>gi|261403421|ref|YP_003247645.1| Methyltransferase type 11 [Methanocaldococcus vulcanius M7]
 gi|261370414|gb|ACX73163.1| Methyltransferase type 11 [Methanocaldococcus vulcanius M7]
          Length = 224

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 76  QYFSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           + F+ T     GN   LP  D + D +L ++ LE   D    L EI RVL   GR+IVVV
Sbjct: 79  KKFTKTERKICGNILHLPFKDKTFDLILCINVLEHV-DKSKALKEINRVLKDNGRVIVVV 137

Query: 133 PNKRGMWARMEHTPF 147
            NK+ ++       F
Sbjct: 138 VNKKCLFKEEVFNDF 152


>gi|90581656|ref|ZP_01237445.1| hypothetical SAM-dependent methyltransferase [Vibrio angustum S14]
 gi|90437140|gb|EAS62342.1| hypothetical SAM-dependent methyltransferase [Vibrio angustum S14]
          Length = 256

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 16/158 (10%)

Query: 75  DQYFSSTALVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           D++ S   + +E   LP  + S D  L++H L+++ DP  +L E+ RV    G +++   
Sbjct: 69  DKFSSYRNVEAESFELPFVEKSFDACLLIHQLDYSTDPHRLLREVDRVTVDDGYLLLSGN 128

Query: 134 NKRGM--------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT-HKK 184
           N   +        W R +  P+ +G+ Y   ++I  LR  N+ +         P T H  
Sbjct: 129 NPLSVNGFCGLLPWNR-KKAPW-NGRMYLSSRVIDWLRLLNYEVIYHETFAVLPSTRHLT 186

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           C   L ++  +  ++ G     +Y I ARK  +   PI
Sbjct: 187 CSAWLENILSEPLSMVG----SLYFIVARKRTFPLRPI 220


>gi|229016567|ref|ZP_04173507.1| O-antigen biosynthesis protein [Bacillus cereus AH1273]
 gi|229022774|ref|ZP_04179298.1| O-antigen biosynthesis protein [Bacillus cereus AH1272]
 gi|228738586|gb|EEL89058.1| O-antigen biosynthesis protein [Bacillus cereus AH1272]
 gi|228744743|gb|EEL94805.1| O-antigen biosynthesis protein [Bacillus cereus AH1273]
          Length = 229

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 83/221 (37%), Gaps = 26/221 (11%)

Query: 13  SSFLGKCTTDAISKVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           S F        + K +   W +V   GC    LG AI         VE   AF  A + A
Sbjct: 13  SDFYYNAANPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGVE---AFSEAAEKA 69

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
               D        +   ++P  +   DCV+    LE   DP+ ++ ++   +   G ++ 
Sbjct: 70  KEKLDHVVLGD--IETMDMPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILA 127

Query: 131 VVPNK----------RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFF 178
            +PN            G W   E+          +++ +M+ +  +A +++S   R    
Sbjct: 128 SIPNVAHISVLAPLLAGNWTYTEYGLLDKTHVRFFTFNEMLRMFLKAGYSISKVDRVYID 187

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAG-----IYVIEARK 214
              ++  I +L+ V +K     G GF        Y+IEA K
Sbjct: 188 HKMYEPLIEELYEVCKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|307109266|gb|EFN57504.1| hypothetical protein CHLNCDRAFT_21078 [Chlorella variabilis]
          Length = 145

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            L +      AT  P       A  +E  LPL D SVD V+ VH L     P   + E+ 
Sbjct: 8   ALGYAQQAAAATGLPPDRLQVVAGSAEA-LPLGDGSVDVVIAVHVLCCVGSPDRAVAEVR 66

Query: 120 RVLTSGGR 127
           RVL  GGR
Sbjct: 67  RVLRPGGR 74


>gi|89107088|ref|AP_000868.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|90111099|ref|NP_414749.2| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|170079844|ref|YP_001729164.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|238899606|ref|YP_002925402.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BW2952]
 gi|256024148|ref|ZP_05438013.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia sp. 4_1_40B]
 gi|300949355|ref|ZP_07163367.1| methyltransferase domain protein [Escherichia coli MS 116-1]
 gi|300958302|ref|ZP_07170445.1| methyltransferase domain protein [Escherichia coli MS 175-1]
 gi|301029640|ref|ZP_07192702.1| methyltransferase domain protein [Escherichia coli MS 196-1]
 gi|301645472|ref|ZP_07245409.1| methyltransferase domain protein [Escherichia coli MS 146-1]
 gi|307136808|ref|ZP_07496164.1| putative methyltransferase [Escherichia coli H736]
 gi|6226919|sp|P75672|YAFS_ECOLI RecName: Full=Uncharacterized protein yafS
 gi|1552783|gb|AAB08635.1| hypothetical protein [Escherichia coli]
 gi|4902950|dbj|BAA77884.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K12 substr. W3110]
 gi|87081700|gb|AAC73318.2| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|169887679|gb|ACB01386.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|238863088|gb|ACR65086.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BW2952]
 gi|260450590|gb|ACX41012.1| Methyltransferase type 11 [Escherichia coli DH1]
 gi|299877467|gb|EFI85678.1| methyltransferase domain protein [Escherichia coli MS 196-1]
 gi|300315008|gb|EFJ64792.1| methyltransferase domain protein [Escherichia coli MS 175-1]
 gi|300451238|gb|EFK14858.1| methyltransferase domain protein [Escherichia coli MS 116-1]
 gi|301076261|gb|EFK91067.1| methyltransferase domain protein [Escherichia coli MS 146-1]
 gi|315134898|dbj|BAJ42057.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli DH1]
 gi|315616889|gb|EFU97506.1| methyltransferase domain protein [Escherichia coli 3431]
 gi|323943404|gb|EGB39556.1| methyltransferase domain-containing protein [Escherichia coli E482]
          Length = 240

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 83/222 (37%), Gaps = 31/222 (13%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           GK    A+ + L+  +  + G  LL +G      +C    V   +     G       D 
Sbjct: 22  GKLYRKALERQLNPWFTKMYGFHLLKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADP 81

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                      +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N  
Sbjct: 82  L----------HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPI 131

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKL 189
                 +  P      PY+  +M +L+R+       NF +   SR    P          
Sbjct: 132 SFMGLRKLVPVLRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP---------- 180

Query: 190 WSVF-EKIGNIFGPGFAGIYVIEARK--ILYQGLPITESKKK 228
           W+    K+ N   P    + +I ARK  I     P+ +SK K
Sbjct: 181 WNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|327194324|gb|EGE61185.1| putative methyltransferase protein [Rhizobium etli CNPAF512]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP AD S D VL  H LE  EDP     EI RVL      I++ P
Sbjct: 120 NLPYADESFDFVLCSHVLEHVEDPVRATAEIRRVLKQDSVAILMAP 165


>gi|229029840|ref|ZP_04185910.1| Methyltransferase [Bacillus cereus AH1271]
 gi|228731455|gb|EEL82367.1| Methyltransferase [Bacillus cereus AH1271]
          Length = 232

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 9/99 (9%)

Query: 37  GCRLLGLGYAIPFFSCFHGK---VERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLAD 93
           GC   G GY     SC   K   V+ +   +  G+G    P+  F    L S   LP  +
Sbjct: 61  GC---GDGYGTYKLSCAGYKAVGVDLSEVMIQKGKGRGEGPNLSFIKGDLSS---LPFEN 114

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
              + ++ ++ LE+ E+P   L+EI RVL S G   + +
Sbjct: 115 EQFESIIAINSLEWTEEPLRALNEIKRVLKSDGYACIAI 153


>gi|190890843|ref|YP_001977385.1| methyltransferase [Rhizobium etli CIAT 652]
 gi|190696122|gb|ACE90207.1| putative methyltransferase protein [Rhizobium etli CIAT 652]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP AD S D VL  H LE  EDP     EI RVL      I++ P
Sbjct: 120 NLPYADESFDFVLCSHVLEHVEDPVRATAEIRRVLKQDSVAILMAP 165


>gi|304311303|ref|YP_003810901.1| hypothetical protein HDN1F_16660 [gamma proteobacterium HdN1]
 gi|301797036|emb|CBL45249.1| Hypothetical protein HDN1F_16660 [gamma proteobacterium HdN1]
          Length = 296

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
            L +A+ SVD V++ H L+F   P  +L E+ RV+  GG++++V  N   +W 
Sbjct: 120 ELAIANDSVDVVILHHCLDFTLQPQRILREVSRVVIPGGKIVIVGFNPWSLWG 172


>gi|218681043|ref|ZP_03528940.1| putative methyltransferase protein [Rhizobium etli CIAT 894]
          Length = 259

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP AD S D VL  H LE  EDP     EI RVL      I++ P
Sbjct: 120 NLPYADESFDFVLCSHVLEHVEDPVRATAEIRRVLKQDSVAILMAP 165


>gi|330470286|ref|YP_004408029.1| type 11 methyltransferase [Verrucosispora maris AB-18-032]
 gi|328813257|gb|AEB47429.1| methyltransferase type 11 [Verrucosispora maris AB-18-032]
          Length = 241

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P   G   +P     + A +S G+LPLAD SVD +  VH LE   D   +L E  RVL  
Sbjct: 102 PGNLGLDIFPAPGVDAVADLS-GSLPLADGSVDVLFAVHILEHLIDFLPLLDECHRVLRP 160

Query: 125 GGRMIVVVP 133
           GG + V+ P
Sbjct: 161 GGVLHVMSP 169


>gi|149377508|ref|ZP_01895249.1| biotin synthesis protein BioC [Marinobacter algicola DG893]
 gi|149358200|gb|EDM46681.1| biotin synthesis protein BioC [Marinobacter algicola DG893]
          Length = 274

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV------VVPNKRGMWARM 142
           LPL D+SVD V     +++  DP  +L E  RVL  GGR++V       +   R  W R 
Sbjct: 115 LPLPDNSVDVVFSNLMIQWCRDPAGVLAECRRVLRPGGRLLVSTLLEGTLDELREAWYRA 174

Query: 143 E--HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           +  H      +P + ++ ++L       L+I + SL +P
Sbjct: 175 DPGHQHVNRFEPEARFRELALETLPAPQLTIETISLDYP 213


>gi|73749101|ref|YP_308340.1| SAM-dependent methyltransferase [Dehalococcoides sp. CBDB1]
 gi|289433077|ref|YP_003462950.1| methyltransferase type 11 [Dehalococcoides sp. GT]
 gi|73660817|emb|CAI83424.1| SAM-dependent methyltransferase [Dehalococcoides sp. CBDB1]
 gi|288946797|gb|ADC74494.1| Methyltransferase type 11 [Dehalococcoides sp. GT]
          Length = 206

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 81  TALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           + L ++GN LPL + SVD      +L  AEDP  +++E+ R+L  GGR+++ 
Sbjct: 86  SCLQADGNTLPLKNQSVDYSFANMFLHHAEDPAGVINEMSRILLPGGRLVIT 137


>gi|119511471|ref|ZP_01630581.1| hypothetical protein N9414_08719 [Nodularia spumigena CCY9414]
 gi|119463859|gb|EAW44786.1| hypothetical protein N9414_08719 [Nodularia spumigena CCY9414]
          Length = 213

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 63  FMPAGQGATNWP----DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           F P  +  + W     DQ  +     S   +PL DSSVD  L+   LE  E P ++L E 
Sbjct: 38  FRPPIKQVSTWRYINIDQTTNPDFCCSAEAIPLPDSSVDGFLLCEVLEHLEAPEVVLKEA 97

Query: 119 WRVLTSGGRMIVVVP 133
           +R+L  GG+  + +P
Sbjct: 98  FRLLKPGGKGWITMP 112


>gi|52144121|ref|YP_082707.1| O-antigen biosynthesis protein; glycosyltransferase;
           methyltransferase [Bacillus cereus E33L]
 gi|51977590|gb|AAU19140.1| possible O-antigen biosynthesis protein; possible
           glycosyltransferase; possible methyltransferase
           [Bacillus cereus E33L]
          Length = 229

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 82/208 (39%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W+  E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           V +K     G GF        Y+IEA K
Sbjct: 201 VCKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|90416120|ref|ZP_01224053.1| hypothetical protein GB2207_02767 [marine gamma proteobacterium
           HTCC2207]
 gi|90332494|gb|EAS47691.1| hypothetical protein GB2207_02767 [marine gamma proteobacterium
           HTCC2207]
          Length = 291

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 10/131 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           +R++  +  G+       ++L      + G R+L LG +         +   TL      
Sbjct: 29  IRRWLDTDFGRYVLSRERRILREKCSKLPGYRMLRLGLS---------EDAETLDCFDHI 79

Query: 68  QGATNWPDQYFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
              +  P ++    A +S+   LPL   ++D +L+ H LEF+  P  +L E  RV   GG
Sbjct: 80  HRFSMHPSEFSGDHAAISDYMELPLMSETIDVMLLHHALEFSTSPKAVLAEAGRVTMPGG 139

Query: 127 RMIVVVPNKRG 137
            +I+ + N  G
Sbjct: 140 HLILCMFNPYG 150


>gi|325109544|ref|YP_004270612.1| methyltransferase type 11 [Planctomyces brasiliensis DSM 5305]
 gi|324969812|gb|ADY60590.1| Methyltransferase type 11 [Planctomyces brasiliensis DSM 5305]
          Length = 301

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           N+PL D+S DC++    +   +D   +  EI RVL  GGR+ V
Sbjct: 132 NMPLEDASADCIISNCVINLVDDKPAVFREIARVLKPGGRLAV 174


>gi|323455839|gb|EGB11707.1| hypothetical protein AURANDRAFT_61607 [Aureococcus anophagefferens]
          Length = 622

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 62  AFMPA-GQGATNW--PDQYF--SSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLML 115
           +++PA G G   W  P++     + A++ EG  L  AD S D V++    E    P    
Sbjct: 121 SYIPADGGGEELWFPPNEVVKADAAAVLQEGGVLEYADESFDAVVLYSAAELVTSPRATF 180

Query: 116 HEIWRVLTSGGRMIVVVPNKR 136
            E+WRVL  GGR IV     R
Sbjct: 181 RELWRVLKPGGRAIVAFSAAR 201


>gi|328882080|emb|CCA55319.1| putative methyltransferase [Streptomyces venezuelae ATCC 10712]
          Length = 244

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG   NLP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 67  GATATAMEGDALNLPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 125


>gi|254523034|ref|ZP_05135089.1| transcriptional regulator [Stenotrophomonas sp. SKA14]
 gi|219720625|gb|EED39150.1| transcriptional regulator [Stenotrophomonas sp. SKA14]
          Length = 309

 Score = 41.2 bits (95), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V EG+   LP  D S D V+++H L +A  P   + E  RVL SGGR+++         A
Sbjct: 197 VREGDMHALPFKDGSFDLVVLMHALTYASKPAQAVTEAARVLRSGGRLLLC------SLA 250

Query: 141 RMEH 144
           R EH
Sbjct: 251 RHEH 254


>gi|326779635|ref|ZP_08238900.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
 gi|326659968|gb|EGE44814.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG   NLP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALNLPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  W   +       G  + Y   Q+++ +REA  
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYKADQLLARIREAGL 164


>gi|182438981|ref|YP_001826700.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178467497|dbj|BAG22017.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG   NLP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALNLPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  W   +       G  + Y   Q+++ +REA  
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYKADQLLARIREAGL 164


>gi|329296920|ref|ZP_08254256.1| type 11 methyltransferase [Plautia stali symbiont]
          Length = 244

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-------K 135
           + S   LP    S+D  L+ H L +++DP  +L E+ RVL   G MI+   N        
Sbjct: 78  IASATQLPFEAKSIDACLLAHTLAWSQDPHRVLREVDRVLIDDGWMIISGFNPFSLLGIS 137

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTL 169
           +G+       P+ SG+ +S  +++  L   N+ L
Sbjct: 138 KGLPGLQRRAPW-SGRMFSQVRLLDWLSLLNYEL 170


>gi|282861667|ref|ZP_06270731.1| Methyltransferase type 11 [Streptomyces sp. ACTE]
 gi|282563483|gb|EFB69021.1| Methyltransferase type 11 [Streptomyces sp. ACTE]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG   NLP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 67  GATATAMEGDALNLPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 125


>gi|221201094|ref|ZP_03574134.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2M]
 gi|221206454|ref|ZP_03579467.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2]
 gi|221173763|gb|EEE06197.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2]
 gi|221178944|gb|EEE11351.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2M]
          Length = 1714

 Score = 40.8 bits (94), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           S  ++PLAD+SVD V+    +E  +    M+ EI RVL   G +I+  PNK
Sbjct: 111 SAADIPLADASVDLVVSFETIEHHDQHEAMMREIKRVLRPDGLVIISSPNK 161


>gi|84389768|ref|ZP_00991320.1| SAM-dependent methyltransferase [Vibrio splendidus 12B01]
 gi|84376869|gb|EAP93743.1| SAM-dependent methyltransferase [Vibrio splendidus 12B01]
          Length = 260

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 63/144 (43%), Gaps = 15/144 (10%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           NLP  + S D V++ H L+++ DP  +L E+ RV+   G +I+   N   +       P+
Sbjct: 83  NLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYIIITGFNPFSITGLASLLPW 142

Query: 148 G------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
                  SG+ Y+  ++   L   N+ +        FP +  +    +W+  E   N  G
Sbjct: 143 RKNSLPWSGRMYTPNRIKDWLGVLNYEVIHCDTYALFPMSKYQA---MWTWLE---NSLG 196

Query: 202 --PGFAG-IYVIEARKILYQGLPI 222
               FAG  Y I ARK  Y   PI
Sbjct: 197 GCASFAGSQYFIVARKRTYPLKPI 220


>gi|195349591|ref|XP_002041326.1| GM10287 [Drosophila sechellia]
 gi|194123021|gb|EDW45064.1| GM10287 [Drosophila sechellia]
          Length = 1269

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVL---MVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           D++F   AL     LP  D S D VL   +VH+    E     L E+ R+L  GGR+++ 
Sbjct: 78  DRWFRGVALCDNLELPFRDDSFDAVLSLAVVHHFATTERRVQALRELARILRIGGRVVIT 137

Query: 132 V 132
           V
Sbjct: 138 V 138


>gi|239979203|ref|ZP_04701727.1| putative methyltransferase [Streptomyces albus J1074]
 gi|291451081|ref|ZP_06590471.1| methyltransferase [Streptomyces albus J1074]
 gi|291354030|gb|EFE80932.1| methyltransferase [Streptomyces albus J1074]
          Length = 244

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG   NLP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 67  GATATAMEGDALNLPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 125


>gi|229078508|ref|ZP_04211068.1| O-antigen biosynthesis protein [Bacillus cereus Rock4-2]
 gi|229126623|ref|ZP_04255635.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-Cer4]
 gi|229143924|ref|ZP_04272341.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-ST24]
 gi|229177730|ref|ZP_04305104.1| O-antigen biosynthesis protein [Bacillus cereus 172560W]
 gi|228605694|gb|EEK63141.1| O-antigen biosynthesis protein [Bacillus cereus 172560W]
 gi|228639487|gb|EEK95900.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-ST24]
 gi|228656563|gb|EEL12389.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-Cer4]
 gi|228704824|gb|EEL57250.1| O-antigen biosynthesis protein [Bacillus cereus Rock4-2]
          Length = 232

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCVL    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IEKIDLPYEEGQFDCVLFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|302392775|ref|YP_003828595.1| methyltransferase type 11 [Acetohalobium arabaticum DSM 5501]
 gi|302204852|gb|ADL13530.1| Methyltransferase type 11 [Acetohalobium arabaticum DSM 5501]
          Length = 266

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV--VVPNKR 136
           LP AD+SVD V+    +  + D   +  EI+RVL SGGR+ +  VV N  
Sbjct: 144 LPAADNSVDVVISNCVINLSVDKEAVFQEIYRVLKSGGRIAISDVVKNNE 193


>gi|239940829|ref|ZP_04692766.1| putative methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|239987307|ref|ZP_04707971.1| putative methyltransferase [Streptomyces roseosporus NRRL 11379]
 gi|291444265|ref|ZP_06583655.1| methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|291347212|gb|EFE74116.1| methyltransferase [Streptomyces roseosporus NRRL 15998]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG   NLP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALNLPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  W   +       G  + Y   Q+++ +REA  
Sbjct: 127 GPEKICWTLSDAYHEVEGGHIRIYKADQLLARIREAGL 164


>gi|269836884|ref|YP_003319112.1| methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
 gi|269786147|gb|ACZ38290.1| Methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
          Length = 266

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
            LPL D SVD VL    LE   D    L E+ RVL  GG  ++  PN+R
Sbjct: 132 RLPLGDGSVDVVLSSDLLEHLPDVDGHLAEVARVLRPGGHYLIKTPNRR 180


>gi|189219781|ref|YP_001940422.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase
           [Methylacidiphilum infernorum V4]
 gi|189186639|gb|ACD83824.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase
           [Methylacidiphilum infernorum V4]
          Length = 245

 Score = 40.8 bits (94), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP AD + D V     +E  E+   +L EI+RVL S G +I+  PN   + +R+    FG
Sbjct: 75  LPYADHTFDIVTCTEVIEHLENFRRLLREIYRVLKSQGLVILSTPNLLNIKSRIRFFSFG 134


>gi|218235863|ref|YP_002365997.1| hypothetical protein BCB4264_A1264 [Bacillus cereus B4264]
 gi|218163820|gb|ACK63812.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 229

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPDAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCVL    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCVLFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|320011066|gb|ADW05916.1| Methyltransferase type 11 [Streptomyces flavogriseus ATCC 33331]
          Length = 243

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG   NLP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 67  GATATAMEGDALNLPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 125


>gi|254820547|ref|ZP_05225548.1| methyltransferase type 11 [Mycobacterium intracellulare ATCC 13950]
          Length = 248

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           LPL D++ D  +    L+   DP   L EI RVL  GGR+ ++VP
Sbjct: 151 LPLRDNTFDAAVSTAVLQLVPDPKAALAEIARVLRPGGRVAIMVP 195


>gi|242280120|ref|YP_002992249.1| methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
 gi|242123014|gb|ACS80710.1| Methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
          Length = 242

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 88/227 (38%), Gaps = 36/227 (15%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           A++K++   +   TG R L +G  +  F+      ++          A ++  + F  T 
Sbjct: 9   ALTKIIKDRFSGQTGIRHLDIGAGVGGFT------KQIKDACNLDTEACDFHSERFEPTD 62

Query: 83  L------VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           +      V +  LP  D+S D V  V  +E  +    ++ E  RVL  GG +I+  PN  
Sbjct: 63  ITIKKVNVCKEKLPYEDNSFDLVTSVEVIEHLDSYENLIGEAKRVLKPGGLLILTTPNIL 122

Query: 137 GMWARMEH-----------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
            M +R+ +            P  + + YS    IS +       ++T +       H   
Sbjct: 123 NMNSRISYFLNGFQQMFAPIPMKNEEHYSTGSHISPIHYFFLVHALTEKDFKNIDCHSDK 182

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           I K         + FG     + V+   K+L+      + KKKH+S 
Sbjct: 183 IQK---------SSFGKWLTCLPVLALSKVLF----FMKQKKKHLSE 216


>gi|126459356|ref|YP_001055634.1| methyltransferase type 11 [Pyrobaculum calidifontis JCM 11548]
 gi|126249077|gb|ABO08168.1| Methyltransferase type 11 [Pyrobaculum calidifontis JCM 11548]
          Length = 301

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 77  YFSSTALVS-------EGNLPLADSSVDC------VLMVHYLEFAEDPFLMLHEIWRVLT 123
           Y SS +LV        EG    A+S+ D       VL+V  +++  DP   L  IWR + 
Sbjct: 176 YDSSPSLVELAKKTAPEGTFVTANSACDVSGRFDVVLLVEKMQWFPDPARELECIWRAMA 235

Query: 124 SGGRMIVVVPNKRGMWARME-HTPFGSGQPYSWYQMISLLR 163
            GGR+ V  P    M   +  H   G+   YSW  + +LL+
Sbjct: 236 PGGRLYVAQPVVESMPGYLAIHAALGAIHVYSWKDVENLLQ 276


>gi|288920825|ref|ZP_06415123.1| Methyltransferase type 12 [Frankia sp. EUN1f]
 gi|288347784|gb|EFC82063.1| Methyltransferase type 12 [Frankia sp. EUN1f]
          Length = 676

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query: 86  EGNLP-LADS---SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---GM 138
            G LP LAD+     D V M HYLE   DP   L    +VL  GG ++V +PN     G 
Sbjct: 496 RGRLPDLADTLRDRYDVVSMFHYLEHTRDPRKELQAATQVLAPGGHLLVELPNPHCPAGR 555

Query: 139 WARMEHTPFGSGQPYSWY--QMISLLREANFTLSITSRSL-----FFPPTHK--KCILKL 189
           W       FG+  P  W   Q   LL   N T ++    L      F P H+     + L
Sbjct: 556 W-------FGTYWP-GWLVPQHQHLLPADNLTAALDDLGLKVLDVRFGPAHQGGDAPIAL 607

Query: 190 WSVFEK 195
           W  +++
Sbjct: 608 WGAWQR 613


>gi|315499698|ref|YP_004088501.1| methyltransferase type 11 [Asticcacaulis excentricus CB 48]
 gi|315417710|gb|ADU14350.1| Methyltransferase type 11 [Asticcacaulis excentricus CB 48]
          Length = 230

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           ++ +G  A  +  Q +    L  E +  PL   S+D  L +  +E   DP L L E  R+
Sbjct: 68  YLESGAAARGFAYQGYDIDTLNFESDAFPLEAQSLDLFLSLAVIEHLRDPGLFLSEALRL 127

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANF 167
           L  GG +++  PN +  +    + P    +PY+   + S+L+ A F
Sbjct: 128 LRPGGAVVISTPNFQQDFRNFYNDP-THVKPYTPLSLASVLKLAGF 172


>gi|315126184|ref|YP_004068187.1| S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas sp. SM9913]
 gi|315014698|gb|ADT68036.1| S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas sp. SM9913]
          Length = 253

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 3/82 (3%)

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           P  Y    A + E  LP  + S+D  +M H LE+  DP  +L E  R L  GG + +   
Sbjct: 71  PGPYTGVVADIDE--LPFYEHSIDACIMSHCLEYHSDPHHILREAHRTLIPGGYIAITGF 128

Query: 134 NKRGMWARMEHTPFGSGQPYSW 155
           N        +  PF SGQ   W
Sbjct: 129 NPFSFCGLAQLLPF-SGQKLPW 149


>gi|296131985|ref|YP_003639232.1| Methyltransferase type 11 [Thermincola sp. JR]
 gi|296030563|gb|ADG81331.1| Methyltransferase type 11 [Thermincola potens JR]
          Length = 277

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           NLP+AD+SVD V+    +  + D   +  EI+RVL  GGR+ +
Sbjct: 137 NLPVADNSVDVVISNCVINLSADKKRVFREIYRVLKPGGRVAI 179


>gi|289191539|ref|YP_003457480.1| Methyltransferase type 11 [Methanocaldococcus sp. FS406-22]
 gi|288937989|gb|ADC68744.1| Methyltransferase type 11 [Methanocaldococcus sp. FS406-22]
          Length = 205

 Score = 40.8 bits (94), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 68/140 (48%), Gaps = 17/140 (12%)

Query: 83  LVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
           ++++G +LP  D   D VL+   LEFAE+P  ML E  RVL  GG++I+ + +K     +
Sbjct: 76  IIAKGEDLPFKDEEFDFVLINTVLEFAENPKKMLKEAERVLKKGGKIIIGIIDKDSFLGK 135

Query: 142 MEHTPFGSGQPY------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
           +        + Y      S  ++I +L+E  F     ++++F      K I K+  V  K
Sbjct: 136 IYEEKKQKSKFYKDANFLSAKEVIEMLKELGFKNIKATQTIF------KEIDKVDKVEVK 189

Query: 196 IGNIFGPGFAGIYVIEARKI 215
            G  +G G  G   I A KI
Sbjct: 190 DG--YGEG--GFVSISAEKI 205


>gi|268323941|emb|CBH37529.1| conserved hypothetical protein, methyltransferase domain family
           [uncultured archaeon]
          Length = 201

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 17/94 (18%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---- 136
           + +GN   LP  D+S  C    +   F + P ++L+E +RVL  GGR+++          
Sbjct: 96  IVQGNAESLPWDDNSFTCATASNMFFFIDKPMIVLNEFYRVLKPGGRLVITSAEDSILPK 155

Query: 137 ---GMWARMEHTPFGSGQPYSWYQMISLLREANF 167
               +W+R  H        Y   +M S+L++A F
Sbjct: 156 LLFVLWSRSMHL-------YKNQEMESMLKQAGF 182


>gi|111023422|ref|YP_706394.1| 3-demethylubiquinone-9 3-O-methyltransferase [Rhodococcus jostii
           RHA1]
 gi|110822952|gb|ABG98236.1| probable 3-demethylubiquinone-9 3-O-methyltransferase [Rhodococcus
           jostii RHA1]
          Length = 275

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LPL   SVD V+    +E   D    L E +RVLT GG ++V  PN R  ++    TP 
Sbjct: 117 ELPLDGESVDTVVNFQVIEHLWDQAQFLRECFRVLTPGGELLVSTPN-RITFSPGRDTPL 175

Query: 148 G--SGQPYSWYQMISLLREANFTLSITS 173
                +     ++  LL EA F +++ +
Sbjct: 176 NPFHTRELDAAELTELLEEAGFRVALMT 203


>gi|30019362|ref|NP_830993.1| O-antigen biosynthesis protein rfbC [Bacillus cereus ATCC 14579]
 gi|228951694|ref|ZP_04113796.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229043060|ref|ZP_04190790.1| O-antigen biosynthesis protein [Bacillus cereus AH676]
 gi|296501905|ref|YP_003663605.1| O-antigen biosynthesis protein rfbC [Bacillus thuringiensis BMB171]
 gi|29894905|gb|AAP08194.1| O-antigen biosynthesis protein rfbC [Bacillus cereus ATCC 14579]
 gi|228726301|gb|EEL77528.1| O-antigen biosynthesis protein [Bacillus cereus AH676]
 gi|228807979|gb|EEM54496.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|296322957|gb|ADH05885.1| O-antigen biosynthesis protein rfbC [Bacillus thuringiensis BMB171]
          Length = 229

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCVL    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCVLFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|297194652|ref|ZP_06912050.1| methyltransferase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197720319|gb|EDY64227.1| methyltransferase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 244

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG   NLP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 67  GATATAMEGDALNLPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAVTVPR 125


>gi|312869505|ref|ZP_07729660.1| methyltransferase domain protein [Lactobacillus oris PB013-T2-3]
 gi|311094952|gb|EFQ53241.1| methyltransferase domain protein [Lactobacillus oris PB013-T2-3]
          Length = 285

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 42/94 (44%), Gaps = 13/94 (13%)

Query: 98  CVLMVHYLEFAEDPFLMLHEIW---------RVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           CV  +  L F +D F  L E++         RVL  GGR+I VVPN   +   + H  +G
Sbjct: 145 CVADLRQLPFNDDSFDSLVELFSPSDYTEFKRVLRPGGRLIKVVPNSDYLL-ELRHLLYG 203

Query: 149 SGQPYSWY---QMISLLREANFTLSITSRSLFFP 179
             Q +S Y   Q++ L R    T  +      FP
Sbjct: 204 RDQAHSHYDNQQVVDLFRRHYPTAQVDRVRYQFP 237


>gi|218510456|ref|ZP_03508334.1| putative methyltransferase protein [Rhizobium etli Brasil 5]
          Length = 259

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP AD S D VL  H LE  EDP     EI RVL      +++ P
Sbjct: 120 NLPYADESFDFVLCSHVLEHVEDPVRATAEIRRVLKQDSVAVLMAP 165


>gi|126663181|ref|ZP_01734179.1| SAM-dependent methyltransferase [Flavobacteria bacterium BAL38]
 gi|126624839|gb|EAZ95529.1| SAM-dependent methyltransferase [Flavobacteria bacterium BAL38]
          Length = 254

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           NLP  D+S D +L  H LE   D    + E++RVL +GG  I  +P 
Sbjct: 131 NLPFEDNSYDMILCNHVLEHIPDDTKAMQELYRVLKTGGMGIFQIPQ 177


>gi|77360890|ref|YP_340465.1| S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76875801|emb|CAI87022.1| conserved protein of unknown function ; putative
           S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 255

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 76  QYFSSTALVSE-GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           Q  + T ++++   LP  + ++D  ++ H LE+  DP  +L E  R L  GG ++V   N
Sbjct: 70  QAGAHTGVIADIDELPFYEHTIDACILSHCLEYHSDPHHILREAHRTLIPGGYIVVTGFN 129

Query: 135 KRGMWARMEHTPFGSGQPYSW 155
              +    +  PF SGQ   W
Sbjct: 130 PFSLCGLAQLLPF-SGQKLPW 149


>gi|330810142|ref|YP_004354604.1| hypothetical protein PSEBR_a3285 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378250|gb|AEA69600.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 252

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 63/158 (39%), Gaps = 3/158 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V+M H L+F   P  +L E    +  GG ++++  N    W   
Sbjct: 84  VCEEQAWPLSEHAADVVVMQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWGLR 143

Query: 143 E---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
               H      +  S  ++   L    F L       + PP          + +E+    
Sbjct: 144 HVFAHDALRQARCISASRVGDWLNLLGFALEKRRFGCYRPPLASPKWQARLAGWERKAGD 203

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           +     G Y++ ARKI     P+ +++++ +   I +P
Sbjct: 204 WQLSGGGFYLLVARKIAVGLRPVRQARREPMGKLIPLP 241


>gi|182415791|ref|YP_001820857.1| methyltransferase type 11 [Opitutus terrae PB90-1]
 gi|177843005|gb|ACB77257.1| Methyltransferase type 11 [Opitutus terrae PB90-1]
          Length = 293

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 9/90 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR----GMWARM-- 142
           LP  D++ D V+   YLE  E P + L E+ RVL  GG + +V P ++    G+ +R+  
Sbjct: 106 LPFGDATFDYVIFFDYLEHIERPAVSLAEMSRVLKPGGYLHLVCPAEKQSIFGLSSRLFG 165

Query: 143 ---EHTPFGSGQPYSWYQMISLLREANFTL 169
              + T  G  Q +    + +L+R A  ++
Sbjct: 166 RHFKETTAGHIQQFLRADLEALVRAAGLSV 195


>gi|315441783|ref|YP_004074662.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Mycobacterium sp. Spyr1]
 gi|315260086|gb|ADT96827.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Mycobacterium sp. Spyr1]
          Length = 236

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LPL+D SVD V+ +  L+   +P   + E+ RVL  G R+ V+VP      A + + P 
Sbjct: 138 DLPLSDESVDGVVSIAMLQLIPEPAQAVAEMVRVLRPGRRVAVMVPTAGPAAAALRYLPH 197

Query: 148 GSGQPYSWYQMISLLREANFT 168
                +   ++  +      T
Sbjct: 198 AGAHSFGDDELADVFEGLGLT 218


>gi|296283000|ref|ZP_06860998.1| transcriptional regulator [Citromicrobium bathyomarinum JL354]
          Length = 329

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV---VPNKRGMWARMEH 144
           +LP   +S D VL    L +A DP + L E  RVL  GGR+ +V      +  +  R +H
Sbjct: 214 SLPFDSASFDTVLFHQVLHYAPDPLVPLREAARVLRPGGRIAIVDFAAHQQEELRERFQH 273

Query: 145 TPFGSGQPYSWYQMISLLREANFT 168
              G    +   Q++  L +  F 
Sbjct: 274 ARLG----FEDGQLVGALEQTGFA 293


>gi|125718239|ref|YP_001035372.1| hypothetical protein SSA_1428 [Streptococcus sanguinis SK36]
 gi|125498156|gb|ABN44822.1| Conserved hypothetical protein [Streptococcus sanguinis SK36]
          Length = 236

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 10/146 (6%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           GK   D +   L +    + G ++L  G      + F  +  +  A  P+ +       Q
Sbjct: 17  GKLQYDIVFAFLES----LKGQKILDFGSGFGIVADFLAENNQVTAIEPSSEMIPERK-Q 71

Query: 77  YFSSTALVSEGNL--PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            FS   L    NL   L D S D ++  + LE+  DP L L E  R+L   G++ +V  +
Sbjct: 72  NFSYEQLQGSLNLLKNLPDQSFDVIICHNVLEYVSDPALYLAEFSRLLKKDGKISLVKHH 131

Query: 135 KRGMWARMEHTPFGSGQPYSWYQMIS 160
           + G   R+ HT      P    Q+++
Sbjct: 132 EVG---RIMHTVVFENDPEKAQQLLA 154


>gi|295096914|emb|CBK86004.1| Methylase involved in ubiquinone/menaquinone biosynthesis
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 199

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP A+ S+D  L+ H L +  DP  +L E  RVL   G +I+   N   +    + TP 
Sbjct: 44  HLPFAEKSIDACLLAHTLPWCSDPHRLLREADRVLIDDGWLILSGFNPLSLMGLRKLTPV 103

Query: 148 GSGQPYSWYQMISLLREANF 167
               P    +M +++R+ ++
Sbjct: 104 LRRTPPYNSRMFTMMRQLDW 123


>gi|302524923|ref|ZP_07277265.1| methyltransferase type 11 [Streptomyces sp. AA4]
 gi|302433818|gb|EFL05634.1| methyltransferase type 11 [Streptomyces sp. AA4]
          Length = 265

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 18/109 (16%)

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           A  +PD    S A  +   LPL D +VD V     +E   D    L E +RVL  GG+++
Sbjct: 91  ARRYPD---VSVARANLAYLPLRDGAVDVVANFQVIEHLWDQDGFLAECFRVLRPGGKLL 147

Query: 130 VVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLREANFTLS 170
           V  PN      R+  TP  S  P + +        +M  LLR A F ++
Sbjct: 148 VTTPN------RLTFTP-DSDTPLNPFHTRELAPSEMDDLLRAAGFAVA 189


>gi|120401137|ref|YP_950966.1| type 11 methyltransferase [Mycobacterium vanbaalenii PYR-1]
 gi|119953955|gb|ABM10960.1| Methyltransferase type 11 [Mycobacterium vanbaalenii PYR-1]
          Length = 236

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           +LP  D S D V+ +  L+   DP + L E+ RVL  G RM V+VP
Sbjct: 138 HLPFRDESFDAVVSIAMLQLIPDPAVALAEMVRVLRPGRRMAVMVP 183


>gi|296163290|ref|ZP_06846052.1| glycosyl transferase family 2 [Burkholderia sp. Ch1-1]
 gi|295886472|gb|EFG66328.1| glycosyl transferase family 2 [Burkholderia sp. Ch1-1]
          Length = 1123

 Score = 40.8 bits (94), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
           S  ++PL D+SVD V+    +E  +    ML EI RVL  GG +++  P++R 
Sbjct: 85  SASDIPLPDASVDVVVSFETIEHHDQHDKMLAEIKRVLRPGGLLVMSSPDRRA 137


>gi|242281097|ref|YP_002993226.1| methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
 gi|242123991|gb|ACS81687.1| Methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
          Length = 181

 Score = 40.8 bits (94), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           L +  +LP  + S D + MV    + ED   ML E  RVL  GGR+I+    +  + A  
Sbjct: 54  LTTGSSLPFKNESFDMIFMVAVDYYVEDHEAMLAECQRVLKKGGRLIIATYKQENL-AHQ 112

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
             T   +   +S  +  +  ++A F   +  + +  PP +
Sbjct: 113 VATQDEAWHAFSEDEYAARYKKAGFNNFVIDKIINNPPQN 152


>gi|27479698|gb|AAO17225.1| Orf71 [Photorhabdus luminescens]
          Length = 257

 Score = 40.8 bits (94), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 61/152 (40%), Gaps = 12/152 (7%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+    A+ + L   W  + G  LL +G            +   +     G+      D 
Sbjct: 41  GEYYRAALERQLQPWWPKIFGFHLLKVGNLSAEIDSKECPIFNQINVGKEGKNMQVITDP 100

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           Y          +LP  + SVD  L+ H L ++ DP  +L E+ RV+   G +I+   N  
Sbjct: 101 Y----------HLPFEEKSVDACLLSHMLAYSADPHRLLREVDRVMIDDGWLIISGFNSL 150

Query: 137 GMWARMEHTP-FGSGQPYSWYQMISLLREANF 167
            +    +  P     QPY   +M SL+R+ ++
Sbjct: 151 SLLGLGKLVPGLWRHQPYC-SRMFSLMRQLDW 181


>gi|284046939|ref|YP_003397279.1| methyltransferase type 11 [Conexibacter woesei DSM 14684]
 gi|283951160|gb|ADB53904.1| Methyltransferase type 11 [Conexibacter woesei DSM 14684]
          Length = 196

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-KRGMWARMEH-TP 146
           LP  D+S D V++   LE   DP  ++ E+ RVL  GGR+    P+ +R +W    H  P
Sbjct: 72  LPFPDASFDGVVLKDLLEHVPDPVAVVTEVLRVLRPGGRVFASSPDAQRWVWDDYTHRRP 131

Query: 147 F 147
           F
Sbjct: 132 F 132


>gi|23014863|ref|ZP_00054659.1| COG0500: SAM-dependent methyltransferases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 321

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           S  +V +G+   LPL  +S D V +   L +A DP  ++ E  RVL  GGR+ VV
Sbjct: 198 SNCMVRQGDIAQLPLPAASADAVTIHQVLHYAADPAALVAEAARVLEPGGRLAVV 252


>gi|320104462|ref|YP_004180053.1| type 11 methyltransferase [Isosphaera pallida ATCC 43644]
 gi|319751744|gb|ADV63504.1| Methyltransferase type 11 [Isosphaera pallida ATCC 43644]
          Length = 294

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 33/77 (42%), Gaps = 17/77 (22%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPLAD S D       L FA DP L L E+ R+L  GGR    V      W    H P  
Sbjct: 119 LPLADGSQDAATCRWGLMFAVDPSLALREVVRILKPGGRFAASV------WDHARHVP-- 170

Query: 149 SGQPYSWYQMISLLREA 165
                    MI+L R+A
Sbjct: 171 ---------MIALARDA 178


>gi|308389417|gb|ADO31737.1| hypothetical protein NMBB_1426 [Neisseria meningitidis alpha710]
          Length = 158

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 52/128 (40%), Gaps = 13/128 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-------- 140
           + LAD S D +L  H LE    P  +L E  R+L   GR+++   N   +W         
Sbjct: 1   MALADVSADMLLFPHTLE-GGVPSQILSEAHRILKPCGRLMLTGFNPYSLWGFSRWFDGE 59

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
           R+    F    P    ++   L +  F +      ++ PP      ++ W   EK G+ +
Sbjct: 60  RLPEKRFCLPLP----ELKRRLADVGFDIEFGKFMVYLPPVSSLGQIRFWQFMEKAGDRW 115

Query: 201 GPGFAGIY 208
            P  A +Y
Sbjct: 116 WPQCAAVY 123


>gi|307328692|ref|ZP_07607864.1| Methyltransferase type 11 [Streptomyces violaceusniger Tu 4113]
 gi|306885641|gb|EFN16655.1| Methyltransferase type 11 [Streptomyces violaceusniger Tu 4113]
          Length = 247

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL +GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLKAGGRIAVTVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  WA  +       G  + Y   +++  +REA  
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYRADELLEKMREAGL 164


>gi|253577113|ref|ZP_04854434.1| methyltransferase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843495|gb|EES71522.1| methyltransferase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 246

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 60/133 (45%), Gaps = 9/133 (6%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
           ++Y     + + +A    +      VTG R+L +G +    S   G+  R +  +   +G
Sbjct: 10  RYYGQVNSEKSHEATRARIHWICRQVTGRRVLDVGCSQGITSILLGREGRRVLGLDLEEG 69

Query: 70  ATNWPDQYFS--STALVSEGNLPLADSS-------VDCVLMVHYLEFAEDPFLMLHEIWR 120
           A ++  +  S  S  + S+    +AD +        D V++   LE   +P +++   +R
Sbjct: 70  AIHYAKRELSRESKPVRSKVQFKVADVTEFQGHKLFDTVILGQILEHFANPGVLISHAYR 129

Query: 121 VLTSGGRMIVVVP 133
           +L  GG +IV VP
Sbjct: 130 LLADGGTLIVTVP 142


>gi|254777574|ref|ZP_05219090.1| methyltransferase type 11 [Mycobacterium avium subsp. avium ATCC
           25291]
          Length = 248

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           LPL D++VD  +    L+    P   L EI RVL  GGR+ V+VP
Sbjct: 151 LPLRDNTVDAAVSTAVLQLVPKPQAALVEIARVLRPGGRLAVMVP 195


>gi|229068871|ref|ZP_04202165.1| O-antigen biosynthesis protein [Bacillus cereus F65185]
 gi|228714155|gb|EEL66036.1| O-antigen biosynthesis protein [Bacillus cereus F65185]
          Length = 229

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEKARERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCVL    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCVLFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|169630445|ref|YP_001704094.1| hypothetical protein MAB_3364 [Mycobacterium abscessus ATCC 19977]
 gi|169242412|emb|CAM63440.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 273

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 4/103 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LPLAD SVD V+    +E   D    + E  RVL  GG +++  PN R  ++    TP 
Sbjct: 115 DLPLADGSVDVVVNFQVIEHLWDQGQFIRECARVLRPGGSLLISTPN-RITFSPGRDTPL 173

Query: 148 G--SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
                +  +  ++  LL E  F+L  +   +F  P  ++   K
Sbjct: 174 NPFHTRELNGAELTELLEENGFSLE-SMNGVFHGPRLRELDAK 215


>gi|302038156|ref|YP_003798478.1| hypothetical protein NIDE2850 [Candidatus Nitrospira defluvii]
 gi|300606220|emb|CBK42553.1| protein of unknown function [Candidatus Nitrospira defluvii]
          Length = 172

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           + +P   G    P    S    +S  + P  DSSV+  ++ + LE   D   ++ E+WRV
Sbjct: 13  SVLPEYTGVDLSPQPGVSVVCDLSRKSWPFQDSSVERCVLFNLLEHLPDTIQVMEELWRV 72

Query: 122 LTSGGRMIVVVP--NKRGMWARMEHTPFGSGQPYSWY 156
              GG + + VP  N  G +    H  F + + + ++
Sbjct: 73  TRPGGIVHIQVPYYNSAGAFQDPTHVKFFTERTFDYF 109


>gi|329120513|ref|ZP_08249178.1| generic methyl-transferase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327461971|gb|EGF08301.1| generic methyl-transferase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 212

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-- 140
           +++   LP A  S+D +L+ H LE       +LHE +RVL + GR+++   N   +W   
Sbjct: 61  MLAADALPFAADSMDLLLLPHGLETPCRAG-VLHEAYRVLAAEGRLVLSGFNPHSVWRLL 119

Query: 141 -RMEHTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
            R E  PF   G      ++ +L ++A F    T   + +PP  +
Sbjct: 120 YRAERKPFPDGGNSIPIGRLKTLWQDAGFEAERTEWLVCWPPADE 164


>gi|77458412|ref|YP_347917.1| hypothetical protein Pfl01_2185 [Pseudomonas fluorescens Pf0-1]
 gi|77382415|gb|ABA73928.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 252

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 63/158 (39%), Gaps = 3/158 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG +++V  N    W   
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIVGINPWSTWGLR 143

Query: 143 E---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
               H      +  S  ++   L    F L       + PP          + +E+    
Sbjct: 144 HVFAHDALHQARCISPSRVADWLNLLGFALEKRRFGCYRPPLASPKWQARLAGWERKAGD 203

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           +     G Y++ ARKI+    P+ + +++ +   I +P
Sbjct: 204 WQLSGGGFYLLVARKIVVGLRPVRQERREPMGKLIPLP 241


>gi|326796077|ref|YP_004313897.1| SAM-dependent methyltransferase [Marinomonas mediterranea MMB-1]
 gi|326546841|gb|ADZ92061.1| SAM-dependent methyltransferase [Marinomonas mediterranea MMB-1]
          Length = 246

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 13/153 (8%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            S+ +     LPL    VD  ++ H L+ + +P   L E  R L   G++I+V  N   M
Sbjct: 74  DSSIIARSSELPLEGDGVDLHVLHHTLDVSLEPHDDLREAARTLLPSGKLIIVGFNPWSM 133

Query: 139 W------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
           W      ++ +  P+  G+  S  ++   L+ A  TL       + PP       K  S 
Sbjct: 134 WGIRRVFSKRKKAPW-CGRFISHARLEDWLKVAGLTLEKRQFISYAPPVQSD---KWRSR 189

Query: 193 FEKIGNIF---GPGFAGIYVIEARKILYQGLPI 222
           F  +G  F      F G+Y++   K   + +PI
Sbjct: 190 FHWLGQYFKFLKLPFGGVYILTVTKETKRFIPI 222


>gi|319943375|ref|ZP_08017657.1| putative methyltransferase [Lautropia mirabilis ATCC 51599]
 gi|319743190|gb|EFV95595.1| putative methyltransferase [Lautropia mirabilis ATCC 51599]
          Length = 215

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 47/108 (43%), Gaps = 17/108 (15%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LPLAD+S D  L V+ + F  D   ML E+ RVL  GGR+ +    K    A M+  PF
Sbjct: 106 RLPLADASFDRALAVNTVYFWADMPAMLAELARVLKPGGRLCLTFAEK----AFMQRLPF 161

Query: 148 GSGQPYSW-------------YQMISLLREANFTLSITSRSLFFPPTH 182
            +     W              Q ++ ++E +  +S   R +  P  H
Sbjct: 162 AAHGFALWDATDIEQQVGALPLQRVARVQEEDLAVSKDGRLVKRPYVH 209


>gi|239909054|ref|YP_002955796.1| hypothetical protein DMR_44190 [Desulfovibrio magneticus RS-1]
 gi|239798921|dbj|BAH77910.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 282

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            L   D+S D V+     E   DP+    E+WRVL  GGR +  VP   G
Sbjct: 128 RLSFPDASFDLVVTQDVFEHVADPWRAFAEVWRVLAPGGRHVFTVPLNEG 177


>gi|296140612|ref|YP_003647855.1| methyltransferase type 11 [Tsukamurella paurometabola DSM 20162]
 gi|296028746|gb|ADG79516.1| Methyltransferase type 11 [Tsukamurella paurometabola DSM 20162]
          Length = 248

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
             LPL D+SVD V+    +E   D    L E+ RVL  GG +++  PN+
Sbjct: 91  AELPLDDASVDAVVNFQVIEHLWDQPQFLREVARVLRPGGELVISTPNR 139


>gi|228984386|ref|ZP_04144565.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229154881|ref|ZP_04282995.1| O-antigen biosynthesis protein [Bacillus cereus ATCC 4342]
 gi|228628439|gb|EEK85152.1| O-antigen biosynthesis protein [Bacillus cereus ATCC 4342]
 gi|228775355|gb|EEM23742.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 229

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|254468296|ref|ZP_05081702.1| generic methyl-transferase [beta proteobacterium KB13]
 gi|207087106|gb|EDZ64389.1| generic methyl-transferase [beta proteobacterium KB13]
          Length = 216

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 15/144 (10%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK------RGMWARM 142
           LP    ++DC+++ H  +  ED   ML E++R L   G  I +  N       R  ++  
Sbjct: 63  LPFESDAIDCIVLPH--QNTEDE-RMLSEVYRSLMPHGHAIFINFNPWSPIGLRTFFSMS 119

Query: 143 EHTPFGSG-QPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
              P+    + ++ +Q  + L + +F + +  +   + P  K    K  S ++KIG+ + 
Sbjct: 120 SEEPWNHNLESFTSFQ--NKLLKQDFEI-VNGKFFGYHPRFKSASNK--SRWDKIGDRWF 174

Query: 202 PGFAGIYVIEARKILYQGLPITES 225
           P FA IY+I  RK ++   PI  S
Sbjct: 175 PLFANIYLIVVRKKIFTMTPIKPS 198


>gi|254458199|ref|ZP_05071625.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
 gi|207085035|gb|EDZ62321.1| conserved hypothetical protein [Campylobacterales bacterium GD 1]
          Length = 162

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           A ++ G LP  D+S+D +   H+LE   D   +L EI RVL   G+ I  VP+
Sbjct: 8   ANINNG-LPFDDNSIDEIYSFHFLEHVSDLEFVLKEIHRVLKPNGKKIGTVPH 59


>gi|78044795|ref|YP_359413.1| UbiE/COQ5 family methlytransferase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996910|gb|ABB15809.1| methyltransferase, UbiE/COQ5 family [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 204

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 40/101 (39%), Gaps = 17/101 (16%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP-----------NKR 136
           NLP    S D V+    L  A D   +  EI+RVL   G  IV  P           N  
Sbjct: 91  NLPFVGESFDVVISNCALNHARDKLKVYREIYRVLKEDGYFIVSDPVSLVELPPEIKNNE 150

Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            +WA+     F   +  S Y  +  + EA FTL I  R  +
Sbjct: 151 ELWAQC----FAGAEEESKY--LRYIIEAGFTLEILKRREY 185


>gi|254518879|ref|ZP_05130935.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
 gi|226912628|gb|EEH97829.1| conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
          Length = 184

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 32/51 (62%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           S A++SE  +PLA+++ D V M+      +DP  +L +  RVL + G++++
Sbjct: 89  SIAIMSENEIPLAENTADLVFMITVHHELKDPVSLLKDAKRVLKNDGKLLI 139


>gi|94970154|ref|YP_592202.1| methyltransferase type 11 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552204|gb|ABF42128.1| Methyltransferase type 11 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 261

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 80/191 (41%), Gaps = 16/191 (8%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLL----GLGYAIPFFSCFHGKVERTLA 62
           ++  FY  F+ +     I +V+ST   D     +L    G G      S F G+V  T  
Sbjct: 11  DVESFYWWFIAR--RKLIREVVSTHSKDPAHTTILDVGCGTGLNHEMLSEF-GEVFGT-- 65

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
              A + A  +  Q      ++S+   L  AD + + V  +  LE   D    + EIWRV
Sbjct: 66  --DASEEALRFSRQRNIQNLVLSDAEALQFADETFEIVTALDVLEHVNDDLKAISEIWRV 123

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS---RSLFF 178
           +   G  ++ VP    +W+  +       + Y+ +++ + L  A F +  ++    SLFF
Sbjct: 124 MKPDGVFVISVPAYGFLWSEHDEA-LHHRRRYAAHELRNKLINAGFEVERSTYFISSLFF 182

Query: 179 PPTHKKCILKL 189
           P    + +  L
Sbjct: 183 PILFMRIVQNL 193


>gi|332306245|ref|YP_004434096.1| hypothetical protein Glaag_1882 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173574|gb|AEE22828.1| hypothetical protein Glaag_1882 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 249

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 65/151 (43%), Gaps = 23/151 (15%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           + L +SSVD  ++VH L+FA+DP  +L E+ R +   G + +V  N   +          
Sbjct: 85  MALKESSVDGFVLVHELDFAQDPHQILREVDRAIMPDGDLAIVGFNPLSL---------T 135

Query: 149 SGQPYSWYQMISLLREANF-----------TLSITSRSLFFPPTHKKCILKLWSVFEKIG 197
             +   W+   S+L EA +            L      + + P  K    +  ++  +  
Sbjct: 136 GLRKLMWFNRQSILHEARYFSVPRIKDWLQLLGFEVTQVKYMPYSKFFTNRPNNIVTRWC 195

Query: 198 NIFGPGFAGIYVIEARKILYQGLPITESKKK 228
             F P  A +Y+I A+K   + +P++  K K
Sbjct: 196 QRFLPQLASVYIIVAKK---RTVPLSPIKPK 223


>gi|66045007|ref|YP_234848.1| hypothetical protein Psyr_1762 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255714|gb|AAY36810.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|330972574|gb|EGH72640.1| hypothetical protein PSYAR_18985 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 253

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 63/159 (39%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  +
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSTWG-I 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E++G 
Sbjct: 143 RHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLERLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G YV+ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMP 241


>gi|167997907|ref|XP_001751660.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162697641|gb|EDQ83977.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 243

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A + A N     F    L  E  L  AD+S D VL    +++ E P  +  +I+RVL  G
Sbjct: 89  AQELARNRQLNQFFVKDLNEEPKLESADNSFDAVLCTVSVQYLEQPEKVFADIFRVLKPG 148

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMI 159
           G  IV   N+  M+     T +  G  YS  Q++
Sbjct: 149 GVCIVSFSNR--MFYEKAVTAWRDGSDYSRTQLV 180


>gi|22126972|ref|NP_670395.1| hypothetical protein y3096 [Yersinia pestis KIM 10]
 gi|45442537|ref|NP_994076.1| hypothetical protein YP_2769 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597281|ref|YP_071472.1| hypothetical protein YPTB2966 [Yersinia pseudotuberculosis IP
           32953]
 gi|108806555|ref|YP_650471.1| hypothetical protein YPA_0558 [Yersinia pestis Antiqua]
 gi|108813078|ref|YP_648845.1| hypothetical protein YPN_2918 [Yersinia pestis Nepal516]
 gi|145598914|ref|YP_001162990.1| hypothetical protein YPDSF_1632 [Yersinia pestis Pestoides F]
 gi|149366917|ref|ZP_01888951.1| hypothetical protein YPE_2175 [Yersinia pestis CA88-4125]
 gi|153950302|ref|YP_001400034.1| methyltransferase [Yersinia pseudotuberculosis IP 31758]
 gi|162420142|ref|YP_001607085.1| hypothetical protein YpAngola_A2684 [Yersinia pestis Angola]
 gi|165924746|ref|ZP_02220578.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938365|ref|ZP_02226923.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011955|ref|ZP_02232853.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211355|ref|ZP_02237390.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399823|ref|ZP_02305341.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419663|ref|ZP_02311416.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423855|ref|ZP_02315608.1| putative methyltransferase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470219|ref|ZP_02334923.1| putative methyltransferase [Yersinia pestis FV-1]
 gi|170023353|ref|YP_001719858.1| type 11 methyltransferase [Yersinia pseudotuberculosis YPIII]
 gi|186896386|ref|YP_001873498.1| type 11 methyltransferase [Yersinia pseudotuberculosis PB1/+]
 gi|218928249|ref|YP_002346124.1| hypothetical protein YPO1080 [Yersinia pestis CO92]
 gi|229841011|ref|ZP_04461170.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843116|ref|ZP_04463262.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229895466|ref|ZP_04510638.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Pestoides A]
 gi|229903521|ref|ZP_04518634.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Nepal516]
 gi|270487302|ref|ZP_06204376.1| methyltransferase domain protein [Yersinia pestis KIM D27]
 gi|21960015|gb|AAM86646.1|AE013910_8 hypothetical protein y3096 [Yersinia pestis KIM 10]
 gi|45437402|gb|AAS62953.1| SAM-dependent methyltransferases [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590563|emb|CAH22204.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108776726|gb|ABG19245.1| hypothetical protein YPN_2918 [Yersinia pestis Nepal516]
 gi|108778468|gb|ABG12526.1| hypothetical protein YPA_0558 [Yersinia pestis Antiqua]
 gi|115346860|emb|CAL19746.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145210610|gb|ABP40017.1| hypothetical protein YPDSF_1632 [Yersinia pestis Pestoides F]
 gi|149291291|gb|EDM41366.1| hypothetical protein YPE_2175 [Yersinia pestis CA88-4125]
 gi|152961797|gb|ABS49258.1| putative methyltransferase [Yersinia pseudotuberculosis IP 31758]
 gi|162352957|gb|ABX86905.1| putative methyltransferase [Yersinia pestis Angola]
 gi|165913743|gb|EDR32362.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923806|gb|EDR40938.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989122|gb|EDR41423.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207126|gb|EDR51606.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962404|gb|EDR58425.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050531|gb|EDR61939.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056704|gb|EDR66467.1| putative methyltransferase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749887|gb|ACA67405.1| Methyltransferase type 11 [Yersinia pseudotuberculosis YPIII]
 gi|186699412|gb|ACC90041.1| Methyltransferase type 11 [Yersinia pseudotuberculosis PB1/+]
 gi|229679291|gb|EEO75394.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Nepal516]
 gi|229689463|gb|EEO81524.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697377|gb|EEO87424.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701621|gb|EEO89648.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Pestoides A]
 gi|262361133|gb|ACY57854.1| hypothetical protein YPD4_0945 [Yersinia pestis D106004]
 gi|262365376|gb|ACY61933.1| hypothetical protein YPD8_1248 [Yersinia pestis D182038]
 gi|270335806|gb|EFA46583.1| methyltransferase domain protein [Yersinia pestis KIM D27]
 gi|320014216|gb|ADV97787.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 239

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           L S   LP A+ SVD  L+ H L +A +P  +L E+ RVL   G +++
Sbjct: 78  LASPYQLPFAEKSVDACLLSHTLAYAANPHRILREVDRVLIDDGWLVI 125


>gi|323474313|gb|ADX84919.1| methyltransferase type 11 [Sulfolobus islandicus REY15A]
          Length = 239

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           V+   +PL D+S+D V+    +E   +  L++ EI RVL  GG +I+  PN
Sbjct: 91  VNVSKIPLGDASIDVVIFEEVIEHLYNSDLIISEIKRVLKKGGILILSTPN 141


>gi|146299521|ref|YP_001194112.1| methyltransferase type 11 [Flavobacterium johnsoniae UW101]
 gi|146153939|gb|ABQ04793.1| Methyltransferase type 11 [Flavobacterium johnsoniae UW101]
          Length = 257

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           NLP  D+  D +L  H LE   D    + E++RVL  GG  I+ +P 
Sbjct: 131 NLPFKDNEYDVILCNHVLEHIPDDTKAMQELYRVLKPGGMAILQIPQ 177


>gi|238061227|ref|ZP_04605936.1| methyltransferase type 11 [Micromonospora sp. ATCC 39149]
 gi|237883038|gb|EEP71866.1| methyltransferase type 11 [Micromonospora sp. ATCC 39149]
          Length = 241

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P   G   +P     + A +S G+LPLAD SVD +  VH LE   D   ++ E  RVL  
Sbjct: 102 PLNLGLDIYPAPGVDAVADLS-GSLPLADDSVDVLFAVHILEHLIDFLPLVDECHRVLRP 160

Query: 125 GGRMIVVVP 133
           GG + V+ P
Sbjct: 161 GGVLHVMSP 169


>gi|289679439|ref|ZP_06500329.1| hypothetical protein PsyrpsF_39452 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330897778|gb|EGH29197.1| hypothetical protein PSYJA_09560 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330975087|gb|EGH75153.1| hypothetical protein PSYAP_00220 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 253

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 63/159 (39%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  +
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSTWG-I 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E++G 
Sbjct: 143 RHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLERLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G YV+ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMP 241


>gi|229095798|ref|ZP_04226777.1| O-antigen biosynthesis protein [Bacillus cereus Rock3-29]
 gi|229114749|ref|ZP_04244163.1| O-antigen biosynthesis protein [Bacillus cereus Rock1-3]
 gi|228668814|gb|EEL24242.1| O-antigen biosynthesis protein [Bacillus cereus Rock1-3]
 gi|228687631|gb|EEL41530.1| O-antigen biosynthesis protein [Bacillus cereus Rock3-29]
          Length = 232

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 83/221 (37%), Gaps = 26/221 (11%)

Query: 13  SSFLGKCTTDAISKVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           S F        + K +   W +V   GC    LG AI        +V    AF  A + A
Sbjct: 16  SDFYYNAANPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFSEAAEKA 72

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
               D        +   ++P  +   DCV+    LE   DP+ ++ ++   +   G ++ 
Sbjct: 73  KEKLDHVVLGD--IETMDMPYEEGQFDCVIFGDVLEHLFDPWAVVEKVKPYIKQNGVILA 130

Query: 131 VVPNK----------RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFF 178
            +PN            G W   E+          +++ +M+ L  +A +++S   R    
Sbjct: 131 SIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRLFLKAGYSISKVDRVYVD 190

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAG-----IYVIEARK 214
              ++  I +L+ + +K     G GF        Y+IEA K
Sbjct: 191 HKIYEPLIEELYGICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|298486276|ref|ZP_07004339.1| SAM-dependent methyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159283|gb|EFI00341.1| SAM-dependent methyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 253

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 63/159 (39%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  M
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWG-M 142

Query: 143 EHTPFGSG----QPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H     G    +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDGLRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMP 241


>gi|292490521|ref|YP_003525960.1| methyltransferase type 11 [Nitrosococcus halophilus Nc4]
 gi|291579116|gb|ADE13573.1| Methyltransferase type 11 [Nitrosococcus halophilus Nc4]
          Length = 241

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 19/110 (17%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLM---LHEIWRVLTSGGRMIVVVPNKRGMW 139
           LVS+  LP  D S D  +  H LE   DP      L EI RVL   G + + VPN+   W
Sbjct: 82  LVSDTALPFDDDSFDICVSNHVLEHVGDPKAQAAHLREIQRVLRPAGWLYLAVPNR---W 138

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREA--NFTLSITSRSLFF---PPTHKK 184
           A +E        P+    ++S L  +  +  + IT R   +   PPTH +
Sbjct: 139 ALIE--------PHFKLPLLSWLPPSLRDTYVRITGRGQRYDCHPPTHAE 180


>gi|94264007|ref|ZP_01287808.1| UbiE/COQ5 methyltransferase:Radical SAM [delta proteobacterium
           MLMS-1]
 gi|93455600|gb|EAT05785.1| UbiE/COQ5 methyltransferase:Radical SAM [delta proteobacterium
           MLMS-1]
          Length = 1081

 Score = 40.4 bits (93), Expect = 0.23,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           +PL D + D V+    +  + D   + HEIWR+L  GGR++V
Sbjct: 646 IPLPDDAADVVISNCVINLSPDKRRVFHEIWRILKPGGRLVV 687


>gi|94270164|ref|ZP_01291666.1| UbiE/COQ5 methyltransferase:Radical SAM [delta proteobacterium
           MLMS-1]
 gi|93450918|gb|EAT01921.1| UbiE/COQ5 methyltransferase:Radical SAM [delta proteobacterium
           MLMS-1]
          Length = 1079

 Score = 40.4 bits (93), Expect = 0.23,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           +PL D + D V+    +  + D   + HEIWR+L  GGR++V
Sbjct: 644 IPLPDDAADVVISNCVINLSPDKRRVFHEIWRILKPGGRLVV 685


>gi|119717223|ref|YP_924188.1| methyltransferase type 11 [Nocardioides sp. JS614]
 gi|119537884|gb|ABL82501.1| Methyltransferase type 11 [Nocardioides sp. JS614]
          Length = 246

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 58/146 (39%), Gaps = 1/146 (0%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           RV+  + R+FY++ L + +   IS  L+     + G  LL +G    +F         T 
Sbjct: 18  RVEQSDPRRFYTA-LAQDSVGQISAYLAPDGRGLAGATLLDVGGGPGYFRDAFRAAGATY 76

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
             + A  G         + T +    NLP  D SVD     + LE    P+ +  E+ RV
Sbjct: 77  WALDADVGELAGLGGIAAGTVVGDGMNLPFRDGSVDVCYSSNVLEHVSRPWDLADEMLRV 136

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPF 147
              GG   +      G W   E +P+
Sbjct: 137 TRPGGIAFISYTLWWGPWGGHETSPW 162


>gi|257483798|ref|ZP_05637839.1| hypothetical protein PsyrptA_11114 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289627517|ref|ZP_06460471.1| hypothetical protein PsyrpaN_20686 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649932|ref|ZP_06481275.1| hypothetical protein Psyrpa2_19609 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868361|gb|EGH03070.1| hypothetical protein PSYAE_14164 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330889982|gb|EGH22643.1| hypothetical protein PSYMO_14541 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330985654|gb|EGH83757.1| hypothetical protein PLA107_11588 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012692|gb|EGH92748.1| hypothetical protein PSYTB_24077 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 253

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 62/159 (38%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  M
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWG-M 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMP 241


>gi|171679016|ref|XP_001904456.1| hypothetical protein [Podospora anserina S mat+]
 gi|170937579|emb|CAP62236.1| unnamed protein product [Podospora anserina S mat+]
          Length = 339

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           +LP  DS  D V+  H L   + P   L E  RVL +GGR++V +
Sbjct: 185 SLPFPDSEFDTVVANHMLYHVDSPIAALREFKRVLKNGGRLVVAL 229


>gi|300023316|ref|YP_003755927.1| ArsR family transcriptional regulator [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525137|gb|ADJ23606.1| transcriptional regulator, ArsR family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 342

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 42  GLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST----ALVSEGN---LPLADS 94
           G G A+  FS    + ER L  +   Q    +     ++     A V  G+   L +AD 
Sbjct: 165 GTGRALELFS---DRFERGLG-IDVNQAMLAYARAKLNTDGCTRAQVRHGDIYALSIADR 220

Query: 95  SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
             D ++M   L F  DP L + E  RVL  GG++++V
Sbjct: 221 QADAIVMHQILHFLSDPSLAIREAARVLAPGGKLLIV 257


>gi|189499722|ref|YP_001959192.1| Methyltransferase type 11 [Chlorobium phaeobacteroides BS1]
 gi|189495163|gb|ACE03711.1| Methyltransferase type 11 [Chlorobium phaeobacteroides BS1]
          Length = 267

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           NLP+AD+SVD V+    +  + D   +  EI+RVL  GG++ V
Sbjct: 134 NLPVADNSVDVVISNCVINLSADKQRVFQEIYRVLKPGGKIAV 176


>gi|332295844|ref|YP_004437767.1| Methyltransferase type 11 [Thermodesulfobium narugense DSM 14796]
 gi|332178947|gb|AEE14636.1| Methyltransferase type 11 [Thermodesulfobium narugense DSM 14796]
          Length = 401

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           L S   LP  D+S D ++    +E+  +PF +  EI R+L  GG  IV + N+
Sbjct: 280 LNSNSTLPYDDNSFDSIICTVSIEYLVNPFEIFSEILRILKPGGIFIVTISNR 332


>gi|298208986|ref|YP_003717165.1| Glycosyltransferase [Croceibacter atlanticus HTCC2559]
 gi|83848913|gb|EAP86782.1| Glycosyltransferase [Croceibacter atlanticus HTCC2559]
          Length = 255

 Score = 40.4 bits (93), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           NLP  D++ D +L  H LE   D    + E++RVL  GG  I+ VP +
Sbjct: 131 NLPFQDNAYDFILCNHVLEHIPDHHKAISELYRVLKPGGTAILQVPQE 178


>gi|170078393|ref|YP_001735031.1| hypothetical protein SYNPCC7002_A1787 [Synechococcus sp. PCC 7002]
 gi|169886062|gb|ACA99775.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
          Length = 212

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 64  MPAGQGATNWP-DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           M A + A N   D+YF    L  +  LPLAD S + VL+   +++ + P  +  EI RVL
Sbjct: 75  MNAAELAKNRRLDRYFVQN-LNVDPKLPLADQSFEAVLVAVSVQYLQYPEAVFAEIQRVL 133

Query: 123 TSGGRMIVVVPNK 135
           T GG  IV   N+
Sbjct: 134 TPGGICIVSFSNR 146


>gi|110835078|ref|YP_693937.1| biotin biosynthesis protein BioC [Alcanivorax borkumensis SK2]
 gi|110648189|emb|CAL17665.1| probable biotin biosynthesis protein BioC [Alcanivorax borkumensis
           SK2]
          Length = 292

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP------NKRGMWAR 141
           NLPL+ +S   V     L++  DP +++ EI RVL  GGR+++ VP        +  W R
Sbjct: 135 NLPLSTNSQGLVFSCFALQWC-DPQVVMAEINRVLAPGGRLLLAVPLAGSLAELQSSWQR 193

Query: 142 MEHTPFGSGQP 152
           + H P  +  P
Sbjct: 194 VNHRPHVNALP 204


>gi|253701537|ref|YP_003022726.1| ArsR family transcriptional regulator [Geobacter sp. M21]
 gi|251776387|gb|ACT18968.1| transcriptional regulator, ArsR family [Geobacter sp. M21]
          Length = 307

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWAR 141
           +LP+AD    CV+    L  A DP  +L EI RVL  GG +++  +      WAR
Sbjct: 202 HLPIADGGAGCVIANMVLHHAADPMTVLGEIQRVLQPGGALVLADLARHEREWAR 256


>gi|303247873|ref|ZP_07334141.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ]
 gi|302490774|gb|EFL50675.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ]
          Length = 292

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            L   D+S D V+     E   DP+    E+WRVL  GGR +  VP   G
Sbjct: 128 RLSFPDASFDLVVTQDIFEHVTDPWRAFDEVWRVLAPGGRHVFTVPIHEG 177


>gi|163755696|ref|ZP_02162814.1| SAM-dependent methyltransferase [Kordia algicida OT-1]
 gi|161324217|gb|EDP95548.1| SAM-dependent methyltransferase [Kordia algicida OT-1]
          Length = 254

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 11/93 (11%)

Query: 53  FHGKVERTLAFMPAGQGATNWPDQY---FSSTALVSE--------GNLPLADSSVDCVLM 101
           F  K ++ L F P       + +Q    +++T L S          +LP  D S D +L 
Sbjct: 85  FFTKPQKVLHFAPEQAFYKRFRNQKNLEYTTTDLFSPLADVKADICDLPFEDDSFDTILC 144

Query: 102 VHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            H LE   D    + E++RVL  GG  I+ +P 
Sbjct: 145 NHVLEHIPDDTKAMQELYRVLKPGGMAILQIPQ 177


>gi|322436431|ref|YP_004218643.1| Methyltransferase type 11 [Acidobacterium sp. MP5ACTX9]
 gi|321164158|gb|ADW69863.1| Methyltransferase type 11 [Acidobacterium sp. MP5ACTX9]
          Length = 200

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDP---FLMLHEIWRVL 122
           A Q A   P + F   A+ +   +P  D   D V+    L FA+D      M+ E+WRVL
Sbjct: 67  ASQLAPGLPPENFQVAAIET---MPFPDGFADVVICNSVLHFAQDDGHFVGMVKEMWRVL 123

Query: 123 TSGGRMIVVVPNKRGM-WARMEHTPFGSGQPYSWY 156
             GG + V V ++ GM + R+    +  G    W+
Sbjct: 124 RPGGLLFVRVGSRIGMSFPRVRGNVYEIGDGSEWF 158


>gi|254500942|ref|ZP_05113093.1| Methyltransferase domain family [Labrenzia alexandrii DFL-11]
 gi|222437013|gb|EEE43692.1| Methyltransferase domain family [Labrenzia alexandrii DFL-11]
          Length = 309

 Score = 40.0 bits (92), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           L DSS+D  L  H LE   +P  +L E++RVL  GG M+  VP+
Sbjct: 160 LPDSSMDSALSFHVLEHLPEPAPILQELFRVLKPGGVMVAEVPH 203


>gi|15805385|ref|NP_294079.1| BioC family methyltransferase [Deinococcus radiodurans R1]
 gi|6458036|gb|AAF09939.1|AE001896_4 methyltransferase, putative, BioC family [Deinococcus radiodurans
           R1]
          Length = 173

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 10/80 (12%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR---GMWARMEHT 145
           LP  D + D  L+V  L    DP   L E WRVL  GG++++         G W  +   
Sbjct: 43  LPFPDGTFDVALLVRVLAHLPDPARALAEAWRVLRPGGQLVLAAQGADHLAGTWRAL--- 99

Query: 146 PFGSGQPYSWYQMISLLREA 165
               G+P S     + LREA
Sbjct: 100 ----GRPTSANGPDNALREA 115


>gi|317508606|ref|ZP_07966265.1| methyltransferase domain-containing protein [Segniliparus rugosus
           ATCC BAA-974]
 gi|316253098|gb|EFV12509.1| methyltransferase domain-containing protein [Segniliparus rugosus
           ATCC BAA-974]
          Length = 262

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
            LP    S+D V+ +  +E   D    L E WRVL  GG ++V  PN+
Sbjct: 101 QLPFRSGSIDIVVNLQVIEHLWDQLGFLRECWRVLRGGGTLVVSTPNR 148


>gi|119718437|ref|YP_925402.1| methyltransferase type 11 [Nocardioides sp. JS614]
 gi|119539098|gb|ABL83715.1| Methyltransferase type 11 [Nocardioides sp. JS614]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPL D S++ ++ +  + + ED  L   E  RVL  GG++++ +PN    +   + +PF 
Sbjct: 93  LPLQDQSIEVLVALEMIYYIEDQPLFFREAARVLRLGGKLLLTMPNPTRRY--FQRSPFC 150

Query: 149 SGQPYSWYQMISLLREANFTLSI 171
           +  P ++ ++  LL  A    +I
Sbjct: 151 TNYP-TFDELTILLASAGLAPTI 172


>gi|330939728|gb|EGH43017.1| hypothetical protein PSYPI_11704 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 253

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 61/152 (40%), Gaps = 5/152 (3%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT---- 145
           PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  + H     
Sbjct: 91  PLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSTWG-IRHVFARD 149

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
                +  S  ++   L    F L       + PP          +  E++G        
Sbjct: 150 ALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLERLGEGRQSPGG 209

Query: 206 GIYVIEARKILYQGLPITESKKKHISSPILVP 237
           G YV+ ARK++    P+ + ++  I   I +P
Sbjct: 210 GFYVLVARKLVVGLRPLRQVRRDPIGKLIPMP 241


>gi|197117733|ref|YP_002138160.1| bifunctional helix-turn-helix metal-dependent transcriptional
           regulator/SAM-dependent methyltransferase [Geobacter
           bemidjiensis Bem]
 gi|197087093|gb|ACH38364.1| helix-turn-helix metal-dependent transcriptional regulator, ArsR
           subfamily, and SAM-dependent methyltransferase, type 11
           [Geobacter bemidjiensis Bem]
          Length = 305

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWAR 141
           +LP+AD    CV+    L  A DP  +L EI RVL  GG +++  +      WAR
Sbjct: 202 HLPIADGGAGCVIANMVLHHAADPMTVLGEIQRVLQPGGALVMADLARHEREWAR 256


>gi|297195809|ref|ZP_06913207.1| methyltransferase type 11 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197720747|gb|EDY64655.1| methyltransferase type 11 [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 239

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            LPLAD   D VL    +E   DP   L E+ R+L  GG +++  PN
Sbjct: 97  GLPLADGCADAVLFSEVIEHLVDPDHALDELRRILRPGGHLMLSTPN 143


>gi|153870461|ref|ZP_01999859.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152073072|gb|EDN70140.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 341

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           S   VS+   P  D   D ++  H +E   DP + L+E  R+L  GG++I + PN R +
Sbjct: 182 SLGDVSDKQYP--DDYFDAIISSHVIEHIPDPKVWLNECVRILKPGGKLICMTPNNRSL 238


>gi|88809630|ref|ZP_01125137.1| hypothetical protein WH7805_00460 [Synechococcus sp. WH 7805]
 gi|88786380|gb|EAR17540.1| hypothetical protein WH7805_00460 [Synechococcus sp. WH 7805]
          Length = 222

 Score = 40.0 bits (92), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +LPL DSSVDC L+V   ++ + P  +  E+ R+    G++IV   N+
Sbjct: 103 SLPLDDSSVDCTLIVAGWQYLQQPEAIAEELLRITRPNGQVIVAFSNR 150


>gi|254393986|ref|ZP_05009078.1| methyltransferase type 11 [Streptomyces clavuligerus ATCC 27064]
 gi|294816170|ref|ZP_06774813.1| SAM-dependent methyltransferase [Streptomyces clavuligerus ATCC
           27064]
 gi|326444504|ref|ZP_08219238.1| hypothetical protein SclaA2_25721 [Streptomyces clavuligerus ATCC
           27064]
 gi|197707565|gb|EDY53377.1| methyltransferase type 11 [Streptomyces clavuligerus ATCC 27064]
 gi|294328769|gb|EFG10412.1| SAM-dependent methyltransferase [Streptomyces clavuligerus ATCC
           27064]
          Length = 266

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 82  ALVSEGNL-PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           A+V++G L PLAD S D  L  + LE  +DP   L E+ RV   GG + V   N    W 
Sbjct: 115 AVVADGYLLPLADGSADVCLSSNVLEHVDDPQTFLSEMIRVTRPGGLIYVSFTNWLSPWG 174

Query: 141 RMEHTPF 147
             E  P+
Sbjct: 175 GHEWAPW 181


>gi|170767902|ref|ZP_02902355.1| putative methyltransferase [Escherichia albertii TW07627]
 gi|170123390|gb|EDS92321.1| putative methyltransferase [Escherichia albertii TW07627]
          Length = 240

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ + 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLST 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|163757154|ref|ZP_02164256.1| hypothetical protein KAOT1_00775 [Kordia algicida OT-1]
 gi|161322882|gb|EDP94229.1| hypothetical protein KAOT1_00775 [Kordia algicida OT-1]
          Length = 245

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
           N+   D+S D ++  H LE   D    + E++RV+ SGG +++  P K G
Sbjct: 126 NIDQKDASFDTIICFHVLEHIPDDSKAMQELYRVIKSGGNVLIQTPFKTG 175


>gi|296448565|ref|ZP_06890439.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b]
 gi|296253931|gb|EFH01084.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b]
          Length = 219

 Score = 40.0 bits (92), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 91  LADSSVDCVLMVHYLEF---AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            ADS +D     ++LE      D  ++L +++RVLT GG++I++ PN +  +A  E+  F
Sbjct: 91  FADSCIDVAFSSNFLEHLPAKSDIVVLLRDVYRVLTPGGKLILLGPNIK--YAFREYWDF 148

Query: 148 GSGQ-PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI------LKLWSVFEKIGNIF 200
                P S   +   L+ A F + IT    F P T    I      ++L+  F  + ++F
Sbjct: 149 FDHHIPLSDASIGEALQLAGFKVEITV-PRFLPFTMNNTIPVHDILIRLYLSFPFVWSLF 207

Query: 201 GPGF 204
           G  F
Sbjct: 208 GKQF 211


>gi|294503096|ref|YP_003567158.1| hypothetical protein YPZ3_0986 [Yersinia pestis Z176003]
 gi|294353555|gb|ADE63896.1| hypothetical protein YPZ3_0986 [Yersinia pestis Z176003]
          Length = 230

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           L S   LP A+ SVD  L+ H L +A +P  +L E+ RVL   G +++
Sbjct: 69  LASPYQLPFAEKSVDACLLSHTLAYAANPHRILREVDRVLIDDGWLVI 116


>gi|283783997|ref|YP_003363862.1| hypothetical protein ROD_02181 [Citrobacter rodentium ICC168]
 gi|282947451|emb|CBG86998.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 244

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 64/152 (42%), Gaps = 6/152 (3%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP A  SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P  
Sbjct: 84  LPFAPKSVDVCLLAHALPWCTDPHRLLREADRVLIDDGWLVLSGFNPVSLMGLRKLVPVL 143

Query: 149 SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIY 208
              P    +M +L+R+ ++   +    L +   H   +L       K+ +   P    + 
Sbjct: 144 RKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWKKNGGKMLSAHLPALGCMQ 200

Query: 209 VIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +I ARK   + +P+T +  K   +   +P  V
Sbjct: 201 LIVARK---RTIPLTLNPMKQSKAKARIPQAV 229


>gi|50840994|gb|AAT83661.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Propionibacterium acnes KPA171202]
          Length = 340

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 196 LPYADNSFDAVTISYGLRNVEDPHQALREMLRVAKPGGRVVI 237


>gi|310825100|ref|YP_003957458.1| hypothetical protein STAUR_7876 [Stigmatella aurantiaca DW4/3-1]
 gi|309398172|gb|ADO75631.1| uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 330

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 17/92 (18%)

Query: 51  SCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLP------LADSSVDCVLMVHY 104
           +CF+G V         GQ   +    YF    +  +G L       + D S+D V+  H 
Sbjct: 142 TCFYGDVR-------DGQQLQD----YFQRQEVTFDGRLDAQTFEGVPDGSLDFVISAHV 190

Query: 105 LEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           +E  EDP   +    RVL  GG  ++ VP+ R
Sbjct: 191 IEHLEDPINAVRNTLRVLRPGGVFLLAVPDMR 222


>gi|212546791|ref|XP_002153549.1| arsenic methyltransferase Cyt19, putative [Penicillium marneffei
           ATCC 18224]
 gi|210065069|gb|EEA19164.1| arsenic methyltransferase Cyt19, putative [Penicillium marneffei
           ATCC 18224]
          Length = 298

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 88  NLPLADSSVDCVL--MVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           ++PL DSSVDC++   V  L   +D  L+ HEI R+L  GGR+ V
Sbjct: 128 SIPLPDSSVDCIISNCVINLVPTKDKSLVFHEIARLLKPGGRLAV 172


>gi|15607470|ref|NP_214843.1| hypothetical protein Rv0329c [Mycobacterium tuberculosis H37Rv]
 gi|15839716|ref|NP_334753.1| hypothetical protein MT0344 [Mycobacterium tuberculosis CDC1551]
 gi|148660095|ref|YP_001281618.1| hypothetical protein MRA_0338 [Mycobacterium tuberculosis H37Ra]
 gi|148821525|ref|YP_001286279.1| hypothetical protein TBFG_10334 [Mycobacterium tuberculosis F11]
 gi|167967767|ref|ZP_02550044.1| hypothetical protein MtubH3_06913 [Mycobacterium tuberculosis
           H37Ra]
 gi|215406333|ref|ZP_03418514.1| hypothetical protein Mtub0_22121 [Mycobacterium tuberculosis
           02_1987]
 gi|215409839|ref|ZP_03418647.1| hypothetical protein Mtub9_00610 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215425546|ref|ZP_03423465.1| hypothetical protein MtubT9_03826 [Mycobacterium tuberculosis T92]
 gi|215429152|ref|ZP_03427071.1| hypothetical protein MtubE_00280 [Mycobacterium tuberculosis
           EAS054]
 gi|215444413|ref|ZP_03431165.1| hypothetical protein MtubT_00265 [Mycobacterium tuberculosis T85]
 gi|218751959|ref|ZP_03530755.1| hypothetical protein MtubG1_00275 [Mycobacterium tuberculosis GM
           1503]
 gi|219556138|ref|ZP_03535214.1| hypothetical protein MtubT1_02100 [Mycobacterium tuberculosis T17]
 gi|253797255|ref|YP_003030256.1| hypothetical protein TBMG_00333 [Mycobacterium tuberculosis KZN
           1435]
 gi|254230695|ref|ZP_04924022.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254363297|ref|ZP_04979343.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549272|ref|ZP_05139719.1| hypothetical protein Mtube_02221 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260185200|ref|ZP_05762674.1| hypothetical protein MtubCP_04020 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260199329|ref|ZP_05766820.1| hypothetical protein MtubT4_04125 [Mycobacterium tuberculosis T46]
 gi|289441709|ref|ZP_06431453.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289445868|ref|ZP_06435612.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289552581|ref|ZP_06441791.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289568240|ref|ZP_06448467.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289748098|ref|ZP_06507476.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289748812|ref|ZP_06508190.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289752359|ref|ZP_06511737.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289756393|ref|ZP_06515771.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289760438|ref|ZP_06519816.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|297632814|ref|ZP_06950594.1| hypothetical protein MtubK4_01756 [Mycobacterium tuberculosis KZN
           4207]
 gi|297729789|ref|ZP_06958907.1| hypothetical protein MtubKR_01786 [Mycobacterium tuberculosis KZN
           R506]
 gi|298523806|ref|ZP_07011215.1| MitM-related protein [Mycobacterium tuberculosis 94_M4241A]
 gi|306774422|ref|ZP_07412759.1| hypothetical protein TMAG_03697 [Mycobacterium tuberculosis
           SUMu001]
 gi|306779168|ref|ZP_07417505.1| hypothetical protein TMBG_03558 [Mycobacterium tuberculosis
           SUMu002]
 gi|306782955|ref|ZP_07421277.1| hypothetical protein TMCG_03012 [Mycobacterium tuberculosis
           SUMu003]
 gi|306787323|ref|ZP_07425645.1| hypothetical protein TMDG_02523 [Mycobacterium tuberculosis
           SUMu004]
 gi|306791876|ref|ZP_07430178.1| hypothetical protein TMEG_02901 [Mycobacterium tuberculosis
           SUMu005]
 gi|306796062|ref|ZP_07434364.1| hypothetical protein TMFG_01618 [Mycobacterium tuberculosis
           SUMu006]
 gi|306801922|ref|ZP_07438590.1| hypothetical protein TMHG_03340 [Mycobacterium tuberculosis
           SUMu008]
 gi|306806133|ref|ZP_07442801.1| hypothetical protein TMGG_03334 [Mycobacterium tuberculosis
           SUMu007]
 gi|306966331|ref|ZP_07478992.1| hypothetical protein TMIG_01218 [Mycobacterium tuberculosis
           SUMu009]
 gi|306970526|ref|ZP_07483187.1| hypothetical protein TMJG_02064 [Mycobacterium tuberculosis
           SUMu010]
 gi|307078254|ref|ZP_07487424.1| hypothetical protein TMKG_02655 [Mycobacterium tuberculosis
           SUMu011]
 gi|313657118|ref|ZP_07813998.1| hypothetical protein MtubKV_01786 [Mycobacterium tuberculosis KZN
           V2475]
 gi|2193950|emb|CAB09577.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13879840|gb|AAK44567.1| MitM-related protein [Mycobacterium tuberculosis CDC1551]
 gi|124599754|gb|EAY58764.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134148811|gb|EBA40856.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504247|gb|ABQ72056.1| conserved hypothetical protein [Mycobacterium tuberculosis H37Ra]
 gi|148720052|gb|ABR04677.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|253318758|gb|ACT23361.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289414628|gb|EFD11868.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289418826|gb|EFD16027.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289437213|gb|EFD19706.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289541993|gb|EFD45642.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289688626|gb|EFD56114.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289689399|gb|EFD56828.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289692946|gb|EFD60375.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gi|289707944|gb|EFD71960.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289711957|gb|EFD75969.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298493600|gb|EFI28894.1| MitM-related protein [Mycobacterium tuberculosis 94_M4241A]
 gi|308217016|gb|EFO76415.1| hypothetical protein TMAG_03697 [Mycobacterium tuberculosis
           SUMu001]
 gi|308327878|gb|EFP16729.1| hypothetical protein TMBG_03558 [Mycobacterium tuberculosis
           SUMu002]
 gi|308332235|gb|EFP21086.1| hypothetical protein TMCG_03012 [Mycobacterium tuberculosis
           SUMu003]
 gi|308335999|gb|EFP24850.1| hypothetical protein TMDG_02523 [Mycobacterium tuberculosis
           SUMu004]
 gi|308339619|gb|EFP28470.1| hypothetical protein TMEG_02901 [Mycobacterium tuberculosis
           SUMu005]
 gi|308343528|gb|EFP32379.1| hypothetical protein TMFG_01618 [Mycobacterium tuberculosis
           SUMu006]
 gi|308347391|gb|EFP36242.1| hypothetical protein TMGG_03334 [Mycobacterium tuberculosis
           SUMu007]
 gi|308351318|gb|EFP40169.1| hypothetical protein TMHG_03340 [Mycobacterium tuberculosis
           SUMu008]
 gi|308355966|gb|EFP44817.1| hypothetical protein TMIG_01218 [Mycobacterium tuberculosis
           SUMu009]
 gi|308359923|gb|EFP48774.1| hypothetical protein TMJG_02064 [Mycobacterium tuberculosis
           SUMu010]
 gi|308363822|gb|EFP52673.1| hypothetical protein TMKG_02655 [Mycobacterium tuberculosis
           SUMu011]
 gi|323721278|gb|EGB30335.1| hypothetical protein TMMG_04005 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326906082|gb|EGE53015.1| hypothetical protein TBPG_04061 [Mycobacterium tuberculosis W-148]
 gi|328457042|gb|AEB02465.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 208

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARME 143
            LP+AD S+D VL VH   F  DP   L +I R L  GGR+++  + + + + AR +
Sbjct: 109 TLPVADHSLDKVLGVHNFYFWPDPRASLCDIARALRPGGRLVLTSISDDQPLAARFD 165


>gi|261363683|ref|ZP_05976566.1| methyl-transferase [Neisseria mucosa ATCC 25996]
 gi|288568234|gb|EFC89794.1| methyl-transferase [Neisseria mucosa ATCC 25996]
          Length = 222

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 64/153 (41%), Gaps = 13/153 (8%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW--- 139
           L++   +     S+D +LM H  E A     +LHE  RVL   GR+++   N + +W   
Sbjct: 59  LMTADAMAWESHSIDVLLMPHSHETAALT-QVLHEASRVLKPEGRLVLTGFNPKSLWFFS 117

Query: 140 -----ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
                 R+         P    +++ L    +F +      ++ P  + K  L+ W   E
Sbjct: 118 KWFDGTRLPKKEHCLTLPALKQRLVDL----DFEVEFGKFMVYLPAVNSKKGLRFWRFME 173

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
           K G+ + P  A +Y +   K +    P+ E +K
Sbjct: 174 KAGDRWWPQCAAVYGLVLIKRMAGVTPLPEFEK 206


>gi|150400930|ref|YP_001324696.1| methyltransferase type 11 [Methanococcus aeolicus Nankai-3]
 gi|150013633|gb|ABR56084.1| Methyltransferase type 11 [Methanococcus aeolicus Nankai-3]
          Length = 235

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            NLP  D+S D +L ++ LE  +D    L EI RVL      I+VV NK  
Sbjct: 101 SNLPFKDNSFDLILCINVLEHIKDYKKALMEIKRVLKPNAMAIIVVVNKES 151


>gi|23502320|ref|NP_698447.1| ArsR family transcriptional regulator [Brucella suis 1330]
 gi|23348298|gb|AAN30362.1| transcriptional regulator, ArsR family [Brucella suis 1330]
          Length = 341

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLQLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|256810217|ref|YP_003127586.1| Methyltransferase type 11 [Methanocaldococcus fervens AG86]
 gi|256793417|gb|ACV24086.1| Methyltransferase type 11 [Methanocaldococcus fervens AG86]
          Length = 228

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 52/114 (45%), Gaps = 11/114 (9%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP  D   D V+ ++ LE   +    L+EI RVL + G++IVVV NK  +   ++   F 
Sbjct: 99  LPFKDEVFDLVVCINVLEHV-NHLNALNEIKRVLKNNGKLIVVVVNKDSL---IKEEIFN 154

Query: 149 SGQPYSWYQMISLLREANFTLSITSR-----SLF--FPPTHKKCILKLWSVFEK 195
             + Y         +   F ++  S      S+F  FPP     ILK W + +K
Sbjct: 155 DFEIYHRPLSAEDFKVNGFKINYISSVYYLPSIFKIFPPIILSKILKHWKIVDK 208


>gi|115373584|ref|ZP_01460880.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115369426|gb|EAU68365.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 307

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 17/92 (18%)

Query: 51  SCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLP------LADSSVDCVLMVHY 104
           +CF+G V         GQ   +    YF    +  +G L       + D S+D V+  H 
Sbjct: 119 TCFYGDVR-------DGQQLQD----YFQRQEVTFDGRLDAQTFEGVPDGSLDFVISAHV 167

Query: 105 LEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           +E  EDP   +    RVL  GG  ++ VP+ R
Sbjct: 168 IEHLEDPINAVRNTLRVLRPGGVFLLAVPDMR 199


>gi|332187597|ref|ZP_08389333.1| bacterial regulatory , arsR family protein [Sphingomonas sp. S17]
 gi|332012345|gb|EGI54414.1| bacterial regulatory , arsR family protein [Sphingomonas sp. S17]
          Length = 320

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNKR 136
           LP+ D + D  ++ H L FA+ P   + E  RVL  GGR+++    P+ R
Sbjct: 207 LPMGDGAADIAILHHVLHFAQQPGAAIAEAARVLGPGGRLLIADFAPHDR 256


>gi|228920036|ref|ZP_04083385.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228839492|gb|EEM84784.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 232

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEKAKEILDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DC+L    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IEKIDLPYEEGQFDCILFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|225627898|ref|ZP_03785934.1| ArsR family transcriptional regulator [Brucella ceti str. Cudo]
 gi|237815849|ref|ZP_04594846.1| ArsR family transcriptional regulator [Brucella abortus str. 2308
           A]
 gi|225617061|gb|EEH14107.1| ArsR family transcriptional regulator [Brucella ceti str. Cudo]
 gi|237789147|gb|EEP63358.1| ArsR family transcriptional regulator [Brucella abortus str. 2308
           A]
          Length = 347

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 210 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 269

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 270 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 322


>gi|148239141|ref|YP_001224528.1| SAM-dependent methyltransferase [Synechococcus sp. WH 7803]
 gi|147847680|emb|CAK23231.1| Possible SAM-dependent methyltransferase [Synechococcus sp. WH
           7803]
          Length = 222

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
            LPL DSSVDC L+V   ++ + P  +  E+ R+    G++IV   N+
Sbjct: 103 ELPLDDSSVDCTLIVAGWQYLQQPEAIAEELLRITRPNGQVIVAFSNR 150


>gi|168704153|ref|ZP_02736430.1| Methyltransferase type 12 [Gemmata obscuriglobus UQM 2246]
          Length = 329

 Score = 40.0 bits (92), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 87  GNLP---LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           G+LP   LA  S D V M H LE    P  +L E +++L  GG+++V  PN
Sbjct: 176 GSLPHPDLAPGSFDVVTMWHSLEHIHRPLELLREAFKLLIPGGKLVVATPN 226


>gi|301061508|ref|ZP_07202270.1| methyltransferase domain protein [delta proteobacterium NaphS2]
 gi|300444316|gb|EFK08319.1| methyltransferase domain protein [delta proteobacterium NaphS2]
          Length = 272

 Score = 40.0 bits (92), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 19/100 (19%)

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQP 152
           D+  D V + H LE    P   L EI R+L   GR+I+ VPN+                 
Sbjct: 130 DAYFDAVHLSHILEHVPKPIEFLMEIHRILKPKGRVIIEVPNE---------------SK 174

Query: 153 YSW-YQMISLLREAN---FTLSITSRSLFFPPTHKKCILK 188
           + W Y++I+LL+ ++     ++    SLF P T  + +LK
Sbjct: 175 FPWNYKIINLLQPSHAPRVKMTEKHLSLFTPRTLAQMLLK 214


>gi|282162911|ref|YP_003355296.1| hypothetical protein MCP_0241 [Methanocella paludicola SANAE]
 gi|282155225|dbj|BAI60313.1| conserved hypothetical protein [Methanocella paludicola SANAE]
          Length = 184

 Score = 40.0 bits (92), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 86  EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +G +PL   S+DCV ++  LE  + P  +L E +R++ + G++++  P+
Sbjct: 72  DGKVPLETGSMDCVTLIAVLEHLDRPEDVLGECYRIVKNRGKILITTPS 120


>gi|256061506|ref|ZP_05451650.1| transcriptional regulator, ArsR family protein [Brucella neotomae
           5K33]
 gi|261325514|ref|ZP_05964711.1| methyltransferase [Brucella neotomae 5K33]
 gi|261301494|gb|EEY04991.1| methyltransferase [Brucella neotomae 5K33]
          Length = 341

 Score = 40.0 bits (92), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|302036925|ref|YP_003797247.1| hypothetical protein NIDE1587 [Candidatus Nitrospira defluvii]
 gi|300604989|emb|CBK41322.1| protein of unknown function, putative Sensory histidine kinase with
            methyltransferase region [Candidatus Nitrospira defluvii]
          Length = 1396

 Score = 39.7 bits (91), Expect = 0.32,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 25/42 (59%)

Query: 89   LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            LP AD S D VL    L F+  P   L E++RVL  GG++IV
Sbjct: 1265 LPFADHSFDRVLANLSLSFSRSPLHALRELFRVLRPGGKLIV 1306


>gi|312197776|ref|YP_004017837.1| methyltransferase type 11 [Frankia sp. EuI1c]
 gi|311229112|gb|ADP81967.1| Methyltransferase type 11 [Frankia sp. EuI1c]
          Length = 351

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 56/138 (40%), Gaps = 6/138 (4%)

Query: 36  TGCRLLGLGYAIPFFSCFHGKVERTLAF--MPAGQGATNWPDQYFSSTALVSEGN-LPLA 92
            GC   G G A+P      G   R LA    P    AT    +  +++ ++++   LPLA
Sbjct: 196 AGC---GTGRALPALREAVGPAGRVLALDVTPEMLAATRQAGRGDAASLVLADARRLPLA 252

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQP 152
           D S+D V     +    D    + E+ RV   G R+ +  P+ R   A          +P
Sbjct: 253 DQSLDAVFAAGLVHHLPDMAAGVAELARVSRPGARLAIFHPSGRAALAARHGRTLRPDEP 312

Query: 153 YSWYQMISLLREANFTLS 170
            S  ++  LL  A + L 
Sbjct: 313 LSAARLGPLLAAAGWRLD 330


>gi|284176162|ref|YP_003406439.1| Methyltransferase type 11 [Haloterrigena turkmenica DSM 5511]
 gi|284017819|gb|ADB63766.1| Methyltransferase type 11 [Haloterrigena turkmenica DSM 5511]
          Length = 275

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
           +LP +D + D VL    L+F  +P     E+ RVL+ GGR+ V V      W  +E+ P
Sbjct: 106 DLPFSDGTFDVVLCQQALQFVTEPPTAFQEMHRVLSPGGRIAVSV------WRPLEYNP 158


>gi|325685367|gb|EGD27474.1| transcriptional regulator [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 390

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            +LP AD   D V+  H L + +D   +L+E+ RVL  GGR      +KR M
Sbjct: 234 AHLPFADEEFDLVVANHMLFYCDDIPQVLNEVRRVLKKGGRFCASTYSKRHM 285


>gi|325261289|ref|ZP_08128027.1| putative transcriptional regulatory protein [Clostridium sp. D5]
 gi|324032743|gb|EGB94020.1| putative transcriptional regulatory protein [Clostridium sp. D5]
          Length = 398

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           NLP  D+S+D V+  H L + ED   +  E+ RVL  GGR +    + R M
Sbjct: 238 NLPFEDNSLDLVIANHVLFYCEDIPKVCREVQRVLKPGGRFLCSAYSSRHM 288


>gi|306844348|ref|ZP_07476940.1| ArsR family transcriptional regulator [Brucella sp. BO1]
 gi|306275420|gb|EFM57161.1| ArsR family transcriptional regulator [Brucella sp. BO1]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|329934831|ref|ZP_08284872.1| methyltransferase [Streptomyces griseoaurantiacus M045]
 gi|329305653|gb|EGG49509.1| methyltransferase [Streptomyces griseoaurantiacus M045]
          Length = 259

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  WA  +       G  + Y   ++++ +REA  
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYRAGELLARMREAGL 164


>gi|81300139|ref|YP_400347.1| hypothetical protein Synpcc7942_1330 [Synechococcus elongatus PCC
           7942]
 gi|81169020|gb|ABB57360.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 218

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           D++F    L  +  LP  DSS D VL+   +++ + P  +L E+ RVL  GG++I+   N
Sbjct: 93  DRWFVQN-LNQQSALPELDSSFDAVLIAVSVQYLQQPEQVLAEVRRVLRPGGQLIISFSN 151

Query: 135 K 135
           +
Sbjct: 152 R 152


>gi|52425000|ref|YP_088137.1| SmtA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307052|gb|AAU37552.1| SmtA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 237

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA---RMEHT 145
           LPL + S+D  L+ + L F  DP  +L EI RV T  G + + + N   + A   +   T
Sbjct: 94  LPLIEESIDACLLANNLNFCADPHRLLREITRVTTESGLLFISLFNPLSILAFKRQFHQT 153

Query: 146 PF 147
           P+
Sbjct: 154 PY 155


>gi|145346046|ref|XP_001417507.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577734|gb|ABO95800.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 133

 Score = 39.7 bits (91), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 7/96 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR-----GMWARME 143
           LP  D S D V+    L   EDP   L E+ RVL S GR +++  +K      G +  + 
Sbjct: 28  LPFDDGSFDVVVDTFSLCVIEDPSAALREVRRVLRSKGRAVLIEHSKSDVGALGAYQDLT 87

Query: 144 HTPFGS-GQPYSWYQMI-SLLREANFTLSITSRSLF 177
             P     +   W Q + SL+R++   +  T R+L 
Sbjct: 88  SAPVKRMSKGCVWNQDVESLVRQSGMRVVKTQRALL 123


>gi|265984489|ref|ZP_06097224.1| methyltransferase type 11 [Brucella sp. 83/13]
 gi|264663081|gb|EEZ33342.1| methyltransferase type 11 [Brucella sp. 83/13]
          Length = 338

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 201 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 260

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 261 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 313


>gi|159900783|ref|YP_001547030.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893822|gb|ABX06902.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 279

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +P AD+S D  +    +E  +DP  ML E+ RV+  GGR+++ + N+
Sbjct: 115 VPFADNSFDLAICWDIVEHVQDPAAMLAELRRVIRPGGRVLLTIINR 161


>gi|17986841|ref|NP_539475.1| ArsR family transcriptional regulator [Brucella melitensis bv. 1
           str. 16M]
 gi|17982476|gb|AAL51739.1| transcriptional regulator, arsr family [Brucella melitensis bv. 1
           str. 16M]
          Length = 338

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 201 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 260

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 261 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 313


>gi|15602551|ref|NP_245623.1| hypothetical protein PM0686 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720970|gb|AAK02770.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 238

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLG--YAIPFFSCF-HGKVERTLAFMPAGQGATNW 73
           G C  +A++   S  +  + G  +L LG   A     CF H  +       P+ Q     
Sbjct: 23  GSCYCNALTDYFSAWYPKILGHHVLKLGGLSAEIQSDCFLHHAILLAPHISPSLQSLG-- 80

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV- 132
             Q  +S    +   LP  + S+D  ++ + L F++DP  +L E+ RVL   G + + + 
Sbjct: 81  -LQKNTSVIQANLTELPFIEQSIDACMLSNTLNFSQDPHQILREVTRVLREDGYLFLSLF 139

Query: 133 -PNKRGMWARMEHTPFGSGQPYSWY 156
            P    ++ R  HT   S  P   Y
Sbjct: 140 NPFSPLLFKRHLHTVSHSPLPVRHY 164


>gi|62290344|ref|YP_222137.1| ArsR family transcriptional regulator [Brucella abortus bv. 1 str.
           9-941]
 gi|82700267|ref|YP_414841.1| hypothetical protein BAB1_1469 [Brucella melitensis biovar Abortus
           2308]
 gi|148559673|ref|YP_001259342.1| ArsR family transcriptional regulator [Brucella ovis ATCC 25840]
 gi|189024575|ref|YP_001935343.1| ArsR family transcriptional regulator [Brucella abortus S19]
 gi|254689643|ref|ZP_05152897.1| transcriptional regulator, ArsR family protein [Brucella abortus
           bv. 6 str. 870]
 gi|254694134|ref|ZP_05155962.1| transcriptional regulator, ArsR family protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697786|ref|ZP_05159614.1| transcriptional regulator, ArsR family protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254702170|ref|ZP_05163998.1| transcriptional regulator, ArsR family protein [Brucella suis bv. 5
           str. 513]
 gi|254708123|ref|ZP_05169951.1| transcriptional regulator, ArsR family protein [Brucella
           pinnipedialis M163/99/10]
 gi|254710491|ref|ZP_05172302.1| transcriptional regulator, ArsR family protein [Brucella
           pinnipedialis B2/94]
 gi|254730675|ref|ZP_05189253.1| transcriptional regulator, ArsR family protein [Brucella abortus
           bv. 4 str. 292]
 gi|256031985|ref|ZP_05445599.1| transcriptional regulator, ArsR family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256160182|ref|ZP_05457876.1| transcriptional regulator, ArsR family protein [Brucella ceti
           M490/95/1]
 gi|256255388|ref|ZP_05460924.1| transcriptional regulator, ArsR family protein [Brucella ceti
           B1/94]
 gi|256257894|ref|ZP_05463430.1| transcriptional regulator, ArsR family protein [Brucella abortus
           bv. 9 str. C68]
 gi|256369867|ref|YP_003107378.1| transcriptional regulator, ArsR family [Brucella microti CCM 4915]
 gi|260169121|ref|ZP_05755932.1| transcriptional regulator, ArsR family protein [Brucella sp. F5/99]
 gi|260546884|ref|ZP_05822623.1| transcriptional regulator [Brucella abortus NCTC 8038]
 gi|260755172|ref|ZP_05867520.1| methyltransferase type 11 [Brucella abortus bv. 6 str. 870]
 gi|260758391|ref|ZP_05870739.1| methyltransferase type 11 [Brucella abortus bv. 4 str. 292]
 gi|260762217|ref|ZP_05874560.1| methyltransferase type 11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884186|ref|ZP_05895800.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261214434|ref|ZP_05928715.1| methyltransferase type 11 [Brucella abortus bv. 3 str. Tulya]
 gi|261222593|ref|ZP_05936874.1| methyltransferase [Brucella ceti B1/94]
 gi|261315626|ref|ZP_05954823.1| methyltransferase type 11 [Brucella pinnipedialis M163/99/10]
 gi|261318062|ref|ZP_05957259.1| methyltransferase type 11 [Brucella pinnipedialis B2/94]
 gi|261752741|ref|ZP_05996450.1| methyltransferase type 11 [Brucella suis bv. 5 str. 513]
 gi|261758629|ref|ZP_06002338.1| transcriptional regulator [Brucella sp. F5/99]
 gi|265989095|ref|ZP_06101652.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265998558|ref|ZP_06111115.1| methyltransferase type 11 [Brucella ceti M490/95/1]
 gi|294852776|ref|ZP_06793449.1| ArsR family transcriptional regulator [Brucella sp. NVSL 07-0026]
 gi|297248730|ref|ZP_06932448.1| ArsR family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
 gi|62196476|gb|AAX74776.1| transcriptional regulator, ArsR family [Brucella abortus bv. 1 str.
           9-941]
 gi|82616368|emb|CAJ11425.1| SAM (and some other nucleotide) binding motif:Generic
           methyltransferase:Bacterial regulatory protein, ArsR
           family [Brucella melitensis biovar Abortus 2308]
 gi|148370930|gb|ABQ60909.1| transcriptional regulator, ArsR family [Brucella ovis ATCC 25840]
 gi|189020147|gb|ACD72869.1| transcriptional regulator, ArsR family [Brucella abortus S19]
 gi|256000030|gb|ACU48429.1| transcriptional regulator, ArsR family [Brucella microti CCM 4915]
 gi|260095934|gb|EEW79811.1| transcriptional regulator [Brucella abortus NCTC 8038]
 gi|260668709|gb|EEX55649.1| methyltransferase type 11 [Brucella abortus bv. 4 str. 292]
 gi|260672649|gb|EEX59470.1| methyltransferase type 11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675280|gb|EEX62101.1| methyltransferase type 11 [Brucella abortus bv. 6 str. 870]
 gi|260873714|gb|EEX80783.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916041|gb|EEX82902.1| methyltransferase type 11 [Brucella abortus bv. 3 str. Tulya]
 gi|260921177|gb|EEX87830.1| methyltransferase [Brucella ceti B1/94]
 gi|261297285|gb|EEY00782.1| methyltransferase type 11 [Brucella pinnipedialis B2/94]
 gi|261304652|gb|EEY08149.1| methyltransferase type 11 [Brucella pinnipedialis M163/99/10]
 gi|261738613|gb|EEY26609.1| transcriptional regulator [Brucella sp. F5/99]
 gi|261742494|gb|EEY30420.1| methyltransferase type 11 [Brucella suis bv. 5 str. 513]
 gi|262553182|gb|EEZ09016.1| methyltransferase type 11 [Brucella ceti M490/95/1]
 gi|264661292|gb|EEZ31553.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|294821365|gb|EFG38364.1| ArsR family transcriptional regulator [Brucella sp. NVSL 07-0026]
 gi|297175899|gb|EFH35246.1| ArsR family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|95928293|ref|ZP_01311041.1| Methyltransferase type 11 [Desulfuromonas acetoxidans DSM 684]
 gi|95135564|gb|EAT17215.1| Methyltransferase type 11 [Desulfuromonas acetoxidans DSM 684]
          Length = 1000

 Score = 39.7 bits (91), Expect = 0.34,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP+A  S+D +L    L  + D  L+ +EI+RVL  GGR++V
Sbjct: 577 LPVASDSIDLILSNCVLNLSADKRLLFNEIFRVLKPGGRLVV 618


>gi|332360961|gb|EGJ38765.1| methyltransferase domain protein [Streptococcus sanguinis SK1056]
          Length = 236

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 63/149 (42%), Gaps = 16/149 (10%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP-----AGQGAT 71
           GK   D +   L +    + G ++L  G      + F  K  +  A  P     A +   
Sbjct: 17  GKLQYDIVFAFLES----LRGQKILDFGSGFGIVADFLAKNNQVTAIEPNSEMIAERKQN 72

Query: 72  NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            + +Q   S  L+   NLP  D S D ++  + LE+  DP L L E  R+L   G++ +V
Sbjct: 73  FYYEQLQGSLNLLK--NLP--DQSFDVIICHNVLEYVSDPALYLAEFSRLLKKDGKISLV 128

Query: 132 VPNKRGMWARMEHTPFGSGQPYSWYQMIS 160
             ++ G   R+ HT      P    Q+++
Sbjct: 129 KHHEVG---RVMHTVVFENDPEKAQQLLA 154


>gi|291514935|emb|CBK64145.1| Methylase involved in ubiquinone/menaquinone biosynthesis
           [Alistipes shahii WAL 8301]
          Length = 261

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
            +PLAD SVD V+  H +E   D    + E+ RVL  GG  IV+ P  R
Sbjct: 138 QIPLADGSVDVVICNHIMEHVADDRRAMRELHRVLKPGGWGIVLSPVDR 186


>gi|254719480|ref|ZP_05181291.1| transcriptional regulator, ArsR family protein [Brucella sp. 83/13]
 gi|306839259|ref|ZP_07472076.1| ArsR family transcriptional regulator [Brucella sp. NF 2653]
 gi|306843194|ref|ZP_07475808.1| ArsR family transcriptional regulator [Brucella sp. BO2]
 gi|306286620|gb|EFM58191.1| ArsR family transcriptional regulator [Brucella sp. BO2]
 gi|306405806|gb|EFM62068.1| ArsR family transcriptional regulator [Brucella sp. NF 2653]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|291300849|ref|YP_003512127.1| methyltransferase type 11 [Stackebrandtia nassauensis DSM 44728]
 gi|290570069|gb|ADD43034.1| Methyltransferase type 11 [Stackebrandtia nassauensis DSM 44728]
          Length = 253

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 49/126 (38%), Gaps = 29/126 (23%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           +P AD+S D V       FA DP  M  E+ RV   GG + V+        A    +PFG
Sbjct: 90  MPFADASFDVVASAFGAMFAPDPSAMAAELRRVCAPGGTIAVL--------AWTPESPFG 141

Query: 149 SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG-PGFAGI 207
                       +LR        T  S + PP      ++ W   E++   FG P    +
Sbjct: 142 ------------MLR--------TLASAYLPPEAAGPAIEDWGTPERVAAFFGTPVDTEV 181

Query: 208 YVIEAR 213
            V++ R
Sbjct: 182 RVVDVR 187


>gi|308185774|ref|YP_003929905.1| hypothetical protein Pvag_0241 [Pantoea vagans C9-1]
 gi|308056284|gb|ADO08456.1| Uncharacterized protein yafS [Pantoea vagans C9-1]
          Length = 245

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 16/153 (10%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LP    S+D  L+ H L +++DP  +L E+ RVL   G MI+   N   +    +  P 
Sbjct: 83  QLPFESKSIDACLLAHTLAWSQDPHRVLREVDRVLIDDGWMIISGFNPFSLLGVSKMVPG 142

Query: 148 ------GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
                  SG+ +S  +++  L   N+ +   +R     P H++          K+ +   
Sbjct: 143 LTRKAPWSGRMFSQMRLLDWLGLLNYEVVYRTRFQVL-PWHRQG--------GKLISAHL 193

Query: 202 PGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
           P    + ++ ARK  +  LP T +KK   +S I
Sbjct: 194 PALGCLNIVVARKRTFPLLP-TRAKKSLSTSKI 225


>gi|295839249|ref|ZP_06826182.1| methyltransferase type 11 [Streptomyces sp. SPB74]
 gi|197695700|gb|EDY42633.1| methyltransferase type 11 [Streptomyces sp. SPB74]
          Length = 269

 Score = 39.7 bits (91), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +TA   EG+   LP  D+S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 68  ATATAMEGDALALPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 125


>gi|315292139|gb|EFU51491.1| methyltransferase domain protein [Escherichia coli MS 153-1]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 63/151 (41%), Gaps = 21/151 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP +D SVD  L+ H L +  DP  +L E  RVL   G +++   N        +  P 
Sbjct: 83  HLPFSDKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPISFMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLRE------ANFTLSITSRSLFFPPTHKKCILKLWSVF-EKIGNI 199
                PY+  +M +L+R+       NF +   SR    P          W+    K+ N 
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHASRFHVLP----------WNKHGGKLLNA 191

Query: 200 FGPGFAGIYVIEARK--ILYQGLPITESKKK 228
             P    + +I ARK  I     P+ +SK K
Sbjct: 192 HIPALGCLQLIVARKRTIPLTLNPMKQSKNK 222


>gi|163843705|ref|YP_001628109.1| methyltransferase type 11 [Brucella suis ATCC 23445]
 gi|254704707|ref|ZP_05166535.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
 gi|260566045|ref|ZP_05836515.1| transcriptional regulator [Brucella suis bv. 4 str. 40]
 gi|261755401|ref|ZP_05999110.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
 gi|163674428|gb|ABY38539.1| Methyltransferase type 11 [Brucella suis ATCC 23445]
 gi|260155563|gb|EEW90643.1| transcriptional regulator [Brucella suis bv. 4 str. 40]
 gi|261745154|gb|EEY33080.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|330506896|ref|YP_004383324.1| methyltransferase [Methanosaeta concilii GP-6]
 gi|328927704|gb|AEB67506.1| methyltransferase, putative [Methanosaeta concilii GP-6]
          Length = 216

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP  D S D VLMV  + F +DP L   E  R L  GG +I+ + ++     R       
Sbjct: 87  LPFRDESFDFVLMVTTVCFLDDPLLACQEAKRTLVPGGSLIIGMIDRDSPAGRDYDRKKT 146

Query: 149 SGQPY------SWYQMISLLREANFTLSITSRSLF 177
           + + Y      S  +++S L++ +F   +T +++F
Sbjct: 147 TSKFYKFARFRSADEVMSWLKDLDFYDILTRQTIF 181


>gi|225852932|ref|YP_002733165.1| methyltransferase type 11 [Brucella melitensis ATCC 23457]
 gi|256045080|ref|ZP_05447981.1| Methyltransferase type 11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114009|ref|ZP_05454786.1| Methyltransferase type 11 [Brucella melitensis bv. 3 str. Ether]
 gi|256263587|ref|ZP_05466119.1| transcriptional regulator [Brucella melitensis bv. 2 str. 63/9]
 gi|260565322|ref|ZP_05835806.1| transcriptional regulator [Brucella melitensis bv. 1 str. 16M]
 gi|265991508|ref|ZP_06104065.1| methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995346|ref|ZP_06107903.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|225641297|gb|ACO01211.1| Methyltransferase type 11 [Brucella melitensis ATCC 23457]
 gi|260151390|gb|EEW86484.1| transcriptional regulator [Brucella melitensis bv. 1 str. 16M]
 gi|262766459|gb|EEZ12248.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263002292|gb|EEZ14867.1| methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093637|gb|EEZ17642.1| transcriptional regulator [Brucella melitensis bv. 2 str. 63/9]
 gi|326409475|gb|ADZ66540.1| methyltransferase type 11 [Brucella melitensis M28]
 gi|326539182|gb|ADZ87397.1| methyltransferase type 11 [Brucella melitensis M5-90]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|161619397|ref|YP_001593284.1| methyltransferase type 11 [Brucella canis ATCC 23365]
 gi|161336208|gb|ABX62513.1| Methyltransferase type 11 [Brucella canis ATCC 23365]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|254714484|ref|ZP_05176295.1| transcriptional regulator, ArsR family protein [Brucella ceti
           M644/93/1]
 gi|254717382|ref|ZP_05179193.1| transcriptional regulator, ArsR family protein [Brucella ceti
           M13/05/1]
 gi|261219213|ref|ZP_05933494.1| methyltransferase type 11 [Brucella ceti M13/05/1]
 gi|261322274|ref|ZP_05961471.1| methyltransferase type 11 [Brucella ceti M644/93/1]
 gi|260924302|gb|EEX90870.1| methyltransferase type 11 [Brucella ceti M13/05/1]
 gi|261294964|gb|EEX98460.1| methyltransferase type 11 [Brucella ceti M644/93/1]
          Length = 341

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR++VV   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLVVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|229101896|ref|ZP_04232610.1| O-antigen biosynthesis protein [Bacillus cereus Rock3-28]
 gi|228681479|gb|EEL35642.1| O-antigen biosynthesis protein [Bacillus cereus Rock3-28]
          Length = 229

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 82/221 (37%), Gaps = 26/221 (11%)

Query: 13  SSFLGKCTTDAISKVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           S F        + K +   W +V   GC    LG AI        +V    AF  A + A
Sbjct: 13  SDFYYNAANPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFSEAAEKA 69

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
               D        +   ++P      DCV+    LE   DP+ ++ ++   +   G ++ 
Sbjct: 70  KEKLDHVVLGD--IETMDMPYEKGQFDCVIFGDVLEHLFDPWAVVEKVKPYIKQNGVILA 127

Query: 131 VVPNK----------RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFF 178
            +PN            G W   E+          +++ +M+ L  +A +++S   R    
Sbjct: 128 SIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRLFLKAGYSISKVDRVYVD 187

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAG-----IYVIEARK 214
              ++  I +L+ + +K     G GF        Y+IEA K
Sbjct: 188 HKIYEPLIEELYGICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|159900339|ref|YP_001546586.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893378|gb|ABX06458.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 251

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 25/182 (13%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLG-LGYAIPFFSCFHGKVERTLAFM 64
           V +RQ   ++L +  T    + L        GC   G + Y +  +   +G ++   A +
Sbjct: 20  VGMRQIAQAWLDQLPTQRAWRALDA------GCGTAGNVAYLLGDYGPAYG-LDLMQAAV 72

Query: 65  PAGQGATNWPDQYFSSTALVSEGN---LPLADSSVDCV--LMVHYLEFAEDPFLMLHEIW 119
             G+  T+ P         +++G+   LP  D S D V    V Y     D    L EI+
Sbjct: 73  QLGRKKTDAP---------LTQGSVLTLPYRDESFDLVTSFEVLYHRAVPDEVAALQEIY 123

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS--RSLF 177
           RVL  GG +++ +P    +++  + +   + + Y+  ++  LLR ANFT+  +S   S+ 
Sbjct: 124 RVLKPGGWVLLRMPAYHWLYSAHDRS-VHTRRRYTNKEVQKLLRAANFTIERSSYINSML 182

Query: 178 FP 179
           FP
Sbjct: 183 FP 184


>gi|127513041|ref|YP_001094238.1| hypothetical protein Shew_2113 [Shewanella loihica PV-4]
 gi|126638336|gb|ABO23979.1| conserved hypothetical protein [Shewanella loihica PV-4]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 70/147 (47%), Gaps = 11/147 (7%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------RGMWA 140
            LP+ +  +D V+    L+F  +P+ +L E  RVL SGG + ++  N        + + +
Sbjct: 77  QLPIQNGVIDAVVCSMLLDFEANPYSVLRETDRVLISGGYLFIIGFNPLSPAFFGKMLPS 136

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
           R E  P+ SG+ ++  ++   L    + +    R ++    H    ++  S+++     +
Sbjct: 137 RQEKLPW-SGRFFTPARVKDWLGLLGYQVVGDERLVYH---HLLSEIRGDSIWQHALQAW 192

Query: 201 GPGFAGIYVIEARKILYQGLPITESKK 227
            PG   +Y++ ARK+     PI + +K
Sbjct: 193 LPGSGSVYILVARKLDSPMTPILDRQK 219


>gi|300855615|ref|YP_003780599.1| putative methyltransferase [Clostridium ljungdahlii DSM 13528]
 gi|300435730|gb|ADK15497.1| predicted methyltransferase [Clostridium ljungdahlii DSM 13528]
          Length = 210

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARME 143
           S  +LPL D S+D V +   L    D    ++EI+RVL   G  ++  V    G WAR+E
Sbjct: 93  SMSDLPLFDESIDVVFVNMALHHVVDAKKAINEIYRVLKKDGTFVICDVEEHDGEWARIE 152


>gi|218462611|ref|ZP_03502702.1| putative methyltransferase protein [Rhizobium etli Kim 5]
          Length = 199

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP AD S D VL  H LE  +DP     EI RVL      I++ P
Sbjct: 120 NLPYADESFDFVLCSHVLEHVDDPVRATAEIRRVLKQDSVAILMAP 165


>gi|257056804|ref|YP_003134636.1| methyltransferase family protein [Saccharomonospora viridis DSM
           43017]
 gi|256586676|gb|ACU97809.1| methyltransferase family protein [Saccharomonospora viridis DSM
           43017]
          Length = 258

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 44/98 (44%), Gaps = 18/98 (18%)

Query: 84  VSEGNL---PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V  GNL   P+   S+D V  +  +E   D    L E  RVL  GGR+ V  PN      
Sbjct: 92  VVRGNLAFLPVRTGSIDVVANLQVIEHLWDQEGFLAECHRVLRPGGRLFVTTPN------ 145

Query: 141 RMEHTPFGSGQPYSWY--------QMISLLREANFTLS 170
           R+  TP  S  P + Y        ++  LLREA FT+ 
Sbjct: 146 RLTFTP-DSDTPLNPYHTRELSPSELDQLLREAGFTVE 182


>gi|294054907|ref|YP_003548565.1| transcriptional regulator, ArsR family [Coraliomargarita
           akajimensis DSM 45221]
 gi|293614240|gb|ADE54395.1| transcriptional regulator, ArsR family [Coraliomargarita
           akajimensis DSM 45221]
          Length = 310

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            +PLAD+SVD  L+   L  A  P L + E  R+L  GG++I++
Sbjct: 205 EVPLADASVDLALLSQALHHAPKPELAVREAHRILRPGGQLIIL 248


>gi|290960905|ref|YP_003492087.1| SAM-dependent methyltransferase [Streptomyces scabiei 87.22]
 gi|260650431|emb|CBG73547.1| putative SAM-dependent methyltransferase [Streptomyces scabiei
           87.22]
          Length = 255

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  WA  +       G  + Y   ++++ +REA  
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYKADELLARIREAGL 164


>gi|261856416|ref|YP_003263699.1| methyltransferase type 11 [Halothiobacillus neapolitanus c2]
 gi|261836885|gb|ACX96652.1| Methyltransferase type 11 [Halothiobacillus neapolitanus c2]
          Length = 281

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 92/221 (41%), Gaps = 29/221 (13%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
           ++Y++ +G    + ++  L    DD  G   + +G  +P       +    +A       
Sbjct: 18  RWYNTPMGARLAEDLAACLGRLADDAFGYHAVMVGAVLPCEPRLRIRARTQVA------- 70

Query: 70  ATNWPDQYFSSTALVSEGN----LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           AT    +  + T L++       LP+   S D V+ +H LE   +P  ++ E+ R++   
Sbjct: 71  ATR---EELAETPLMAVQADFDYLPIETESADLVIALHVLESTREPHDIMRELDRIIRPE 127

Query: 126 GRMIVVVPNKRGMWA-------------RMEHTPFGSGQPYSWYQMISLLREANFTL-SI 171
           GR+++V  N   +W              +M  + + +GQ  + ++++  LR   + + S+
Sbjct: 128 GRVLIVGVNPVSLWNLKKIGQQTWQGKDKMAQSGYLAGQHRAAWRVVDWLRLLGYDVQSV 187

Query: 172 TSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA 212
                  P T  +   K+ S    I + +     G YVI+A
Sbjct: 188 EHLGGLCPTTRPRFYDKMRS-LRTISSKWLWFMQGFYVIDA 227


>gi|77460268|ref|YP_349775.1| hypothetical protein Pfl01_4047 [Pseudomonas fluorescens Pf0-1]
 gi|77384271|gb|ABA75784.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 309

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 89  LPLADSSVDCVLMVHYLEFA--EDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           LP ADSSV  +   H++E    E     L E +RVLT GG + +  PN R
Sbjct: 40  LPFADSSVSHIFNEHFIEHVTREQAVAFLKECFRVLTPGGAIRITTPNLR 89


>gi|284030657|ref|YP_003380588.1| type 11 methyltransferase [Kribbella flavida DSM 17836]
 gi|283809950|gb|ADB31789.1| Methyltransferase type 11 [Kribbella flavida DSM 17836]
          Length = 241

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
            L L D+S D V  +  LE   D    L EI RVL  GGR ++  PN+
Sbjct: 93  QLDLPDASFDVVTTIEVLEHVRDLDASLAEIHRVLVPGGRFLITSPNR 140


>gi|297199307|ref|ZP_06916704.1| methyltransferase [Streptomyces sviceus ATCC 29083]
 gi|297147360|gb|EDY61207.2| methyltransferase [Streptomyces sviceus ATCC 29083]
          Length = 221

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  WA  +       G  + Y   ++++ +REA  
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYKADELLAKIREAGL 164


>gi|163848970|ref|YP_001637014.1| type 11 methyltransferase [Chloroflexus aurantiacus J-10-fl]
 gi|222526924|ref|YP_002571395.1| type 11 methyltransferase [Chloroflexus sp. Y-400-fl]
 gi|163670259|gb|ABY36625.1| Methyltransferase type 11 [Chloroflexus aurantiacus J-10-fl]
 gi|222450803|gb|ACM55069.1| Methyltransferase type 11 [Chloroflexus sp. Y-400-fl]
          Length = 285

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
           LPL D++ D  +    LE  +DP  +L E+ RVL  GG  ++   N+R 
Sbjct: 117 LPLPDAAFDLAVAWDVLEHVQDPIAVLRELARVLRPGGHALITAINRRA 165


>gi|125590766|gb|EAZ31116.1| hypothetical protein OsJ_15214 [Oryza sativa Japonica Group]
          Length = 177

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A + A N    YF    L  E  L L  SS+D VL    +++ + P  +  EI+RVL  G
Sbjct: 26  AQELAKNPRLDYFFVKDLNKEQRLELQTSSLDAVLCTVSVQYLQSPEKVFAEIFRVLKPG 85

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMIS 160
           G  IV   N+  M+       +  G  YS  Q+++
Sbjct: 86  GVCIVSFSNR--MFYEKAIGAWREGTAYSRVQLVT 118


>gi|146307093|ref|YP_001187558.1| hypothetical protein Pmen_2065 [Pseudomonas mendocina ymp]
 gi|145575294|gb|ABP84826.1| hypothetical protein Pmen_2065 [Pseudomonas mendocina ymp]
          Length = 252

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 9/161 (5%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW-AR 141
           +  E + PL + + D V++ H L+F   P  +L E  R +  GG ++++  +    W AR
Sbjct: 84  VCEEQSWPLGEHAADVVVLQHGLDFCLSPHGLLREAARSVRPGGHLLILGIHPWSGWGAR 143

Query: 142 MEHTPFGSGQ-----PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
                 G  Q     P      ++LL    F L       + PP             E+ 
Sbjct: 144 RLFAQDGLRQARCISPSRVGDWLTLL---GFALEKRRFGCYRPPLASLAWQMRLRRLERW 200

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           G  +    AG Y++ ARK++    P+ +S+++ +   + +P
Sbjct: 201 GEAWQLPGAGFYLLVARKLVVGLRPLRQSRREPMGKLLPLP 241


>gi|56750233|ref|YP_170934.1| hypothetical protein syc0224_c [Synechococcus elongatus PCC 6301]
 gi|56685192|dbj|BAD78414.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 188

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           D++F    L  +  LP  DSS D VL+   +++ + P  +L E+ RVL  GG++I+   N
Sbjct: 93  DRWFVQN-LNQQSALPELDSSFDAVLIAVSVQYLQQPEQVLAEVRRVLRPGGQLIISFSN 151

Query: 135 K 135
           +
Sbjct: 152 R 152


>gi|289547807|ref|YP_003472795.1| methyltransferase type 11 [Thermocrinis albus DSM 14484]
 gi|289181424|gb|ADC88668.1| Methyltransferase type 11 [Thermocrinis albus DSM 14484]
          Length = 210

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR-----ME 143
           LPL    +D +L+   L F +D    L E +RVL  GG++++   +K     +      +
Sbjct: 85  LPLKGEVMDYLLITTTLCFVDDVRSTLKEAYRVLKRGGKLVLGFVDKDSFLGKYYLSMKD 144

Query: 144 HTPF-GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
             PF      YS   +  LL+E NF +   S+++F  P   K
Sbjct: 145 KNPFYRHATFYSTRDVAQLLQEENFWVEKISQTVFHLPHQVK 186


>gi|283834501|ref|ZP_06354242.1| SAM-dependent methyltransferase [Citrobacter youngae ATCC 29220]
 gi|291070051|gb|EFE08160.1| SAM-dependent methyltransferase [Citrobacter youngae ATCC 29220]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +I+   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCADPHRLLREADRVLIDDGWLILSGFNPVSLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
                PY+  +M +L+R+ ++   +    L +   H   +L       K+ +   P    
Sbjct: 143 LRKTSPYN-SRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWNRKGGKMLSAHIPALGC 198

Query: 207 IYVIEARKILYQGLPITESKKKHISS 232
           + ++ ARK   + +P+T +  K   S
Sbjct: 199 LQLVVARK---RTIPLTLNPMKQNKS 221


>gi|229090260|ref|ZP_04221505.1| O-antigen biosynthesis protein [Bacillus cereus Rock3-42]
 gi|228693040|gb|EEL46756.1| O-antigen biosynthesis protein [Bacillus cereus Rock3-42]
          Length = 232

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KYIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|86141334|ref|ZP_01059880.1| hypothetical protein MED217_04932 [Leeuwenhoekiella blandensis
           MED217]
 gi|85831893|gb|EAQ50348.1| hypothetical protein MED217_04932 [Leeuwenhoekiella blandensis
           MED217]
          Length = 255

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +LP  D S D +   H LE   D    + E++R+L SGG  I+ +P 
Sbjct: 132 DLPFEDDSYDVIFCNHVLEHIPDDTKAMQELYRILKSGGMAILQIPQ 178


>gi|285018540|ref|YP_003376251.1| transcriptional regulator transcription regulator protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473758|emb|CBA16261.1| putative transcriptional regulator transcription regulator protein
           [Xanthomonas albilineans]
          Length = 332

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           S   V EG+   LP AD+  D V+M+H L +A  P   + E  RVL  GGR+++
Sbjct: 193 SNVEVREGDMHALPFADAGFDLVVMMHALTYATKPAHAVCESARVLRPGGRLLL 246


>gi|88857809|ref|ZP_01132451.1| hypothetical protein PTD2_10504 [Pseudoalteromonas tunicata D2]
 gi|88819426|gb|EAR29239.1| hypothetical protein PTD2_10504 [Pseudoalteromonas tunicata D2]
          Length = 256

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 63/156 (40%), Gaps = 10/156 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LP  + SVD  L+ H LE+  DP  +L E  R L  GG +++   N   +       PF
Sbjct: 83  ELPFYEHSVDACLLSHCLEYYSDPHHILREAHRTLIPGGYILITGFNPLSLCGLARLLPF 142

Query: 148 G------SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
                  SG+ ++  ++   L    F + +      F    +   L  + +++     + 
Sbjct: 143 SRQKLPWSGRFFTPARVKDWLHLLGFEV-LEDERFIFSSLARGSRLSRFELWQNFCRQYL 201

Query: 202 PGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                +Y+I ARK +    P+T  K K  + P   P
Sbjct: 202 KPMGSVYLIVARKRV---TPLTPIKPKWHARPQFSP 234


>gi|291333748|gb|ADD93434.1| 2 polyprenyl 3 methyl 5 hydroxy 6 metoxy 1 4 benzoquinol methylase
           [uncultured marine bacterium MedDCM-OCT-S04-C103]
          Length = 239

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 42/99 (42%), Gaps = 14/99 (14%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS 149
           P  D S D V+M   +E   DP ++LH   + L   G + V  PN  G+  R+    + +
Sbjct: 99  PFIDGSFDLVIMNQVIEHLPDPIMVLHAAKKALKLKGALYVTTPNFGGISFRLLKDKWKN 158

Query: 150 GQPYSWYQMISL------LREANFT--------LSITSR 174
             P     M S+      L +A F         LSITSR
Sbjct: 159 TCPNDHISMFSVKSLRHYLHDAGFKNLIVRSVGLSITSR 197


>gi|304316215|ref|YP_003851360.1| methyltransferase type 11 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777717|gb|ADL68276.1| Methyltransferase type 11 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 211

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-VPNKRGMWARME 143
           +P+ D S+D V     L   E+PF  + EI R+L  GG +I+  V      WAR E
Sbjct: 100 IPIIDDSIDVVFSNMVLHHVENPFKGIMEIHRILKPGGMLIITDVMKHSSEWARFE 155


>gi|326328788|ref|ZP_08195124.1| LigA [Nocardioidaceae bacterium Broad-1]
 gi|325953410|gb|EGD45414.1| LigA [Nocardioidaceae bacterium Broad-1]
          Length = 261

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
           S   LP AD S D V     +E  E     L EI RVL  GGR+++ VP     W
Sbjct: 86  SATGLPFADGSFDVVAAFDVIEHCEPEATALAEIQRVLAPGGRLLMSVPAYNWAW 140


>gi|325690511|gb|EGD32514.1| methyltransferase domain protein [Streptococcus sanguinis SK115]
          Length = 236

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 14/148 (9%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           GK   D +   L +    + G ++L  G      + F  K  +  A  P+ +       Q
Sbjct: 17  GKLQYDIVFAFLES----LRGQKILDFGSGFGIVADFLAKNNQVTAIEPSSEMIAERK-Q 71

Query: 77  YFSSTALVSEGNLPLA----DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
            FS   L  +G+L L     D   D ++  + LE+  DP L L E  R+L  GG++ +V 
Sbjct: 72  DFSYEQL--QGSLELLQTLPDQFFDVIVCHNVLEYVSDPALYLAEFSRLLKKGGKISLVK 129

Query: 133 PNKRGMWARMEHTPFGSGQPYSWYQMIS 160
            ++ G   R+ HT      P    Q+++
Sbjct: 130 HHEVG---RVMHTVVFENDPEKAQQLLA 154


>gi|281354849|ref|ZP_06241343.1| Methyltransferase type 11 [Victivallis vadensis ATCC BAA-548]
 gi|281317729|gb|EFB01749.1| Methyltransferase type 11 [Victivallis vadensis ATCC BAA-548]
          Length = 242

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 14/106 (13%)

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           PA + A N  D ++    L      P    + D V++   LE   +P  +L E+ RVL  
Sbjct: 76  PAARQAGN-ADYFYDGQTL------PFDSETFDGVVLNEVLEHVFNPEELLTELRRVLRP 128

Query: 125 GGRMIVVVPNKRGMWARMEH-TPFGSGQPYSWYQMISLLREANFTL 169
           GGR+I+ VP     +A +EH  PF   + Y+ + + +LL    F +
Sbjct: 129 GGRIILTVP-----FAWIEHEKPFDYAR-YTSFGLKALLERNGFAV 168


>gi|254499407|ref|ZP_05112073.1| truncated generic methyl-transferase [Legionella drancourtii
           LLAP12]
 gi|254351386|gb|EET10255.1| truncated generic methyl-transferase [Legionella drancourtii
           LLAP12]
          Length = 181

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 30/146 (20%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------ 140
            +LPL+ +S+DC++    LE   +   ++ EI RVL   G ++++  N   +W       
Sbjct: 12  NHLPLSRNSIDCLVAPLTLEPFNNSITLIDEIDRVLKPMGFVVLLCINPWSLWGGAIKYG 71

Query: 141 ----------RMEHTPFGSGQPY--SWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
                     +M  TPF   + +    Y+ +SL    NF         + PP +   ++K
Sbjct: 72  MLNCYRDRTIKM-RTPFNLNRLFIQRGYRQVSL---TNFC--------YIPPVNSASLIK 119

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARK 214
             +  ++IG +  P  +G Y   A+K
Sbjct: 120 KLTFLDEIGKMLWPYPSGFYCYIAQK 145


>gi|315186080|gb|EFU19843.1| Methyltransferase type 11 [Spirochaeta thermophila DSM 6578]
          Length = 135

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            +LP+ D SVD V    YL   EDP   + E+ R+L  GGR+++
Sbjct: 22  AHLPIDDESVDYVFANMYLYHVEDPPRAIQEMARILKPGGRLVI 65


>gi|256425801|ref|YP_003126454.1| methyltransferase type 11 [Chitinophaga pinensis DSM 2588]
 gi|256040709|gb|ACU64253.1| Methyltransferase type 11 [Chitinophaga pinensis DSM 2588]
          Length = 217

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           +P AD S   V   + L F ++P + L  I+RVL +GG +I+ + +   M       PF 
Sbjct: 107 MPFADGSFTKVFAANVLYFWDEPSVALRAIYRVLETGGELILAIRSAESMM----QLPFS 162

Query: 149 SG--QPYSWYQMISLLREANFTLS 170
           +     YS     +LL+E  F ++
Sbjct: 163 AHGFTLYSVEDAEALLQENGFAIA 186


>gi|206968050|ref|ZP_03229006.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206736970|gb|EDZ54117.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 229

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|149178882|ref|ZP_01857461.1| Methyltransferase type 11 [Planctomyces maris DSM 8797]
 gi|148842294|gb|EDL56678.1| Methyltransferase type 11 [Planctomyces maris DSM 8797]
          Length = 228

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           NLP  D S DCV     LE+  DP   L EI RVL  GG + ++    +
Sbjct: 116 NLPFQDESFDCVTCGWVLEYVADPRHGLTEIHRVLQPGGSLFLLATEDK 164


>gi|158521551|ref|YP_001529421.1| methyltransferase type 11 [Desulfococcus oleovorans Hxd3]
 gi|158510377|gb|ABW67344.1| Methyltransferase type 11 [Desulfococcus oleovorans Hxd3]
          Length = 402

 Score = 39.7 bits (91), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           LP  D S D V+    +E+  +PF +  E+ RVLT GG   V   N+
Sbjct: 287 LPFDDKSFDAVVCTASIEYLTNPFAVFDEVARVLTQGGVFAVTFSNR 333


>gi|229171959|ref|ZP_04299524.1| O-antigen biosynthesis protein [Bacillus cereus MM3]
 gi|228611302|gb|EEK68559.1| O-antigen biosynthesis protein [Bacillus cereus MM3]
          Length = 229

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSGGALGAAIKENGI---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+  + ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEEQFDCVIFGDVLEHLFDPWAAIEKVKPYIKENGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|219123478|ref|XP_002182051.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217406652|gb|EEC46591.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 225

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK------RGMWARM 142
           LP  D+S D V  V  +++  DP  +L E+ RVL  GG++IV   N+        MW +M
Sbjct: 118 LPYDDNSFDVVTCVVSIDYLVDPVTVLKEVHRVLRPGGQVIVSQSNRCFPSKAIAMWLKM 177

Query: 143 E 143
            
Sbjct: 178 N 178


>gi|160872779|ref|ZP_02062911.1| putative generic methyltransferase [Rickettsiella grylli]
 gi|159121578|gb|EDP46916.1| putative generic methyltransferase [Rickettsiella grylli]
          Length = 294

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           PL DS +D +++++ LE  E+  + L +I+R+L   G +I+ VP+
Sbjct: 138 PLPDSCIDAIVLLNVLEHIENDSMTLKQIYRILKPNGVLILEVPS 182


>gi|49480887|ref|YP_035449.1| O-antigen biosynthesis protein; glycosyltransferase;
           methyltransferase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|49332443|gb|AAT63089.1| possible O-antigen biosynthesis protein; possible
           glycosyltransferase; possible methyltransferase
           [Bacillus thuringiensis serovar konkukian str. 97-27]
          Length = 229

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 81/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEQAKEKLDHVVLGDIE 82

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
             E  +P  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 83  TME--MPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W+  E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           V +K  +  G GF        Y+IEA K
Sbjct: 201 VCKK--HRLGSGFMAETVVFQYIIEAEK 226


>gi|229189404|ref|ZP_04316421.1| O-antigen biosynthesis protein [Bacillus cereus ATCC 10876]
 gi|228593995|gb|EEK51797.1| O-antigen biosynthesis protein [Bacillus cereus ATCC 10876]
          Length = 232

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|253702658|ref|YP_003023847.1| methyltransferase type 11 [Geobacter sp. M21]
 gi|251777508|gb|ACT20089.1| Methyltransferase type 11 [Geobacter sp. M21]
          Length = 208

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 59/133 (44%), Gaps = 18/133 (13%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM------ 142
           LPL D+S D  +MV  + F +D      E WR+L  GG +++   ++     +       
Sbjct: 87  LPLPDASFDYAVMVTVVCFLDDVATAFREAWRILKRGGVLVIGFIDRESELGKAYERKKK 146

Query: 143 EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           +   +     YS  +++ L+ EA F      R      ++++ +L   +V  ++  + G 
Sbjct: 147 QSEFYRDATFYSVSELVKLMSEAGF------RGF----SYRQTLLAEEAV--RLNVVGGH 194

Query: 203 GFAGIYVIEARKI 215
           G  G  VI A K+
Sbjct: 195 GSGGFVVIRAIKV 207


>gi|163761103|ref|ZP_02168180.1| transcriptional regulator, ArsR family protein [Hoeflea
           phototrophica DFL-43]
 gi|162281654|gb|EDQ31948.1| transcriptional regulator, ArsR family protein [Hoeflea
           phototrophica DFL-43]
          Length = 337

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 75  DQYFSSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           D+   + A V +G   NLPL   + D V +   L F  DP   + E  R+L  GGR+I+V
Sbjct: 199 DEAGITHASVRQGDIFNLPLDRENFDVVTIHQVLHFLHDPLPAISEAARMLRPGGRVIIV 258

Query: 132 --VPNKRGMWARMEHT----PFGSGQPYSWYQMISLLRE 164
              P+      R++H      F  GQ   W +   L  E
Sbjct: 259 DFAPHDHEAL-RLDHAHARLGFSHGQVSDWLEQCGLTVE 296


>gi|157147191|ref|YP_001454510.1| hypothetical protein CKO_02970 [Citrobacter koseri ATCC BAA-895]
 gi|157084396|gb|ABV14074.1| hypothetical protein CKO_02970 [Citrobacter koseri ATCC BAA-895]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFADKSVDVCLLAHTLPWCVDPHRLLREADRVLIDDGWLVLSGFNPISLMGLRKLVPV 142

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
                PY+  +M +L+R+ ++   +    L +   H   +L       K+ +   P    
Sbjct: 143 LRKSSPYN-SRMFTLMRQLDWLSLLNFEVLHYSRFH---VLPWSKQGGKLLSTHIPALGC 198

Query: 207 IYVIEARKILYQGLPITESKKKHISS 232
           + +I ARK   + +P+T +  K   S
Sbjct: 199 LQLIVARK---RTIPLTLNPMKQNKS 221


>gi|194908182|ref|XP_001981723.1| GG11446 [Drosophila erecta]
 gi|190656361|gb|EDV53593.1| GG11446 [Drosophila erecta]
          Length = 1269

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVL---MVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           D++ +  AL     LP  D S D VL   +VH+    E     L E+ R+L  GGR+++ 
Sbjct: 78  DRWLAGVALCDNLELPFRDDSFDAVLSLAVVHHFATTERRVQALRELARILRIGGRVVIT 137

Query: 132 V 132
           V
Sbjct: 138 V 138


>gi|91203725|emb|CAJ71378.1| hypothetical protein kustc0633 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 179

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT 145
           P AD+ +D + M   LE   +P  ++ EI+R+  +G ++ V VP  R  +A ++ T
Sbjct: 39  PFADNEIDEIWMDQILEHLPEPLRVMEEIYRISKNGTKITVGVPYFRSFYAVIDPT 94


>gi|317123844|ref|YP_004097956.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           demethylmenaquinone methyltransferase [Intrasporangium
           calvum DSM 43043]
 gi|315587932|gb|ADU47229.1| 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase;
           demethylmenaquinone methyltransferase [Intrasporangium
           calvum DSM 43043]
          Length = 230

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           G    PD  F++   +S   LP AD+S D V M + L    D    L E  RV   GGR+
Sbjct: 89  GRRRRPDMAFTAADAMS---LPFADASFDVVTMSYGLRNVSDTDAALREFLRVAKPGGRL 145

Query: 129 IV 130
           +V
Sbjct: 146 VV 147


>gi|297153625|gb|ADI03337.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase
           [Streptomyces bingchenggensis BCW-1]
          Length = 188

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 27/53 (50%)

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           F + A      LP AD S D V     LE   DPF ++ E+ RVL  GG +IV
Sbjct: 41  FHAVAQADIVALPFADESFDVVTAGQCLEHVPDPFAVVGELCRVLRPGGTLIV 93


>gi|124003491|ref|ZP_01688340.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123991060|gb|EAY30512.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 256

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 10/82 (12%)

Query: 73  WPDQYFSSTALVSEGNLP----LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           W  + +     +S+ N+P    L D++ D V+    +E  +D  L L EI RVL  GG+ 
Sbjct: 70  WLSEQYKDFTFLSQ-NIPPFTGLQDNTYDFVVSFQVIEHIKDDHLYLKEINRVLKPGGKA 128

Query: 129 IVVVPN-----KRGMWARMEHT 145
           ++  PN      R  W   E+T
Sbjct: 129 LITTPNIKYSLTRNPWHIREYT 150


>gi|300709747|ref|YP_003735561.1| Methyltransferase type 11 [Halalkalicoccus jeotgali B3]
 gi|299123430|gb|ADJ13769.1| Methyltransferase type 11 [Halalkalicoccus jeotgali B3]
          Length = 206

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           LP AD S D V     +E+  DP   L EI R+   GG ++VV PN
Sbjct: 103 LPFADDSFDVVWSSGSIEYWPDPVAALREIKRITAPGGEVLVVGPN 148


>gi|302545869|ref|ZP_07298211.1| methyltransferase type 11 [Streptomyces hygroscopicus ATCC 53653]
 gi|302463487|gb|EFL26580.1| methyltransferase type 11 [Streptomyces himastatinicus ATCC 53653]
          Length = 245

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN- 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAVTVPRY 126

Query: 135 --KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
             ++  WA  +       G  + Y   +++  +REA  
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYRGDELLERMREAGL 164


>gi|37524933|ref|NP_928277.1| hypothetical protein plu0941 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784359|emb|CAE13236.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 237

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP- 146
           +LP  + SVD  L+ H L ++ DP  +L E+ RV+   G +I+   N   +    +  P 
Sbjct: 83  HLPFEEKSVDACLLSHMLAYSADPHRLLREVDRVMIDDGWLIISGFNSLSLLGLGKLVPG 142

Query: 147 FGSGQPYSWYQMISLLREANF 167
               QPY   +M S++R+ ++
Sbjct: 143 LWRHQPYC-SRMFSMMRQLDW 162


>gi|296101378|ref|YP_003611524.1| hypothetical protein ECL_01012 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055837|gb|ADF60575.1| hypothetical protein ECL_01012 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 238

 Score = 39.3 bits (90), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LP A+ SVD  L+ H + +  DP  ML E  RVL   G +++   N   +    +  P 
Sbjct: 83  HLPFAEKSVDACLLAHTIPWCSDPHRMLREADRVLIDDGWLVISGFNPLSLMGLRKLVPV 142

Query: 148 GSGQPYSWYQMISLLREANF 167
               P    +M +++R+ ++
Sbjct: 143 LRRTPPYNSRMFTMMRQLDW 162


>gi|209526658|ref|ZP_03275182.1| Methyltransferase type 11 [Arthrospira maxima CS-328]
 gi|209492894|gb|EDZ93225.1| Methyltransferase type 11 [Arthrospira maxima CS-328]
          Length = 235

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
           + ++S D V+  H++E  +DP   +  + RVL  GG + + VP+KR
Sbjct: 84  VEEASQDFVIANHFIEHCQDPITTIENLLRVLKKGGILYLAVPDKR 129


>gi|256810472|ref|YP_003127841.1| Methyltransferase type 11 [Methanocaldococcus fervens AG86]
 gi|256793672|gb|ACV24341.1| Methyltransferase type 11 [Methanocaldococcus fervens AG86]
          Length = 237

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           A V+ G LP  D   D V++   LE   + F+ L EI RVL   G +IV VP
Sbjct: 75  ADVTRG-LPFNDKEFDAVIIAEVLEHLFEDFIALKEIRRVLKDDGILIVTVP 125


>gi|270308580|ref|YP_003330638.1| SAM-dependent methyltransferase [Dehalococcoides sp. VS]
 gi|270154472|gb|ACZ62310.1| SAM-dependent methyltransferase [Dehalococcoides sp. VS]
          Length = 206

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 78  FSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           +  + L + GN LPL D S+D      +L   EDP   + E+ R+L  GGR++V 
Sbjct: 83  YGVSCLQASGNTLPLKDQSIDYSFANMFLHHVEDPAGAIKEMSRILLPGGRLVVT 137


>gi|302556659|ref|ZP_07309001.1| methyltransferase type 11 [Streptomyces griseoflavus Tu4000]
 gi|302474277|gb|EFL37370.1| methyltransferase type 11 [Streptomyces griseoflavus Tu4000]
          Length = 262

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           LPL   SVDC++  H L    D    L E  RVL  GG ++VV+ N RG   R+
Sbjct: 100 LPLRTRSVDCLMERHMLYHVTDVERALREARRVLRPGGTLVVVL-NMRGTTPRL 152


>gi|302534191|ref|ZP_07286533.1| methyltransferase [Streptomyces sp. C]
 gi|302443086|gb|EFL14902.1| methyltransferase [Streptomyces sp. C]
          Length = 247

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 125


>gi|251772175|gb|EES52745.1| putative methyltransferase [Leptospirillum ferrodiazotrophum]
          Length = 271

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           NLP+AD+SVD ++    +  + D   +  E +RVL  GGRM++
Sbjct: 145 NLPVADASVDIIISNCVVNLSPDKARVFSEAFRVLRPGGRMVI 187


>gi|218295235|ref|ZP_03496071.1| Methyltransferase type 11 [Thermus aquaticus Y51MC23]
 gi|218244438|gb|EED10963.1| Methyltransferase type 11 [Thermus aquaticus Y51MC23]
          Length = 212

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +LP A+ S D VL+   LEF ED    L E  RVL  GG ++V +      WA +
Sbjct: 89  DLPFAEGSFDLVLLFTTLEFVEDVEKTLSEARRVLRPGGALVVGILEALSPWAAL 143


>gi|111221346|ref|YP_712140.1| hypothetical protein FRAAL1908 [Frankia alni ACN14a]
 gi|111148878|emb|CAJ60557.1| hypothetical protein; putative SAM domain [Frankia alni ACN14a]
          Length = 655

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 14/109 (12%)

Query: 97  DCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY 156
           D + M HYLE   DP   L     VL  GG +++ VPN     AR+    +G+  P  W 
Sbjct: 490 DIISMFHYLEHTRDPRAELDAAAAVLEPGGHLLIEVPNPDSPAARL----YGALWP-GWL 544

Query: 157 --QMISLLREANFTLSITSRSLF-----FPPTHKKC--ILKLWSVFEKI 196
             Q   L+  AN   ++  R        F   H+K   ++ L+ + +++
Sbjct: 545 IPQHQHLMPAANVAAALQERGFAVQETRFGEVHQKGDPVMALYGLLQRL 593


>gi|332518932|ref|ZP_08395399.1| Methyltransferase type 11 [Lacinutrix algicola 5H-3-7-4]
 gi|332044780|gb|EGI80973.1| Methyltransferase type 11 [Lacinutrix algicola 5H-3-7-4]
          Length = 263

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP  D+S D +L  H LE   D    + E++RV+  GG  I  +P
Sbjct: 138 NLPFEDNSYDIILCNHVLEHIPDDTKAMQELYRVMKPGGYGIFQIP 183


>gi|228964261|ref|ZP_04125380.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228795358|gb|EEM42846.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 229

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGTLGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DC+L    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEEQFDCILFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|254415718|ref|ZP_05029476.1| Methyltransferase domain family [Microcoleus chthonoplastes PCC
           7420]
 gi|196177424|gb|EDX72430.1| Methyltransferase domain family [Microcoleus chthonoplastes PCC
           7420]
          Length = 247

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 56/138 (40%), Gaps = 24/138 (17%)

Query: 55  GKVERTLAFMPAGQGATNWPDQYFSSTALVS-------EGNLPLADSSVDCVLMVHYLEF 107
           G   R L  MP  Q    +P+   S   LV        E    +AD+S+D V+  H +E 
Sbjct: 56  GVTVRYLDRMPVEQLRKQYPE--LSKYNLVEPDIIDDGETLASIADASLDFVIANHMIEH 113

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR------MEH--TPFGSGQPYS----- 154
            ++P   L    R L   G + + +P+KR  + R      +EH    +  G  +S     
Sbjct: 114 CQNPIFSLKNWLRTLKGSGILYLAIPDKRYTFDRDRPVTTLEHLVQDYAEGPAWSKKSHF 173

Query: 155 --WYQMISLLREANFTLS 170
             W +++S + E    L 
Sbjct: 174 EEWSRLVSKVSENEVALK 191


>gi|162455605|ref|YP_001617972.1| putative methyltransferase [Sorangium cellulosum 'So ce 56']
 gi|161166187|emb|CAN97492.1| putative methyltransferase [Sorangium cellulosum 'So ce 56']
          Length = 248

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           ++PL D   D +   H LE  E P  +L E  R+L  GGR +   PN
Sbjct: 93  SIPLPDGCADVIAADHLLEHLERPEAVLREAHRLLRPGGRFVFTAPN 139


>gi|330993219|ref|ZP_08317156.1| type 11 methyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329759770|gb|EGG76277.1| type 11 methyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 214

 Score = 39.3 bits (90), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV-----VPNKR-GMWAR 141
            LPLAD S+D VL+     +   P  +L E  RVL  GG +I+      +P+K   +W  
Sbjct: 104 ELPLADESMDAVLLCDVAPYLRQPVALLREAARVLQPGGLIILTSGTRFIPHKATALWQA 163

Query: 142 MEHT 145
           ++ T
Sbjct: 164 LDET 167


>gi|307243409|ref|ZP_07525566.1| methyltransferase domain protein [Peptostreptococcus stomatis DSM
           17678]
 gi|306493219|gb|EFM65215.1| methyltransferase domain protein [Peptostreptococcus stomatis DSM
           17678]
          Length = 199

 Score = 39.3 bits (90), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 58/145 (40%), Gaps = 32/145 (22%)

Query: 18  KCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG--ATNWPD 75
           K   D    + S   D V G  +L +           G++ R++A  PA +   AT++ +
Sbjct: 18  KSDRDTYDDMYSKISDSVGGKSVLEIASGT-------GRLARSVA--PASKRFVATDYSE 68

Query: 76  QYFS-----------STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
              S           S  L    NLP  D S + V++ + L    DP   L EI RVL  
Sbjct: 69  GMLSVASKEACPDNLSFELADANNLPYPDDSYEVVIIANALHIMPDPTKALSEIRRVLKP 128

Query: 125 GGRMIVVVPN--------KRGMWAR 141
           GG  +++ PN        K  +W R
Sbjct: 129 GG--LLIAPNFVNRAGGVKSNLWTR 151


>gi|302187969|ref|ZP_07264642.1| hypothetical protein Psyrps6_16548 [Pseudomonas syringae pv.
           syringae 642]
          Length = 253

 Score = 39.3 bits (90), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 62/159 (38%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  +
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSTWG-I 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G YV+ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMP 241


>gi|149186810|ref|ZP_01865120.1| Methylase involved in ubiquinone/menaquinone biosynthesis-like
           protein [Erythrobacter sp. SD-21]
 gi|148829477|gb|EDL47918.1| Methylase involved in ubiquinone/menaquinone biosynthesis-like
           protein [Erythrobacter sp. SD-21]
          Length = 248

 Score = 39.3 bits (90), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 62/145 (42%), Gaps = 18/145 (12%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           +E++   +S  GK    A  K++     D+ G  +L LG          G +   L    
Sbjct: 14  IEVKGHVASERGKRLRKA-RKIVDLLGMDLAGKSVLDLGTGA-------GVIAEYLVSQG 65

Query: 66  AGQGATNWPDQYFSSTAL----VSEGNLPLADSSVDCVLMVHYLEFAED---PFLMLHEI 118
           A   A +     F+   L    + + +LP  D + D ++  H +E   D     ++L EI
Sbjct: 66  AVVTAADRDTSAFAVDGLEPARLEDLSLPFEDEAFDAIIFNHVIEHVGDRPEQAILLAEI 125

Query: 119 WRVLTSGGRMIVVVPNKRGMWARME 143
            R L  GG++ + VPNK   WA +E
Sbjct: 126 RRCLRPGGKLYLAVPNK---WALIE 147


>gi|310780452|ref|YP_003968784.1| Methyltransferase type 11 [Ilyobacter polytropus DSM 2926]
 gi|309749775|gb|ADO84436.1| Methyltransferase type 11 [Ilyobacter polytropus DSM 2926]
          Length = 248

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           + +  LP  D S+D V+     E  ++ F + HEI+R L   G + + VPN   +  R+
Sbjct: 88  IEKDKLPFEDDSIDIVIANQVFEHTKEIFWINHEIFRCLKRDGFLFLGVPNVLSLHNRI 146


>gi|303247628|ref|ZP_07333898.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ]
 gi|302490900|gb|EFL50797.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ]
          Length = 353

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM---WARMEHT-P 146
           L+D   D V+M   LE   +P   L E+ R+L  GG +++ VPN  G+   ++   HT  
Sbjct: 186 LSDCFYDYVVMRDVLEHIPNPVDFLRELARILKPGGSLLIQVPNIEGLIYKFSGSRHTVV 245

Query: 147 FGSGQPYSW--YQMISLLREANFTLSI 171
           FG   P  W    +   L+ A F++ +
Sbjct: 246 FGFEHPNYWSPRSLDVALQRAGFSVQL 272


>gi|297568659|ref|YP_003690003.1| Arsenite methyltransferase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924574|gb|ADH85384.1| Arsenite methyltransferase [Desulfurivibrio alkaliphilus AHT2]
          Length = 1081

 Score = 39.3 bits (90), Expect = 0.48,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           +PL D   D V+    +  + D   + HEIWR+L  GGR++V
Sbjct: 613 IPLPDDCADLVISNCVINLSPDKRRVFHEIWRILKPGGRLVV 654


>gi|302529140|ref|ZP_07281482.1| predicted protein [Streptomyces sp. AA4]
 gi|302438035|gb|EFL09851.1| predicted protein [Streptomyces sp. AA4]
          Length = 210

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
            LPL D ++D  L V+ + F  D      E+ RVL+ GGR +V +    G  A M   PF
Sbjct: 111 ELPLEDGTIDAALTVNTVYFVPDLAPAFAEVARVLSGGGRFVVGI----GDPAMMREMPF 166

Query: 148 GS 149
            S
Sbjct: 167 TS 168


>gi|302551048|ref|ZP_07303390.1| methyltransferase [Streptomyces viridochromogenes DSM 40736]
 gi|302468666|gb|EFL31759.1| methyltransferase [Streptomyces viridochromogenes DSM 40736]
          Length = 253

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 68  ATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 125


>gi|256371306|ref|YP_003109130.1| Methyltransferase type 11 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007890|gb|ACU53457.1| Methyltransferase type 11 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 222

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           LP AD S D VL    LE    P  ++ E  RVL  GG+++V VP+
Sbjct: 63  LPFADGSFDVVLCAEVLEHVAHPAQVVREARRVLAPGGQLVVSVPS 108


>gi|119475406|ref|ZP_01615759.1| metW protein [marine gamma proteobacterium HTCC2143]
 gi|119451609|gb|EAW32842.1| metW protein [marine gamma proteobacterium HTCC2143]
          Length = 196

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN--------K 135
           +++G     ++S D V+M H L+   DP L+++E+ RV   G   IV  PN         
Sbjct: 65  LNQGLATFRENSFDVVVMAHALQTLRDPHLVINEMLRV---GRECIVTFPNFAHWRCRWH 121

Query: 136 RGMWARMEHTPFGSGQPYSWYQ 157
            G   RM   P     PY+WY 
Sbjct: 122 LGQQGRM---PVSKFMPYNWYD 140


>gi|219847805|ref|YP_002462238.1| methyltransferase type 11 [Chloroflexus aggregans DSM 9485]
 gi|219542064|gb|ACL23802.1| Methyltransferase type 11 [Chloroflexus aggregans DSM 9485]
          Length = 282

 Score = 39.3 bits (90), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
           LPL  +  D V+    LE  +DP  +L EI RVL  GG  ++   N+R 
Sbjct: 114 LPLLSAQFDVVVAWDVLEHVQDPIAVLREIARVLRPGGHALITAINRRA 162


>gi|317152416|ref|YP_004120464.1| type 11 methyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316942667|gb|ADU61718.1| Methyltransferase type 11 [Desulfovibrio aespoeensis Aspo-2]
          Length = 248

 Score = 39.3 bits (90), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 5/57 (8%)

Query: 89  LPLADSSVDCVLM---VHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           LP  D++ D V +   +H+++FA +   +L E WRVL  GGR++++  + R + +R+
Sbjct: 102 LPFCDATFDVVYLRDLLHHVDFARE--TVLDEAWRVLKPGGRIVILESHGRRLLSRL 156


>gi|302518731|ref|ZP_07271073.1| methyltransferase [Streptomyces sp. SPB78]
 gi|302427626|gb|EFK99441.1| methyltransferase [Streptomyces sp. SPB78]
          Length = 267

 Score = 39.3 bits (90), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 125


>gi|291280035|ref|YP_003496870.1| S-adenosylmethionine-dependent methyltransferase [Deferribacter
           desulfuricans SSM1]
 gi|290754737|dbj|BAI81114.1| S-adenosylmethionine-dependent methyltransferase [Deferribacter
           desulfuricans SSM1]
          Length = 226

 Score = 39.3 bits (90), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LP+ ++  D V+MV  + F  DP   + E++R+L  GG+  +   +K     ++      
Sbjct: 103 LPIKNNLFDWVIMVTTICFVNDPLKSILEMYRILKKGGKCAIGFVDKDSPLGKIYQEKKS 162

Query: 149 SGQ------PYSWYQMISLLREANFTLSITSRSLF 177
             +       YS   +I  ++E+NF +    ++L+
Sbjct: 163 KSKFYYEAIFYSTKDVIQFMKESNFKIVKIYQTLY 197


>gi|158335055|ref|YP_001516227.1| type 11 methyltransferase [Acaryochloris marina MBIC11017]
 gi|158305296|gb|ABW26913.1| methyltransferase type 11, putative [Acaryochloris marina
           MBIC11017]
          Length = 321

 Score = 39.3 bits (90), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 75  DQYFSS-TALVSEG-NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           D YFS  T L+ +  +LP  D S+D V++   LE   DP+  + E+ RVL S G +    
Sbjct: 143 DIYFSERTQLICDAHDLPFTDQSIDGVIIQAVLEHVVDPYRCVAEMHRVLKSNGLVYAET 202

Query: 133 P 133
           P
Sbjct: 203 P 203


>gi|116621460|ref|YP_823616.1| type 11 methyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116224622|gb|ABJ83331.1| Methyltransferase type 11 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 333

 Score = 39.3 bits (90), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           LVSE +  LAD   D + M+H LE  EDP   L  + R L   G M++ VP
Sbjct: 174 LVSEMD-QLADREFDYITMLHSLEHVEDPAESLRRMARKLAPSGSMLIEVP 223


>gi|159897650|ref|YP_001543897.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890689|gb|ABX03769.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 293

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 19/109 (17%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG---------MW 139
           +P A++S D +L+   LE   D    LHE+ R+L  GG + + VP+            +W
Sbjct: 102 MPFANNSFDKILLSEVLEHIPDQQAALHELRRILKPGGILAISVPHANYPLWWDPASWIW 161

Query: 140 ARM-----EHTPFGS-----GQPYSWYQMISLLREANFTLSITSRSLFF 178
            R+      HT FGS      + Y   +++  +R A+F +     +  +
Sbjct: 162 TRLGGKPFTHTKFGSIWENHVRLYEPAELVRQVRMADFEVECCEEATHY 210


>gi|323436051|ref|ZP_01050011.2| SAM dependent methyltransferase [Dokdonia donghaensis MED134]
 gi|321496366|gb|EAQ39026.2| SAM dependent methyltransferase [Dokdonia donghaensis MED134]
          Length = 254

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +LP A++S D +   H LE   D    + E++RVL+ GG  I+ +P +
Sbjct: 131 DLPFAENSFDLIFCNHVLEHIPDDTKAMQELYRVLSPGGMAILQIPQE 178


>gi|153009052|ref|YP_001370267.1| type 11 methyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151560940|gb|ABS14438.1| Methyltransferase type 11 [Ochrobactrum anthropi ATCC 49188]
          Length = 341

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 81  TALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNK 135
            A V +G+   LP+   S D V +   L F +DP   + E  R L   GR+++V   P+K
Sbjct: 204 NAQVRQGDVYALPVERESFDLVTIHQVLHFLDDPLAAIREAARALRPNGRLLIVDFAPHK 263

Query: 136 RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT----HKKCILKLW 190
              + R EH     G  +S  QM+  +R+A        ++L   P      +   +KLW
Sbjct: 264 L-EFLREEHAHLRLG--FSDEQMLGWMRDAGLE---PEKTLELEPKAANGEEGLTVKLW 316


>gi|147678905|ref|YP_001213120.1| hypothetical protein PTH_2570 [Pelotomaculum thermopropionicum SI]
 gi|146275002|dbj|BAF60751.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 856

 Score = 39.3 bits (90), Expect = 0.50,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           LPL D+SVD ++  H LE A+D   ++ EI+RV      + +V P
Sbjct: 378 LPLDDNSVDYLVASHSLEHADDIIFIMQEIYRVCKHKALVCIVAP 422


>gi|91200944|emb|CAJ74000.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 189

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           ++  +LP  ++  D V+    +E   +P+ ++ E+ RVL  GG++I+  PN   M+ R+
Sbjct: 79  LNTDDLPYDNALFDDVVCCEVIEHIHNPWKLIAEMKRVLKPGGKLIISTPNISKMYDRI 137


>gi|309791277|ref|ZP_07685808.1| methyltransferase type 11 [Oscillochloris trichoides DG6]
 gi|308226703|gb|EFO80400.1| methyltransferase type 11 [Oscillochloris trichoides DG6]
          Length = 280

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 51/130 (39%), Gaps = 20/130 (15%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSS 80
            D    +LS    ++ G R+L LG  +  F+          A   A   A+ +   Y   
Sbjct: 40  QDERLAMLSGVAGELRGLRVLDLGAGMGGFAV-------AAALRGARVVASEYNPAYCEI 92

Query: 81  TALVSEGN-------------LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
             L +E +             LP AD+S D V+    +E  + P  ML EI RVL   G 
Sbjct: 93  VRLRAERHNLRLPVFNAAGETLPFADASFDVVVAWDVIEHVQSPTAMLREIARVLRPKGH 152

Query: 128 MIVVVPNKRG 137
            ++   N+R 
Sbjct: 153 CLITAINRRA 162


>gi|256423272|ref|YP_003123925.1| methyltransferase type 11 [Chitinophaga pinensis DSM 2588]
 gi|256038180|gb|ACU61724.1| Methyltransferase type 11 [Chitinophaga pinensis DSM 2588]
          Length = 203

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFL---MLHEIWRVLTSGGRMIVVVPNKRGMW 139
           + S  NLP  D++ D ++    L FA+DP     M++ +WRVL  GG +   + +  G+ 
Sbjct: 83  VASAENLPFEDNTFDLIISSAVLHFAQDPAHFQDMIYSMWRVLKPGGYLFARLASDIGIE 142

Query: 140 ARMEHTPFGSGQ 151
            +++    G+G+
Sbjct: 143 TQVQ--DLGNGR 152


>gi|152995729|ref|YP_001340564.1| SAM-dependent methyltransferase [Marinomonas sp. MWYL1]
 gi|150836653|gb|ABR70629.1| SAM-dependent methyltransferase [Marinomonas sp. MWYL1]
          Length = 246

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 67/153 (43%), Gaps = 13/153 (8%)

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           S+T +     LP     VD  +  H L+ +  P   L E  R L   G+++++  N   +
Sbjct: 74  SNTIVARASELPFEADGVDVHVFHHTLDISATPHDDLREAARTLLPSGKLVIIGFNPWSL 133

Query: 139 W------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
           W      ++    P+  G   +  ++   L+ A  TL  + R +F+ P  +    K  S 
Sbjct: 134 WGCRRLFSKKIKAPW-CGHFIAHQRLEDWLKVAGLTLE-SKRFVFYEPPLQSS--KWRSR 189

Query: 193 FEKIGNIFGP---GFAGIYVIEARKILYQGLPI 222
           F  I  I  P    F+G+YV+ A K + + +P+
Sbjct: 190 FAWIDKILRPLKLPFSGVYVMTATKQVRRFIPL 222


>gi|29832399|ref|NP_827033.1| methyltransferase [Streptomyces avermitilis MA-4680]
 gi|29609518|dbj|BAC73568.1| putative methyltransferase [Streptomyces avermitilis MA-4680]
          Length = 248

 Score = 39.3 bits (90), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +TA   EG+   LP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 68  ATATAMEGDALALPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 125


>gi|152978856|ref|YP_001344485.1| methyltransferase type 11 [Actinobacillus succinogenes 130Z]
 gi|150840579|gb|ABR74550.1| Methyltransferase type 11 [Actinobacillus succinogenes 130Z]
          Length = 231

 Score = 39.3 bits (90), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 82  ALVSEGNL---PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           A++ EG+L   P  + +VD  L+ + L F +DP  +L E  R+L+  G +++ + N
Sbjct: 84  AILIEGSLQELPFGEETVDACLLANTLNFTQDPHQLLRETERILSDDGYLLISLFN 139


>gi|159467910|ref|XP_001692134.1| methylase [Chlamydomonas reinhardtii]
 gi|158270258|gb|EDO96144.1| methylase [Chlamydomonas reinhardtii]
          Length = 339

 Score = 39.3 bits (90), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 9/86 (10%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLE-FAEDPFLMLHEIWRVLTSGGRMIVVVPN---KRGMW 139
           V +  +PL  +S+D V+M H  E  + DP   + EI RVL  GG + +  PN    RG+ 
Sbjct: 150 VEQEPIPLPSASIDYVIMFHVFEHLSLDPMFGILEIHRVLRPGGILFLSTPNLGSLRGI- 208

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREA 165
           A+M H       P+S+++ +   R +
Sbjct: 209 AQMLH----GNSPHSYHKFLFRRRHS 230


>gi|311897572|dbj|BAJ29980.1| hypothetical protein KSE_41940 [Kitasatospora setae KM-6054]
          Length = 246

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 53/125 (42%), Gaps = 12/125 (9%)

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFL---MLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V EG +PL D +V+ +   H+LE  + P        E +RVLT GG++I  VP+   M  
Sbjct: 93  VREG-VPLPDGTVELLFNEHFLEHIDYPRSAKGFAAESFRVLTPGGQVITGVPDAAHMLN 151

Query: 141 RMEHTPFGSGQP----YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV-FEK 195
           R    P  S +       WY   S   + N  L + +               LW+  FEK
Sbjct: 152 RY---PAASAEADETIRRWYSKRSCRDDINTYLDLVNYVFRDQDDDPHYTPHLWAYDFEK 208

Query: 196 IGNIF 200
           +  +F
Sbjct: 209 LAQLF 213


>gi|262203151|ref|YP_003274359.1| type 11 methyltransferase [Gordonia bronchialis DSM 43247]
 gi|262086498|gb|ACY22466.1| Methyltransferase type 11 [Gordonia bronchialis DSM 43247]
          Length = 264

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LPLAD+SVD V+    +E   D    + E  RVL  GG +++  PN R  ++    TP 
Sbjct: 104 DLPLADASVDTVVNFQVIEHLWDQPAFITECRRVLRPGGELLISTPN-RITFSPGRDTPL 162

Query: 148 G--SGQPYSWYQMISLLREANFTLS 170
                +  S  ++  LL E  F ++
Sbjct: 163 NPFHTRELSAAELTELLIEGGFAVT 187


>gi|229056950|ref|ZP_04196345.1| O-antigen biosynthesis protein [Bacillus cereus AH603]
 gi|228720339|gb|EEL71913.1| O-antigen biosynthesis protein [Bacillus cereus AH603]
          Length = 232

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 79/208 (37%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWQEVLDIGCSSGALGAAIKENG---ARVSGIEAFPEAAEKAKEKLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           +   +LP      DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IETMDLPYEKEQFDCVIFGDVLEHLFDPWAVIKKVKPYIKENGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKIYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|218248225|ref|YP_002373596.1| type 11 methyltransferase [Cyanothece sp. PCC 8801]
 gi|257060450|ref|YP_003138338.1| methyltransferase type 11 [Cyanothece sp. PCC 8802]
 gi|218168703|gb|ACK67440.1| Methyltransferase type 11 [Cyanothece sp. PCC 8801]
 gi|256590616|gb|ACV01503.1| Methyltransferase type 11 [Cyanothece sp. PCC 8802]
          Length = 268

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 21/107 (19%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI---------VVVPN---- 134
           NLP  D   D V  +  LE   DP   L E++RVL  GG++I         +V P+    
Sbjct: 102 NLPWDDHQFDYVYGIWILEHINDPLPCLKEVYRVLKPGGKIILTETDLKTLLVYPDTPEL 161

Query: 135 ---KRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
               +G+W         +G PY   ++  +L E  F  ++ ++ L F
Sbjct: 162 NYLNQGLWDLF----VKNGNPYIGRRLGQILEEVGFQ-NVENKGLGF 203


>gi|330952812|gb|EGH53072.1| hypothetical protein PSYCIT7_15869 [Pseudomonas syringae Cit 7]
          Length = 253

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 62/157 (39%), Gaps = 5/157 (3%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
            E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  + H
Sbjct: 86  EEQAWPLSEHAADVVVLQHGLDFFLSPHGLLREAASSVRPGGHLLIIGINPWSTWG-IRH 144

Query: 145 T----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
                     +  S  ++   L    F L       + PP          +  E++G   
Sbjct: 145 VFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLERLGEGR 204

Query: 201 GPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                G YV+ ARK++    P+ + ++  I   I +P
Sbjct: 205 QSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMP 241


>gi|318077127|ref|ZP_07984459.1| glycosyl transferase [Streptomyces sp. SA3_actF]
          Length = 739

 Score = 39.3 bits (90), Expect = 0.52,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP
Sbjct: 533 ATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVP 589


>gi|300812675|ref|ZP_07093085.1| methyltransferase domain protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496335|gb|EFK31447.1| methyltransferase domain protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 390

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            +LP AD   D V+  H L + +D   +L E+ RVL  GGR      +KR M
Sbjct: 234 AHLPFADEEFDLVVANHMLFYCDDIPQVLKEVRRVLKKGGRFCASTYSKRHM 285


>gi|318060964|ref|ZP_07979685.1| methyltransferase [Streptomyces sp. SA3_actG]
          Length = 274

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 125


>gi|260462678|ref|ZP_05810884.1| Methyltransferase type 11 [Mesorhizobium opportunistum WSM2075]
 gi|259031584|gb|EEW32854.1| Methyltransferase type 11 [Mesorhizobium opportunistum WSM2075]
          Length = 276

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 53/130 (40%), Gaps = 24/130 (18%)

Query: 25  SKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALV 84
           ++ L+ T+    GCR+ G+  + PF        ERT      GQ       Q    TA  
Sbjct: 80  ARFLAATY----GCRVTGVDLSEPFVDAARYLTERT------GQSG-----QLSFQTASA 124

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI---VVV----PNKRG 137
            E  LP  D   D VL+ H      D   +  EI RVL SGGR     VV+    P+   
Sbjct: 125 LE--LPFDDGRFDIVLLQHVAMNISDRTRLYREIRRVLKSGGRFATFDVVLAGGEPHYPL 182

Query: 138 MWARMEHTPF 147
            WAR   T F
Sbjct: 183 PWARTPATSF 192


>gi|196044339|ref|ZP_03111575.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|225863165|ref|YP_002748543.1| hypothetical protein BCA_1254 [Bacillus cereus 03BB102]
 gi|301052856|ref|YP_003791067.1| methyltransferase [Bacillus anthracis CI]
 gi|196024978|gb|EDX63649.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|225787925|gb|ACO28142.1| conserved hypothetical protein [Bacillus cereus 03BB102]
 gi|300375025|gb|ADK03929.1| methyltransferase, putative [Bacillus cereus biovar anthracis str.
           CI]
          Length = 229

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|158317033|ref|YP_001509541.1| methyltransferase type 12 [Frankia sp. EAN1pec]
 gi|158112438|gb|ABW14635.1| Methyltransferase type 12 [Frankia sp. EAN1pec]
          Length = 625

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 29/70 (41%), Gaps = 3/70 (4%)

Query: 72  NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            W DQ +        G L       D V M HYLE   DP   L     VL  GG +++ 
Sbjct: 438 GWVDQAYRGLLPDLAGTL---SGRYDVVSMFHYLEHTRDPRAELRAAAEVLAPGGHLLIE 494

Query: 132 VPNKRGMWAR 141
           VPN +   AR
Sbjct: 495 VPNAQSPAAR 504


>gi|302338054|ref|YP_003803260.1| methyltransferase type 11 [Spirochaeta smaragdinae DSM 11293]
 gi|301635239|gb|ADK80666.1| Methyltransferase type 11 [Spirochaeta smaragdinae DSM 11293]
          Length = 282

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 5/89 (5%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSG 150
             D +   V   H +E   DP   L E  R+L + G +++  PN  G+ A++    FGSG
Sbjct: 157 FGDQAFQVVHASHLIEHLSDPVAFLQEAHRILDNRGLLVLTTPNSAGLQAKL----FGSG 212

Query: 151 QPYSWYQMISLLREANFTLSITSRSLFFP 179
                   I L    NF L++   + F P
Sbjct: 213 WRSVIPDHIHLFGRKNF-LTLLRSNDFSP 240


>gi|11498123|ref|NP_069348.1| chloroplast inner envelope membrane protein [Archaeoglobus fulgidus
           DSM 4304]
 gi|2650105|gb|AAB90718.1| chloroplast inner envelope membrane protein [Archaeoglobus fulgidus
           DSM 4304]
          Length = 205

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           NLP  D+S D  +    +E+  +P   + E+ RV  SGG+++++ P K
Sbjct: 101 NLPFKDNSFDAAISAGSIEYWPNPQRGIEEMARVTKSGGKVVILAPRK 148


>gi|158318065|ref|YP_001510573.1| hypothetical protein Franean1_6325 [Frankia sp. EAN1pec]
 gi|158113470|gb|ABW15667.1| conserved hypothetical protein [Frankia sp. EAN1pec]
          Length = 403

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 86  EGNLPLADSSVDCVLMVHYLEFAEDP---FLMLHEIWRVLTSGGRMIVVVPNKR 136
              LP  D +V  V + H LE  E P     +L E WR L  GG + V VP+ R
Sbjct: 239 RAGLPFDDGAVTAVYLAHILEHVEYPDEALRVLRECWRALGDGGLLRVAVPDLR 292


>gi|314969790|gb|EFT13888.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL037PA1]
          Length = 291

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 160 LPYADNSFDAVTISYGLRNVEDPQKALREMLRVTKPGGRVVI 201


>gi|297161009|gb|ADI10721.1| methyltransferase [Streptomyces bingchenggensis BCW-1]
          Length = 244

 Score = 39.3 bits (90), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAVTVPR 125


>gi|229195512|ref|ZP_04322280.1| O-antigen biosynthesis protein [Bacillus cereus m1293]
 gi|228588052|gb|EEK46102.1| O-antigen biosynthesis protein [Bacillus cereus m1293]
          Length = 210

 Score = 39.3 bits (90), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 7   KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEQAKEKLDHVVLGD-- 61

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           +   ++P  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 62  IETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAP 121

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 122 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYG 181

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 182 ICKKYR--LGSGFMAETVVFQYIIEAEK 207


>gi|118476788|ref|YP_893939.1| O-antigen biosynthesis protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|229183515|ref|ZP_04310739.1| O-antigen biosynthesis protein [Bacillus cereus BGSC 6E1]
 gi|118416013|gb|ABK84432.1| possible O-antigen biosynthesis protein [Bacillus thuringiensis
           str. Al Hakam]
 gi|228599925|gb|EEK57521.1| O-antigen biosynthesis protein [Bacillus cereus BGSC 6E1]
          Length = 232

 Score = 39.3 bits (90), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|229590111|ref|YP_002872230.1| hypothetical protein PFLU2644 [Pseudomonas fluorescens SBW25]
 gi|229361977|emb|CAY48877.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 260

 Score = 38.9 bits (89), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 63/158 (39%), Gaps = 3/158 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-- 140
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG +++V  N    W   
Sbjct: 88  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIVGINPWSSWGLR 147

Query: 141 -RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI 199
               H      +  S  ++   L    F L       + PP          + +E+    
Sbjct: 148 HAFAHDGLRQARCISPQRVGDWLNLLGFALEKRRFGCYRPPLASTKWQGRLAGWERRAGA 207

Query: 200 FGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           +     G Y++ ARKI+    P+ + +++ +   + +P
Sbjct: 208 WQLAGGGFYLLVARKIVVGLRPVQQVRREPMGKLVPMP 245


>gi|218896248|ref|YP_002444659.1| hypothetical protein BCG9842_B4077 [Bacillus cereus G9842]
 gi|218544281|gb|ACK96675.1| conserved hypothetical protein [Bacillus cereus G9842]
          Length = 229

 Score = 38.9 bits (89), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGTLGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DC+L    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCILFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|163939112|ref|YP_001643996.1| methyltransferase type 12 [Bacillus weihenstephanensis KBAB4]
 gi|163861309|gb|ABY42368.1| Methyltransferase type 12 [Bacillus weihenstephanensis KBAB4]
          Length = 229

 Score = 38.9 bits (89), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 79/208 (37%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWQEVLDIGCSSGALGAAIKENG---ARVSGIEAFPEAAEKAKEKLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           +   +LP      DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IETMDLPYEKEQFDCVIFGDVLEHLFDPWAVIKKVKPYIKENGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKIYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|319780134|ref|YP_004139610.1| methyltransferase type 11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166022|gb|ADV09560.1| Methyltransferase type 11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 272

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 53/130 (40%), Gaps = 24/130 (18%)

Query: 25  SKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALV 84
           ++ L+ T+    GCR+ G+  + PF        ERT      GQ       Q    TA  
Sbjct: 80  ARFLAATY----GCRVTGVDLSEPFVDAARYLTERT------GQSG-----QLSFQTASA 124

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI---VVV----PNKRG 137
            E  LP  D   D VL+ H      D  L+  EI RVL  GGR     VV+    P+   
Sbjct: 125 LE--LPFDDGRFDAVLLQHVAMNISDRTLLYSEIRRVLKPGGRFATYDVVLSGGEPHYPL 182

Query: 138 MWARMEHTPF 147
            WAR   T F
Sbjct: 183 PWARTPATSF 192


>gi|196037603|ref|ZP_03104914.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196031845|gb|EDX70441.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
          Length = 229

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSGGALGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKKNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|159897560|ref|YP_001543807.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890599|gb|ABX03679.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 224

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSG 150
            AD+ +D +   H LE  +D    L E  RVL  GGR+++  P+++      + T    G
Sbjct: 119 FADNVIDYIYSSHLLEDFDDTKAALKEWLRVLKVGGRLVIFCPDEQRFRVHCQKT----G 174

Query: 151 QPYSWYQMISLLREANFTLS 170
           QPY+ +      + A+F+L 
Sbjct: 175 QPYNPHH-----KHAHFSLE 189


>gi|86739992|ref|YP_480392.1| hypothetical protein Francci3_1285 [Frankia sp. CcI3]
 gi|86566854|gb|ABD10663.1| hypothetical protein Francci3_1285 [Frankia sp. CcI3]
          Length = 249

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           D S   VL+ H LE   DP  +L E  R L  GGR++V +PN
Sbjct: 81  DGSHQLVLLSHILEHLADPVPLLVEARRALAPGGRVLVALPN 122


>gi|75759805|ref|ZP_00739882.1| SAM-dependent O-methyltransferase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228899896|ref|ZP_04064140.1| O-antigen biosynthesis protein [Bacillus thuringiensis IBL 4222]
 gi|74492705|gb|EAO55844.1| SAM-dependent O-methyltransferase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228859736|gb|EEN04152.1| O-antigen biosynthesis protein [Bacillus thuringiensis IBL 4222]
          Length = 232

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWKEVLDIGCSSGTLGAAIKENGT---RVSGIEAFPEAAEKAKERLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           + + +LP  +   DC+L    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IEKIDLPYEEGQFDCILFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A + +S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|254784643|ref|YP_003072071.1| SAM-dependent methyltransferase, UbiE family [Teredinibacter
           turnerae T7901]
 gi|237685585|gb|ACR12849.1| SAM-dependent methyltransferase, UbiE family [Teredinibacter
           turnerae T7901]
          Length = 246

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 26/47 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            LPL D+SVD ++    LE   D   ML EI RVL  GG + V VP 
Sbjct: 85  KLPLPDASVDHLICSEVLEHIPDYHAMLREINRVLKPGGTLCVSVPR 131


>gi|269836889|ref|YP_003319117.1| methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
 gi|269786152|gb|ACZ38295.1| Methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
          Length = 327

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 84  VSEGNL---PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V +G+L    L  +SVD VL+ H +E    P   L EI RVL  GG +I+ +PN     A
Sbjct: 149 VRQGDLHTVQLPAASVDAVLLSHVIEHLPSPSATLAEITRVLRPGGALILWLPNAASWAA 208

Query: 141 R 141
           R
Sbjct: 209 R 209


>gi|333027489|ref|ZP_08455553.1| putative methyltransferase [Streptomyces sp. Tu6071]
 gi|332747341|gb|EGJ77782.1| putative methyltransferase [Streptomyces sp. Tu6071]
          Length = 251

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP 
Sbjct: 51  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPR 109


>gi|330503132|ref|YP_004380001.1| hypothetical protein MDS_2218 [Pseudomonas mendocina NK-01]
 gi|328917418|gb|AEB58249.1| hypothetical protein MDS_2218 [Pseudomonas mendocina NK-01]
          Length = 252

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 9/161 (5%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA-R 141
           +  E + PL + + D V++ H L+F+  P  +L E  R +  GG ++V+  +    W  R
Sbjct: 84  VCEEQSWPLGEHAADVVVLQHGLDFSLSPHGLLREAARSVRPGGHLLVLGIHPWSAWGVR 143

Query: 142 MEHTPFGSGQ-----PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
                 G  +     P      +SLL    F L       + PP             E  
Sbjct: 144 RLFAQDGLARARCIAPSRVGDWLSLL---GFALEKRRFGCYRPPLASLAWQMRLRRMESW 200

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           G+ +    AG Y++ ARK++    P+ +S+++ +   + +P
Sbjct: 201 GDAWQLPGAGFYLLVARKLVVGLRPLRQSRREPMGKLLPMP 241


>gi|260596629|ref|YP_003209200.1| hypothetical protein CTU_08370 [Cronobacter turicensis z3032]
 gi|260215806|emb|CBA28255.1| Uncharacterized protein yafS [Cronobacter turicensis z3032]
          Length = 238

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 78  FSSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
               AL  +G+   LP A  SVD  L+ H L +  DP  +L+E  RVL   G +I+   N
Sbjct: 70  LQGDALQVQGDPLHLPFAAKSVDACLLAHTLPWCPDPHRLLNEADRVLIDDGWLIMTGFN 129

Query: 135 KRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
              +    +  P    +     +M +++R+ ++ LS+ +  L +   + +C +  W    
Sbjct: 130 PVSLLGAAKLLPVMRKRAPVNSRMFTMMRQMDW-LSLLNFELLY---YSRCQVLPWC--R 183

Query: 195 KIGNIFG---PGFAGIYVIEARKILYQGLPIT 223
           + G +     P    + V+ ARK   + +P+T
Sbjct: 184 QGGKMLTKHLPALGCLQVMVARK---RTIPLT 212


>gi|229010606|ref|ZP_04167807.1| O-antigen biosynthesis protein [Bacillus mycoides DSM 2048]
 gi|229132114|ref|ZP_04260973.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-ST196]
 gi|229166156|ref|ZP_04293916.1| O-antigen biosynthesis protein [Bacillus cereus AH621]
 gi|228617254|gb|EEK74319.1| O-antigen biosynthesis protein [Bacillus cereus AH621]
 gi|228651334|gb|EEL07310.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-ST196]
 gi|228750650|gb|EEM00475.1| O-antigen biosynthesis protein [Bacillus mycoides DSM 2048]
          Length = 232

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 79/208 (37%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWQEVLDIGCSSGALGAAIKENG---ARVSGIEAFPEAAEKAKEKLDHVILGD-- 83

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           +   +LP      DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 84  IETMDLPYEKEQFDCVIFGDVLEHLFDPWAVIKKVKPYIKENGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 144 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYVDHKIYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 204 ICKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|256830874|ref|YP_003159602.1| type 11 methyltransferase [Desulfomicrobium baculatum DSM 4028]
 gi|256580050|gb|ACU91186.1| Methyltransferase type 11 [Desulfomicrobium baculatum DSM 4028]
          Length = 241

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 7/103 (6%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW--- 139
           L S  +LP  D   D   ++  LEF EDP L L E  RV   G  +++   N+  ++   
Sbjct: 91  LGSAEHLPFEDREFDYASLMTVLEFVEDPGLALREAARVARKG--LLISFLNRTSLYRLS 148

Query: 140 ARME--HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            R+E   +     + +SW +M +L+ +      I +RS+   P
Sbjct: 149 VRLEKKKSALNEARWFSWLEMRALILKNLSPGGIEARSILLGP 191


>gi|21220785|ref|NP_626564.1| methyltransferase [Streptomyces coelicolor A3(2)]
 gi|256788064|ref|ZP_05526495.1| methyltransferase [Streptomyces lividans TK24]
 gi|289771956|ref|ZP_06531334.1| methyltransferase [Streptomyces lividans TK24]
 gi|8250587|emb|CAB93437.1| putative methyltransferase [Streptomyces coelicolor A3(2)]
 gi|289702155|gb|EFD69584.1| methyltransferase [Streptomyces lividans TK24]
          Length = 244

 Score = 38.9 bits (89), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-- 134
           +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP   
Sbjct: 68  ATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRYG 127

Query: 135 -KRGMWARME---HTPFGSGQPYSWYQMISLLREANF 167
            ++  W   +       G  + Y   Q+++ +REA  
Sbjct: 128 PEKVCWTLSDAYHEVEGGHIRIYRADQLLTRIREAGL 164


>gi|242281063|ref|YP_002993192.1| methyltransferase type 12 [Desulfovibrio salexigens DSM 2638]
 gi|242123957|gb|ACS81653.1| Methyltransferase type 12 [Desulfovibrio salexigens DSM 2638]
          Length = 241

 Score = 38.9 bits (89), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 92  ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
            D   D ++    LE  EDP L+L    + L  GGR+ V VPN   M  R+
Sbjct: 98  TDKKYDVIIFGFILEHLEDPVLVLKRFKKFLVDGGRIFVSVPNALSMNRRL 148


>gi|46581418|ref|YP_012226.1| hypothetical protein DVU3015 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450840|gb|AAS97486.1| conserved domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311235075|gb|ADP87929.1| Methyltransferase type 11 [Desulfovibrio vulgaris RCH1]
          Length = 188

 Score = 38.9 bits (89), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
           P  D+  D V M H LE    P   + EIWR+L  GG + + VP+    ++  +H
Sbjct: 39  PFEDARFDLVEMDHVLEHLPSPRDAMREIWRILKPGGTLRLRVPHFSRGFSHYDH 93


>gi|206977676|ref|ZP_03238568.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217958792|ref|YP_002337340.1| hypothetical protein BCAH187_A1370 [Bacillus cereus AH187]
 gi|222094939|ref|YP_002528999.1| o-antigen biosynthesis protein; glycosyltransferase;
           methyltransferase [Bacillus cereus Q1]
 gi|229138004|ref|ZP_04266602.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-ST26]
 gi|206744104|gb|EDZ55519.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217063445|gb|ACJ77695.1| conserved hypothetical protein [Bacillus cereus AH187]
 gi|221238997|gb|ACM11707.1| possible O-antigen biosynthesis protein; possible
           glycosyltransferase; possible methyltransferase
           [Bacillus cereus Q1]
 gi|228645349|gb|EEL01583.1| O-antigen biosynthesis protein [Bacillus cereus BDRD-ST26]
          Length = 229

 Score = 38.9 bits (89), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEQAKEKLDHVVLGD-- 80

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
           +   ++P  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 81  IETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W   E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           + +K     G GF        Y+IEA K
Sbjct: 201 ICKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|320538889|ref|ZP_08038565.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Serratia symbiotica str. Tucson]
 gi|320031049|gb|EFW13052.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Serratia symbiotica str. Tucson]
          Length = 239

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 63/152 (41%), Gaps = 30/152 (19%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM--------WA 140
           LP A  SVD  L+ H L + +D   +L E+ RVL   G +++   N   +        W 
Sbjct: 84  LPFATKSVDACLLAHTLCYTDDTHRLLREVDRVLIDDGWLVISGFNPFSLLGIGKLVPWL 143

Query: 141 RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIF 200
           R  H P+ S +  S  +++  L   N+ +   +R    P  HK             GN F
Sbjct: 144 R-HHQPYAS-RMLSQIRVLDWLSLLNYEVLHQARFHVLPWQHK-------------GNKF 188

Query: 201 ----GPGFAGIYVIEARKILYQGLPITESKKK 228
                P    + VI ARK   + LP+T +  K
Sbjct: 189 LCTHLPALGCMSVIVARK---RTLPLTPTPMK 217


>gi|307132181|ref|YP_003884197.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Dickeya dadantii 3937]
 gi|306529710|gb|ADM99640.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Dickeya dadantii 3937]
          Length = 240

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 49/114 (42%), Gaps = 10/114 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G+     ++  L+  W  + G  LL +G            ++  +  +P     +  P  
Sbjct: 22  GEHYLHTLNTALAPWWSRIFGFHLLKIGR-------LSTAIDSQICTIPHQVNVSREPQ- 73

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             ++  +     LP  + SVD  L+ H L ++ DP  ++ E+ R+L + G +I+
Sbjct: 74  --AAHVMADPYQLPFVEKSVDACLLAHVLAYSADPHRIVREVDRILINDGWVII 125


>gi|220905188|ref|YP_002480500.1| type 11 methyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869487|gb|ACL49822.1| Methyltransferase type 11 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 281

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP+AD+SVD VL    +  + D   + HEI+RVL  GG++ V
Sbjct: 148 LPVADNSVDVVLSNCVINLSPDKAQVWHEIFRVLKPGGKVAV 189


>gi|163787578|ref|ZP_02182025.1| SAM-dependent methyltransferase [Flavobacteriales bacterium ALC-1]
 gi|159877466|gb|EDP71523.1| SAM-dependent methyltransferase [Flavobacteriales bacterium ALC-1]
          Length = 232

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +LP  D+S D +L  H LE   D  + + E++RV+  GG  I  +P 
Sbjct: 109 DLPFEDNSYDVILCNHVLEHIPDDTMAMQELYRVMKPGGYGIFQIPQ 155


>gi|194366383|ref|YP_002028993.1| ArsR family transcriptional regulator [Stenotrophomonas maltophilia
           R551-3]
 gi|194349187|gb|ACF52310.1| transcriptional regulator, ArsR family [Stenotrophomonas
           maltophilia R551-3]
          Length = 309

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V EG+   LP  D S D V+++H L +A  P   + E  RVL  GGR+++         A
Sbjct: 197 VREGDMHALPFKDRSFDLVVLMHALTYASKPAQAVTEAARVLRPGGRLLLC------SLA 250

Query: 141 RMEH 144
           R EH
Sbjct: 251 RHEH 254


>gi|120601407|ref|YP_965807.1| methyltransferase type 11 [Desulfovibrio vulgaris DP4]
 gi|120561636|gb|ABM27380.1| Methyltransferase type 11 [Desulfovibrio vulgaris DP4]
          Length = 194

 Score = 38.9 bits (89), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH 144
           P  D+  D V M H LE    P   + EIWR+L  GG + + VP+    ++  +H
Sbjct: 39  PFEDARFDLVEMDHVLEHLPSPRDAMREIWRILKPGGTLRLRVPHFSRGFSHYDH 93


>gi|30261320|ref|NP_843697.1| hypothetical protein BA_1225 [Bacillus anthracis str. Ames]
 gi|47526490|ref|YP_017839.1| hypothetical protein GBAA_1225 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184152|ref|YP_027404.1| hypothetical protein BAS1132 [Bacillus anthracis str. Sterne]
 gi|65318588|ref|ZP_00391547.1| COG0500: SAM-dependent methyltransferases [Bacillus anthracis str.
           A2012]
 gi|165872832|ref|ZP_02217458.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167636109|ref|ZP_02394414.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|167641219|ref|ZP_02399473.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170686702|ref|ZP_02877922.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170708893|ref|ZP_02899327.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177654457|ref|ZP_02936354.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190569171|ref|ZP_03022069.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196036237|ref|ZP_03103636.1| conserved hypothetical protein [Bacillus cereus W]
 gi|218902411|ref|YP_002450245.1| hypothetical protein BCAH820_1293 [Bacillus cereus AH820]
 gi|227815939|ref|YP_002815948.1| hypothetical protein BAMEG_3365 [Bacillus anthracis str. CDC 684]
 gi|228944922|ref|ZP_04107283.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229604466|ref|YP_002865741.1| hypothetical protein BAA_1301 [Bacillus anthracis str. A0248]
 gi|254682618|ref|ZP_05146479.1| hypothetical protein BantC_02045 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725416|ref|ZP_05187198.1| hypothetical protein BantA1_23636 [Bacillus anthracis str. A1055]
 gi|254734036|ref|ZP_05191750.1| hypothetical protein BantWNA_02538 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254740817|ref|ZP_05198506.1| hypothetical protein BantKB_07307 [Bacillus anthracis str. Kruger
           B]
 gi|254753660|ref|ZP_05205696.1| hypothetical protein BantV_14388 [Bacillus anthracis str. Vollum]
 gi|254758757|ref|ZP_05210784.1| hypothetical protein BantA9_10664 [Bacillus anthracis str.
           Australia 94]
 gi|30255174|gb|AAP25183.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47501638|gb|AAT30314.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178079|gb|AAT53455.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
 gi|164711409|gb|EDR16960.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167510860|gb|EDR86252.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|167528463|gb|EDR91228.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|170126209|gb|EDS95102.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170669225|gb|EDT19968.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172080741|gb|EDT65823.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190559754|gb|EDV13741.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|195991212|gb|EDX55181.1| conserved hypothetical protein [Bacillus cereus W]
 gi|218540189|gb|ACK92587.1| conserved hypothetical protein [Bacillus cereus AH820]
 gi|227004864|gb|ACP14607.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|228814591|gb|EEM60851.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229268874|gb|ACQ50511.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
          Length = 229

 Score = 38.9 bits (89), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 26  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEQAKEKLDHVVLGDIE 82

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
             E  +P  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 83  TME--MPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAP 140

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W+  E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 141 LLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYG 200

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           V +K     G GF        Y+IEA K
Sbjct: 201 VCKKYR--LGSGFMAETVVFQYIIEAEK 226


>gi|312200469|ref|YP_004020530.1| methyltransferase type 11 [Frankia sp. EuI1c]
 gi|311231805|gb|ADP84660.1| Methyltransferase type 11 [Frankia sp. EuI1c]
          Length = 255

 Score = 38.9 bits (89), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
            LP+AD  VD  L VH +    D   ++ E+ RVL  GGR  VV
Sbjct: 89  KLPVADGCVDACLAVHVMHLVGDAPAVVAEVARVLRPGGRFAVV 132


>gi|313124559|ref|YP_004034818.1| transcriptional regulator [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312281122|gb|ADQ61841.1| Predicted transcriptional regulator [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
          Length = 390

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            +LP AD   D V+  H L + +D   +L E+ RVL  GGR      +KR M
Sbjct: 234 AHLPFADGEFDLVVANHMLFYCDDIPQVLKEVRRVLKKGGRFCASTYSKRHM 285


>gi|312140519|ref|YP_004007855.1| sam dependent methyltransferase [Rhodococcus equi 103S]
 gi|325675861|ref|ZP_08155545.1| 3-demethylubiquinone-9 3-O-methyltransferase [Rhodococcus equi ATCC
           33707]
 gi|311889858|emb|CBH49175.1| SAM dependent methyltransferase [Rhodococcus equi 103S]
 gi|325553832|gb|EGD23510.1| 3-demethylubiquinone-9 3-O-methyltransferase [Rhodococcus equi ATCC
           33707]
          Length = 271

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
             LPL D SVD V+    +E   D    L E  RVL  GG ++V  PN R  ++    TP
Sbjct: 112 AELPLPDGSVDTVVNFQVIEHLWDQAQFLRECHRVLAPGGELLVSTPN-RITFSPGRDTP 170

Query: 147 FG--SGQPYSWYQMISLLREANFTLSI 171
                 +  +  ++  LL +A F + +
Sbjct: 171 LNPFHTRELNAAELTELLVDAGFRVEV 197


>gi|294012903|ref|YP_003546363.1| ArsR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292676233|dbj|BAI97751.1| ArsR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 323

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV---VVPNKRGMWARME 143
           G LPL   S D V++   L +A+ P  ++ E  RV  +GGR+++       +  +  R +
Sbjct: 208 GALPLEPGSADTVVLHQVLHYAQAPEAVIEEAARVTAAGGRVLIADFAAHEREELRLRDQ 267

Query: 144 HTPFG--SGQPYSWY 156
           H   G    Q  SW+
Sbjct: 268 HARLGFSDDQIESWF 282


>gi|217077068|ref|YP_002334784.1| methyltransferase domain family [Thermosipho africanus TCF52B]
 gi|217036921|gb|ACJ75443.1| methyltransferase domain family [Thermosipho africanus TCF52B]
          Length = 153

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 8/80 (10%)

Query: 78  FSSTALVSEG---NLPLADSSVDCVL---MVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           F +  L+  G   N+P+ D+  D VL   ++ +    ED    + EI+R+L  GG  +++
Sbjct: 2   FGNQMLLKLGSAVNVPIEDNYCDLVLSLGVIEHYRLKEDLEKSVKEIYRILKPGGIAVIM 61

Query: 132 VPNKR--GMWARMEHTPFGS 149
           VPN+   G+  R+    FG 
Sbjct: 62  VPNRISFGVIDRIIQQIFGK 81


>gi|228926352|ref|ZP_04089424.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228932590|ref|ZP_04095469.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|229120837|ref|ZP_04250079.1| O-antigen biosynthesis protein [Bacillus cereus 95/8201]
 gi|228662497|gb|EEL18095.1| O-antigen biosynthesis protein [Bacillus cereus 95/8201]
 gi|228827059|gb|EEM72814.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228833176|gb|EEM78741.1| O-antigen biosynthesis protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 232

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 80/208 (38%), Gaps = 26/208 (12%)

Query: 26  KVLSTTWDDV--TGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTAL 83
           K +   W +V   GC    LG AI        +V    AF  A + A    D        
Sbjct: 29  KHIKKEWKEVLDIGCSSGALGAAIKENGT---RVSGIEAFPEAAEQAKEKLDHVVLGDIE 85

Query: 84  VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK-------- 135
             E  +P  +   DCV+    LE   DP+ ++ ++   +   G ++  +PN         
Sbjct: 86  TME--MPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKHNGVILASIPNVAHISVLAP 143

Query: 136 --RGMWARMEHTPFGSGQP--YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
              G W+  E+          +++ +M+ +  +A +++S   R       ++  I +L+ 
Sbjct: 144 LLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYG 203

Query: 192 VFEKIGNIFGPGFAG-----IYVIEARK 214
           V +K     G GF        Y+IEA K
Sbjct: 204 VCKKYR--LGSGFMAETVVFQYIIEAEK 229


>gi|21230968|ref|NP_636885.1| transcriptional regulator [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769030|ref|YP_243792.1| transcriptional regulator [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21112587|gb|AAM40809.1| transcriptional regulator [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574362|gb|AAY49772.1| transcriptional regulator [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 350

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 216 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 265


>gi|85058568|ref|YP_454270.1| hypothetical protein SG0590 [Sodalis glossinidius str. 'morsitans']
 gi|84779088|dbj|BAE73865.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 242

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            LP A+ S D  L+ H L +  DP  +L E+ RVL   G +++   N   M
Sbjct: 83  QLPFANKSADVCLLAHTLSYTGDPHRLLREVDRVLIDDGWLVITTFNPVSM 133


>gi|332671019|ref|YP_004454027.1| type 11 methyltransferase [Cellulomonas fimi ATCC 484]
 gi|332340057|gb|AEE46640.1| Methyltransferase type 11 [Cellulomonas fimi ATCC 484]
          Length = 305

 Score = 38.9 bits (89), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
            +PL D+SVD V     +E  ED    + EI RVL  GG  I+  PN 
Sbjct: 96  QIPLDDASVDVVTTFETIEHVEDYRAFVAEIDRVLAPGGVAIISTPND 143


>gi|329894775|ref|ZP_08270576.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC3088]
 gi|328922764|gb|EGG30097.1| Ubiquinone/menaquinone biosynthesis methyltransferase UbiE [gamma
           proteobacterium IMCC3088]
          Length = 250

 Score = 38.9 bits (89), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           LP AD+S DCV +   L    D  L L  + RVL  GGR++V+
Sbjct: 125 LPFADNSFDCVTIAFGLRNVTDKDLALRSMLRVLKPGGRLLVL 167


>gi|326381511|ref|ZP_08203205.1| type 11 methyltransferase [Gordonia neofelifaecis NRRL B-59395]
 gi|326199758|gb|EGD56938.1| type 11 methyltransferase [Gordonia neofelifaecis NRRL B-59395]
          Length = 272

 Score = 38.9 bits (89), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 83  LVSEGNL---PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +V +GNL   PLAD+SVD V+    +E   D    + E  RVL  GG +++  PN+
Sbjct: 92  IVHQGNLIDLPLADASVDVVVNFQVIEHLWDQSAFVAECHRVLRPGGVLLMSTPNR 147


>gi|296270332|ref|YP_003652964.1| type 11 methyltransferase [Thermobispora bispora DSM 43833]
 gi|296093119|gb|ADG89071.1| Methyltransferase type 11 [Thermobispora bispora DSM 43833]
          Length = 233

 Score = 38.9 bits (89), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT 145
           +LPL     D VL +  LE  E+  L + E+ RVL  GG  ++ VP    +W+R +  
Sbjct: 87  DLPLPAEVFDLVLALDVLEHIEEDVLAVREMARVLRPGGTALIAVPCDMRLWSRHDEV 144


>gi|294629085|ref|ZP_06707645.1| methyltransferase type 11 [Streptomyces sp. e14]
 gi|292832418|gb|EFF90767.1| methyltransferase type 11 [Streptomyces sp. e14]
          Length = 224

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 48  ATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 105


>gi|149370816|ref|ZP_01890411.1| SAM-dependent methyltransferase [unidentified eubacterium SCB49]
 gi|149355602|gb|EDM44160.1| SAM-dependent methyltransferase [unidentified eubacterium SCB49]
          Length = 239

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP  ++S D ++  H LE   D    + E++RVL  GG  I+ VP
Sbjct: 115 NLPFKNNSYDFIICNHVLEHIPDDTKAMQELYRVLAPGGTAILQVP 160


>gi|327402229|ref|YP_004343067.1| type 12 methyltransferase [Fluviicola taffensis DSM 16823]
 gi|327317737|gb|AEA42229.1| Methyltransferase type 12 [Fluviicola taffensis DSM 16823]
          Length = 298

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           PA +      D Y     L+ +G         D +L+++ LE   DP L+L ++ +++++
Sbjct: 117 PAMESFVLQGDIYMRIEELIEKG------EQYDVILILNVLEHVIDPVLVLKQLRKLVST 170

Query: 125 GGRMIVVVPN 134
           GG +I++VPN
Sbjct: 171 GGLLIILVPN 180


>gi|289192525|ref|YP_003458466.1| Methyltransferase type 11 [Methanocaldococcus sp. FS406-22]
 gi|288938975|gb|ADC69730.1| Methyltransferase type 11 [Methanocaldococcus sp. FS406-22]
          Length = 225

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           LP  D++ D VL ++ LE   D    L+EI RVL + G +IVVV N+  +
Sbjct: 96  LPFKDNTFDLVLCINVLEHV-DYLKALNEIKRVLKNNGHLIVVVINRDSL 144


>gi|254386875|ref|ZP_05002162.1| methyltransferase [Streptomyces sp. Mg1]
 gi|194345707|gb|EDX26673.1| methyltransferase [Streptomyces sp. Mg1]
          Length = 245

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 79  SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 125


>gi|161621790|ref|YP_056619.2| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes KPA171202]
 gi|315107948|gb|EFT79924.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL030PA1]
 gi|327333116|gb|EGE74843.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL097PA1]
          Length = 252

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 108 LPYADNSFDAVTISYGLRNVEDPHQALREMLRVAKPGGRVVI 149


>gi|53803674|ref|YP_114461.1| hypothetical protein MCA2029 [Methylococcus capsulatus str. Bath]
 gi|53757435|gb|AAU91726.1| conserved domain protein [Methylococcus capsulatus str. Bath]
          Length = 246

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%)

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           Q   +  + +  ++P    SVD V +VH LEF+ +P  +L E  R+L   G + V+  N
Sbjct: 79  QRPPARLIAAPDDIPFDSQSVDLVYLVHVLEFSPEPCRILKECERILKPQGELHVLALN 137


>gi|37523871|ref|NP_927248.1| hypothetical protein gll4302 [Gloeobacter violaceus PCC 7421]
 gi|35214877|dbj|BAC92243.1| gll4302 [Gloeobacter violaceus PCC 7421]
          Length = 335

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           LPL D  VD V+ +  LE    P+++  E +RVL  GG  ++ VP     + + +H+   
Sbjct: 120 LPLRDDCVDTVVSIAVLEHTRFPWVVAQEFYRVLRPGGMGVIAVP-----FLQPQHSSPH 174

Query: 149 SGQPYSWYQMISLLREANFTLSITSRSLFF 178
               ++   ++ L+R A F +  T+    F
Sbjct: 175 DYVRFTESGLVELMRYAGFEVVETAHVHHF 204


>gi|88801090|ref|ZP_01116637.1| putative glycosyltransferase [Reinekea sp. MED297]
 gi|88776169|gb|EAR07397.1| putative glycosyltransferase [Reinekea sp. MED297]
          Length = 273

 Score = 38.9 bits (89), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 5/102 (4%)

Query: 39  RLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST-----ALVSEGNLPLAD 93
           +++ LG    + S F  KV +    +     A  +  + + +       + S   LP +D
Sbjct: 45  KVIDLGCGSGYGSTFITKVSKNYTGVDVSNEAVLYAQERYGNNNTTFMKISSSEPLPFSD 104

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +S D  L    +E  + P   L E  R+L   G +I++ P+K
Sbjct: 105 NSFDTALSFQVIEHVKLPDSYLQEAKRILKPNGTLIIITPDK 146


>gi|206895125|ref|YP_002246375.1| SAM-dependent methyltransferase, UbiE/COQ5 family
           [Coprothermobacter proteolyticus DSM 5265]
 gi|206737742|gb|ACI16820.1| SAM-dependent methyltransferase, UbiE/COQ5 family
           [Coprothermobacter proteolyticus DSM 5265]
          Length = 211

 Score = 38.9 bits (89), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM------ 142
           LP  D S D VLMV  + F  D    L E +RVL  GG +++   +K     +M      
Sbjct: 89  LPFEDGSFDFVLMVTVICFLNDVGKALSEAYRVLKPGGCIVIAFIDKNSPIGKMYEQRKN 148

Query: 143 EHTPFGSGQPYSWYQMISLLREANF 167
           E   +     YS  ++ ++L++A F
Sbjct: 149 EDVFYKEATFYSVEEVSAVLQQAGF 173


>gi|307824634|ref|ZP_07654858.1| Methyltransferase type 11 [Methylobacter tundripaludum SV96]
 gi|307734288|gb|EFO05141.1| Methyltransferase type 11 [Methylobacter tundripaludum SV96]
          Length = 239

 Score = 38.9 bits (89), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 65/145 (44%), Gaps = 21/145 (14%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPF 147
           +LPL  + +D +++ H LEF    F  + EI RVL   G ++++  N   +W R ++  +
Sbjct: 81  SLPLQSNCIDMIIVPHLLEFDAFRFQTMREIERVLKPEGILVILNFNPWSLWIRYQYL-W 139

Query: 148 GSGQPYSW-------YQMISLLREANFTLSITSRSLF--FPPTHKKCILKLWSVFEKIGN 198
                 SW        +++  L+  NF ++++S         TH K I +  S+      
Sbjct: 140 DKKMADSWGGHFISRSRILDWLKLLNFEVTVSSEFNLDTVKSTHGKFITRGHSL------ 193

Query: 199 IFGPGFAGIYVIEARKILYQGLPIT 223
                 +  Y I+A K  Y  +P+T
Sbjct: 194 -----TSTAYAIKAIKRRYNLIPLT 213


>gi|299136482|ref|ZP_07029665.1| Methyltransferase type 11 [Acidobacterium sp. MP5ACTX8]
 gi|298600997|gb|EFI57152.1| Methyltransferase type 11 [Acidobacterium sp. MP5ACTX8]
          Length = 208

 Score = 38.9 bits (89), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDP---FLMLHEIWRVL 122
           A + A   P + F  +A + + N P  D   D V+    L FA+D      M+ E+WRVL
Sbjct: 75  AAELAPQLPAENFQVSA-IEKMNFP--DGFADVVICNSVLHFAQDEAHFLAMVEELWRVL 131

Query: 123 TSGGRMIVVVPNKRGM-WARMEHTPFGSGQPYSWY 156
             GG +   + ++ GM + R+    F  G    W+
Sbjct: 132 RPGGMLFCRLGSRIGMDFERVRKNIFRIGDGSEWF 166


>gi|239980117|ref|ZP_04702641.1| methyltransferase type 11 [Streptomyces albus J1074]
 gi|291451972|ref|ZP_06591362.1| predicted protein [Streptomyces albus J1074]
 gi|291354921|gb|EFE81823.1| predicted protein [Streptomyces albus J1074]
          Length = 269

 Score = 38.9 bits (89), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
            LPLAD ++  VL +H L   ED    + E+ RVL  GG  IV   ++R
Sbjct: 105 QLPLADGALGAVLALHMLYHVEDQAQAVRELGRVLAPGGIAIVSTDSRR 153


>gi|86356784|ref|YP_468676.1| hypothetical protein RHE_CH01142 [Rhizobium etli CFN 42]
 gi|86280886|gb|ABC89949.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 259

 Score = 38.9 bits (89), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 24/46 (52%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           NLP AD S D VL  H LE  +DP     EI RVL      I++ P
Sbjct: 120 NLPYADESFDFVLCSHVLEHVDDPVRATAEIRRVLKPHSIAILMAP 165


>gi|88705023|ref|ZP_01102735.1| ubiE/COQ5 methyltransferase family protein [Congregibacter
           litoralis KT71]
 gi|88700718|gb|EAQ97825.1| ubiE/COQ5 methyltransferase family protein [Congregibacter
           litoralis KT71]
          Length = 262

 Score = 38.9 bits (89), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 70/167 (41%), Gaps = 23/167 (13%)

Query: 41  LGLGYAIPFFSCFHGKVERTLAFMP-------AGQGATN--WPDQYFSSTALVSEGNLPL 91
           +G G  +P++      VER +   P       AG+ A N  +P ++     L  E  +PL
Sbjct: 98  IGTGLNLPYYD--RDNVERLIGLDPSEASWELAGERADNIGFPIEFI---GLPGE-EIPL 151

Query: 92  ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV----VPNKR-GMWARMEHTP 146
            D+SVD ++M + L    DP   L  + RVL  GG +        P++    W      P
Sbjct: 152 EDNSVDTIVMTYSLCTIPDPVTALRGMGRVLRPGGVLHFAEHGRAPDEAVRRWQNRLDRP 211

Query: 147 FG--SGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
           +G  +G  +    +  LL E  F  S    S++ P T +     +W 
Sbjct: 212 WGLIAGGCHLNRDIPRLLSEGGFH-SDDQESMYLPSTPRFAGFNVWG 257


>gi|314986344|gb|EFT30436.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL005PA2]
 gi|314988560|gb|EFT32651.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL005PA3]
 gi|327447764|gb|EGE94418.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL013PA2]
          Length = 276

 Score = 38.9 bits (89), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 145 LPYADNSFDAVTISYGLRNVEDPQKALREMLRVTKPGGRVVI 186


>gi|288963200|ref|YP_003453479.1| hypothetical protein AZL_f01750 [Azospirillum sp. B510]
 gi|288915452|dbj|BAI76935.1| hypothetical protein AZL_f01750 [Azospirillum sp. B510]
          Length = 255

 Score = 38.9 bits (89), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 70  ATNWPDQYFSSTALVSEGNLPLAD----SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A     +Y+    +   GN  LA+       D V+    LE  E P  ML +I R+LT G
Sbjct: 66  AAQEARRYYRDVRVADLGNSELAELLPGRRYDIVICADVLEHLEAPGRMLRQIRRILTPG 125

Query: 126 GRMIVVVPN 134
           GR+ + +P+
Sbjct: 126 GRLFISLPH 134


>gi|330878788|gb|EGH12937.1| hypothetical protein PSYMP_22829 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 253

 Score = 38.9 bits (89), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 62/159 (38%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  +
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWG-V 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGK 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMP 241


>gi|260893001|ref|YP_003239098.1| glycosyl transferase family 2 [Ammonifex degensii KC4]
 gi|260865142|gb|ACX52248.1| glycosyl transferase family 2 [Ammonifex degensii KC4]
          Length = 785

 Score = 38.9 bits (89), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           LP  D   D VL+ H LE   DP+ +L  + R +  GG++I  V N R +
Sbjct: 323 LPFPDGFFDVVLLNHCLEKFADPWTVLSGLKRYVAPGGKVIATVANARNL 372


>gi|209967257|ref|YP_002300172.1| hypothetical protein RC1_4019 [Rhodospirillum centenum SW]
 gi|209960723|gb|ACJ01360.1| hypothetical protein RC1_4019 [Rhodospirillum centenum SW]
          Length = 300

 Score = 38.9 bits (89), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + +  +PD  F    L     LP AD++ D V  V  LE    P L L E  RV   GG 
Sbjct: 114 ENSRRFPDARF--VPLKVPRRLPFADAAFDLVFSVFVLEHVVFPHLFLDECLRVCAPGGL 171

Query: 128 MIVVVPN 134
           +IV+ P+
Sbjct: 172 VIVLCPD 178


>gi|115459018|ref|NP_001053109.1| Os04g0481300 [Oryza sativa Japonica Group]
 gi|38345248|emb|CAD41092.2| OSJNBb0011N17.9 [Oryza sativa Japonica Group]
 gi|90265054|emb|CAH67679.1| H0510A06.4 [Oryza sativa Indica Group]
 gi|113564680|dbj|BAF15023.1| Os04g0481300 [Oryza sativa Japonica Group]
 gi|116309848|emb|CAH66884.1| OSIGBa0158F13.15 [Oryza sativa Indica Group]
 gi|125548746|gb|EAY94568.1| hypothetical protein OsI_16345 [Oryza sativa Indica Group]
 gi|215695074|dbj|BAG90265.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 268

 Score = 38.9 bits (89), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A + A N    YF    L  E  L L  SS+D VL    +++ + P  +  EI+RVL  G
Sbjct: 117 AQELAKNPRLDYFFVKDLNKEQRLELQTSSLDAVLCTVSVQYLQSPEKVFAEIFRVLKPG 176

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMIS 160
           G  IV   N+  M+       +  G  YS  Q+++
Sbjct: 177 GVCIVSFSNR--MFYEKAIGAWREGTAYSRVQLVT 209


>gi|20091239|ref|NP_617314.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Methanosarcina
           acetivorans C2A]
 gi|19916357|gb|AAM05794.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase [Methanosarcina
           acetivorans C2A]
          Length = 222

 Score = 38.9 bits (89), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPF--LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT 145
           NLP  DSS + + M+  LE  + P   L+L E  RVL   GR+ VV         + +H 
Sbjct: 110 NLPFPDSSFNAIFMIFTLELFDTPEIPLVLKECQRVLKKDGRLCVVA-------MKQKHD 162

Query: 146 PFGSGQPYSW 155
           P    + Y W
Sbjct: 163 PTPMLKLYEW 172


>gi|21242312|ref|NP_641894.1| transcriptional regulator [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21107743|gb|AAM36430.1| transcriptional regulator [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 331

 Score = 38.9 bits (89), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|313773324|gb|EFS39290.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL074PA1]
 gi|313793522|gb|EFS41565.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL110PA1]
 gi|313802875|gb|EFS44088.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL110PA2]
 gi|313810773|gb|EFS48487.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL083PA1]
 gi|313814982|gb|EFS52696.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL059PA1]
 gi|313829376|gb|EFS67090.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL063PA2]
 gi|313831084|gb|EFS68798.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL007PA1]
 gi|313833214|gb|EFS70928.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL056PA1]
 gi|313838143|gb|EFS75857.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL086PA1]
 gi|314916732|gb|EFS80563.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL005PA4]
 gi|314930350|gb|EFS94181.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL067PA1]
 gi|314956133|gb|EFT00529.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL027PA1]
 gi|314959666|gb|EFT03768.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL002PA1]
 gi|314963246|gb|EFT07346.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL082PA1]
 gi|314973932|gb|EFT18028.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL053PA1]
 gi|314976860|gb|EFT20955.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL045PA1]
 gi|314984982|gb|EFT29074.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL005PA1]
 gi|315079677|gb|EFT51665.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL053PA2]
 gi|315081005|gb|EFT52981.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL078PA1]
 gi|315097683|gb|EFT69659.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL038PA1]
 gi|315098110|gb|EFT70086.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL059PA2]
 gi|327330849|gb|EGE72594.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL096PA2]
 gi|327442858|gb|EGE89512.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL043PA2]
 gi|327445250|gb|EGE91904.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL043PA1]
 gi|327452278|gb|EGE98932.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL083PA2]
 gi|327452495|gb|EGE99149.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL092PA1]
 gi|328752317|gb|EGF65933.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL025PA2]
 gi|328761539|gb|EGF75057.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL099PA1]
          Length = 275

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 144 LPYADNSFDAVTISYGLRNVEDPQKALREMLRVTKPGGRVVI 185


>gi|239931572|ref|ZP_04688525.1| glycosyl transferase [Streptomyces ghanaensis ATCC 14672]
          Length = 731

 Score = 38.9 bits (89), Expect = 0.69,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
           +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP
Sbjct: 551 ATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVP 607


>gi|323135542|ref|ZP_08070625.1| Methyltransferase type 11 [Methylocystis sp. ATCC 49242]
 gi|322398633|gb|EFY01152.1| Methyltransferase type 11 [Methylocystis sp. ATCC 49242]
          Length = 393

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%)

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            Y ++  +     LP  DSS D V+ +  LE  +DPF    EI RVL  G  +   VP
Sbjct: 206 DYPTTDVIGVADRLPFKDSSFDGVISIAVLEHVKDPFKCAREIARVLKPGAWLKCCVP 263


>gi|313763278|gb|EFS34642.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL013PA1]
 gi|314919142|gb|EFS82973.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL050PA1]
 gi|314921222|gb|EFS85053.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL050PA3]
 gi|327451625|gb|EGE98279.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL087PA3]
 gi|328757003|gb|EGF70619.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL087PA1]
          Length = 275

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 144 LPYADNSFDAVTISYGLRNVEDPQKALREMLRVTKPGGRVVI 185


>gi|260836693|ref|XP_002613340.1| hypothetical protein BRAFLDRAFT_68307 [Branchiostoma floridae]
 gi|229298725|gb|EEN69349.1| hypothetical protein BRAFLDRAFT_68307 [Branchiostoma floridae]
          Length = 1244

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 3/62 (4%)

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT---PFGS 149
           D+    +  VH L + ED    L  +W  L  GG M+V + + +G W  + H     FG 
Sbjct: 140 DTKFHLIHAVHVLYYVEDLDATLRNLWEQLGDGGYMLVAIQSDKGGWGGLRHKLWEKFGQ 199

Query: 150 GQ 151
           G 
Sbjct: 200 GD 201


>gi|209527307|ref|ZP_03275816.1| Methyltransferase type 11 [Arthrospira maxima CS-328]
 gi|209492233|gb|EDZ92579.1| Methyltransferase type 11 [Arthrospira maxima CS-328]
          Length = 924

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP--NKRGMWARMEHT 145
           N P  DSSVD +     +E   D    ++EIWRV  +G  + + VP  + RG +    H 
Sbjct: 36  NFPFNDSSVDELRAYDIIEHLPDRINTMNEIWRVCKAGATVDISVPSTDGRGAFQDPTHI 95

Query: 146 PFGSGQPYSWY 156
            F +   + +Y
Sbjct: 96  SFWNINSFFYY 106


>gi|188992154|ref|YP_001904164.1| putative methyltransferase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167733914|emb|CAP52120.1| putative methyltransferase [Xanthomonas campestris pv. campestris]
          Length = 331

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|325285538|ref|YP_004261328.1| Methyltransferase type 11 [Cellulophaga lytica DSM 7489]
 gi|324320992|gb|ADY28457.1| Methyltransferase type 11 [Cellulophaga lytica DSM 7489]
          Length = 254

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           NLP  D+S D +L  H LE   D    + E++RVL  GG  +  +P 
Sbjct: 131 NLPFKDNSYDVILCNHVLEHIPDDTKAMQEMYRVLKPGGWGVFQIPQ 177


>gi|315108814|gb|EFT80790.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL030PA2]
          Length = 275

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 144 LPYADNSFDAVTISYGLRNVEDPQKALREMLRVTKPGGRVVI 185


>gi|302561208|ref|ZP_07313550.1| SAM-dependent methyltransferase [Streptomyces griseoflavus Tu4000]
 gi|302478826|gb|EFL41919.1| SAM-dependent methyltransferase [Streptomyces griseoflavus Tu4000]
          Length = 281

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 87  GNLPLADSSVDCVLMVH-YLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           G LP AD S D     +  L F  DP L+L E+ RVL  GGR++  V
Sbjct: 136 GALPFADGSFDLACSAYGALPFVADPRLVLREVRRVLRPGGRLVFSV 182


>gi|206890019|ref|YP_002249648.1| SAM-dependent methyltransferase, UbiE/COQ5 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741957|gb|ACI21014.1| SAM-dependent methyltransferase, UbiE/COQ5 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 216

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            LP  D    CV+++  L F +DP L L E  RVL   G++I+
Sbjct: 89  ELPFRDKVFSCVMLIVTLCFVKDPLLALKEAKRVLKEEGKVII 131


>gi|162449267|ref|YP_001611634.1| putative SAM-dependent methyltransferse [Sorangium cellulosum 'So
           ce 56']
 gi|161159849|emb|CAN91154.1| putative SAM-dependent methyltransferse [Sorangium cellulosum 'So
           ce 56']
          Length = 337

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           LPL D+SVD       L    DP  +L E+ RVL  GG ++ V PN 
Sbjct: 132 LPLPDASVDLATCQTVLMHVADPLRVLREMRRVLRPGGLLLAVEPNN 178


>gi|148261387|ref|YP_001235514.1| methyltransferase type 11 [Acidiphilium cryptum JF-5]
 gi|326404876|ref|YP_004284958.1| putative methyltransferase [Acidiphilium multivorum AIU301]
 gi|146403068|gb|ABQ31595.1| Methyltransferase type 11 [Acidiphilium cryptum JF-5]
 gi|325051738|dbj|BAJ82076.1| putative methyltransferase [Acidiphilium multivorum AIU301]
          Length = 208

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           D+S D V   H LE   DP + L    RVL  GG M+V+VP++
Sbjct: 67  DASFDFVHSSHCLEHMRDPLVALRNWLRVLKPGGHMVVLVPDE 109


>gi|313813668|gb|EFS51382.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Propionibacterium acnes HL025PA1]
          Length = 275

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LP AD+S D V + + L   EDP   L E+ RV   GGR+++
Sbjct: 144 LPYADNSFDAVTISYGLRNVEDPQKALREMLRVTKPGGRVVI 185


>gi|302560881|ref|ZP_07313223.1| methyltransferase type 11 [Streptomyces griseoflavus Tu4000]
 gi|302478499|gb|EFL41592.1| methyltransferase type 11 [Streptomyces griseoflavus Tu4000]
          Length = 209

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +TA   EG+   LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP 
Sbjct: 31  ATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPR 88


>gi|222086227|ref|YP_002544759.1| methyltransferase protein [Agrobacterium radiobacter K84]
 gi|221723675|gb|ACM26831.1| methyltransferase protein [Agrobacterium radiobacter K84]
          Length = 265

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 43/101 (42%), Gaps = 16/101 (15%)

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           DQ   +TAL      P  D S D V+ +H L    D  L + E++RVL  GG  + V  N
Sbjct: 102 DQQADATAL------PFEDGSFDAVIAMHMLYHIRDQSLAIAEMYRVLKPGG-FLAVTTN 154

Query: 135 KRGMWARMEH--TPFGSGQPYS------WYQMISLLREANF 167
             G   +M    T FGS  PY        Y     L +A F
Sbjct: 155 GAGNMRKMYELTTVFGS-PPYDPAGAAFGYDTAERLMQAQF 194


>gi|166711521|ref|ZP_02242728.1| transcriptional regulator [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 331

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|118588635|ref|ZP_01546043.1| putative transcriptional regulatory protein [Stappia aggregata IAM
           12614]
 gi|118438621|gb|EAV45254.1| putative transcriptional regulatory protein [Stappia aggregata IAM
           12614]
          Length = 219

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           +LP  D + D VL++H L   EDP   L E  RVL  GG++ V
Sbjct: 62  DLPHPDETFDAVLLLHVLYHVEDPRTALREAKRVLRPGGQVFV 104


>gi|58581698|ref|YP_200714.1| transcriptional regulator [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84623613|ref|YP_450985.1| transcriptional regulator [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188577059|ref|YP_001913988.1| transcriptional regulator [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58426292|gb|AAW75329.1| transcriptional regulator [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84367553|dbj|BAE68711.1| transcriptional regulator [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188521511|gb|ACD59456.1| transcriptional regulator [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 331

 Score = 38.9 bits (89), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|330959400|gb|EGH59660.1| hypothetical protein PMA4326_12694 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 256

 Score = 38.5 bits (88), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 63/159 (39%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  +
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSTWG-V 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E +G+
Sbjct: 143 RHVFARDALRKARCISPSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGD 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPSGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMP 241


>gi|319787395|ref|YP_004146870.1| ArsR family transcriptional regulator [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465907|gb|ADV27639.1| transcriptional regulator, ArsR family [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 309

 Score = 38.5 bits (88), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
           V EG+   LP    S D V+++H L +AE P + + E  RVL  GGR+++         A
Sbjct: 197 VREGDMHALPFGPGSFDLVVLMHALTYAERPAVAVAEGARVLRKGGRLLLT------SLA 250

Query: 141 RMEH 144
           R EH
Sbjct: 251 RHEH 254


>gi|294498732|ref|YP_003562432.1| methyltransferase [Bacillus megaterium QM B1551]
 gi|294348669|gb|ADE68998.1| methyltransferase [Bacillus megaterium QM B1551]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 28/42 (66%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           LPL+  SV+ V++++ LE+ E P L L E++RV+  GG   V
Sbjct: 104 LPLSSESVEGVMVINALEWTEHPRLALKELYRVVKPGGYACV 145


>gi|302672227|ref|YP_003832187.1| MerR family transcriptional regulator/SAM-dependent
           methyltransferase [Butyrivibrio proteoclasticus B316]
 gi|302396700|gb|ADL35605.1| transcriptional regulator MerR family/SAM-dependent
           methyltransferase [Butyrivibrio proteoclasticus B316]
          Length = 406

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           +P  D+S D V+  H L + ED  L   EI RVL  GGR++
Sbjct: 252 IPFEDNSFDLVIAGHVLFYCEDVHLACQEISRVLKPGGRLV 292


>gi|169236941|ref|YP_001690141.1| methyltransferase ( 24-sterol C-methyltransferase) [Halobacterium
           salinarum R1]
 gi|167728007|emb|CAP14795.1| putative methyltransferase (homolog to 24-sterol
           C-methyltransferase) [Halobacterium salinarum R1]
          Length = 225

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%)

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
           G+LP AD ++D V       +A DP   L EI RVL SGG
Sbjct: 94  GSLPFADDAIDHVFSFEAFYYASDPRETLAEIRRVLKSGG 133


>gi|197117500|ref|YP_002137927.1| type 12 SAM-dependent methyltransferase [Geobacter bemidjiensis
           Bem]
 gi|197086860|gb|ACH38131.1| SAM-dependent methyltransferase, type 12 [Geobacter bemidjiensis
           Bem]
          Length = 310

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%)

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  DC+ M H LE   D   ML ++  +L   GR+IV VP+  G+ AR+
Sbjct: 138 AQFDCITMWHTLEHMRDIPSMLAQVAGLLKPKGRLIVAVPDFGGLQARL 186


>gi|294665599|ref|ZP_06730879.1| transcriptional regulator [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292604648|gb|EFF48019.1| transcriptional regulator [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 331

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|222149161|ref|YP_002550118.1| transcriptional regulator ArsR family [Agrobacterium vitis S4]
 gi|221736146|gb|ACM37109.1| transcriptional regulator ArsR family [Agrobacterium vitis S4]
          Length = 341

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 75  DQYFSSTALVSEG---NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           D+   + A V +G   NLPL     D V++   L F  +P L L+E  R+L  GGR++++
Sbjct: 203 DKAGVAKAAVRQGDILNLPLDGGEFDVVIIHQVLHFLVEPELALNEAARMLKPGGRLVII 262

Query: 132 --VPNK 135
              P+K
Sbjct: 263 DLAPHK 268


>gi|83309531|ref|YP_419795.1| SAM-dependent methyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82944372|dbj|BAE49236.1| SAM-dependent methyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 330

 Score = 38.5 bits (88), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 80  STALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           S  +V +G+   +PL  ++ D V +   L +A DP  ++ E  RVL  GGR+ VV
Sbjct: 207 SNCMVRQGDIAQMPLPAATADAVTIHQVLHYATDPAALVAEAARVLEPGGRLAVV 261


>gi|213968847|ref|ZP_03396988.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301384107|ref|ZP_07232525.1| hypothetical protein PsyrptM_15790 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059181|ref|ZP_07250722.1| hypothetical protein PsyrptK_04267 [Pseudomonas syringae pv. tomato
           K40]
 gi|302135019|ref|ZP_07261009.1| hypothetical protein PsyrptN_26756 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213926450|gb|EEB60004.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 253

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 62/159 (38%), Gaps = 5/159 (3%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           +  E   PL++ + D V++ H L+F   P  +L E    +  GG ++++  N    W  +
Sbjct: 84  VCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHLLIIGINPWSAWG-V 142

Query: 143 EHT----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
            H          +  S  ++   L    F L       + PP          +  E +G 
Sbjct: 143 RHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAAWQSRLAGLESLGE 202

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
                  G Y++ ARK++    P+ + ++  I   I +P
Sbjct: 203 GRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMP 241


>gi|220910103|ref|YP_002485414.1| hypothetical protein Cyan7425_4748 [Cyanothece sp. PCC 7425]
 gi|219866714|gb|ACL47053.1| Methyltransferase type 11 [Cyanothece sp. PCC 7425]
          Length = 273

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 56  KVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
           + +  L +  A     N P ++ S+ A     +LP AD++ D   +   L+   DP   +
Sbjct: 83  RSQAILNYAIAQATGLNLPLEFVSADA----QSLPFADNTFDRARVDRTLQHIADPQKAI 138

Query: 116 HEIWRVLTSGGRMIVVVPN 134
           HEI RVL  GG ++ + P+
Sbjct: 139 HEIARVLRPGGYLVAMEPD 157


>gi|78047160|ref|YP_363335.1| ArsR family transcriptional regulator [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035590|emb|CAJ23257.1| putative transcriptional regulator, ArsR family [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 331

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|325928315|ref|ZP_08189515.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Xanthomonas perforans 91-118]
 gi|325541326|gb|EGD12868.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Xanthomonas perforans 91-118]
          Length = 331

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|294624409|ref|ZP_06703100.1| transcriptional regulator [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292601293|gb|EFF45339.1| transcriptional regulator [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 331

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|291460799|ref|ZP_06600189.1| phosphatidylethanolamine N-methyltransferase [Oribacterium sp. oral
           taxon 078 str. F0262]
 gi|291416603|gb|EFE90322.1| phosphatidylethanolamine N-methyltransferase [Oribacterium sp. oral
           taxon 078 str. F0262]
          Length = 200

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           A+    +LP  D S D V++ + L    DP  +L EI RVL  GG  +++ PN
Sbjct: 86  AVADAQSLPYRDRSFDVVIIANALHLVPDPERVLREIARVLRPGG--LLIAPN 136


>gi|13475774|ref|NP_107341.1| sarcosine-dimethylglycine methyltransferase [Mesorhizobium loti
           MAFF303099]
 gi|14026530|dbj|BAB53127.1| sarcosine-dimethylglycine methyltransferase [Mesorhizobium loti
           MAFF303099]
          Length = 217

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 52/130 (40%), Gaps = 24/130 (18%)

Query: 25  SKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALV 84
           ++ L+ T+    GCR+ G+  + PF        ERT      GQG          S   V
Sbjct: 21  ARFLAATY----GCRVTGVDLSEPFVDAARYLTERT------GQGGQ-------LSFQTV 63

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI---VVV----PNKRG 137
           S   LP  D   D  L+ H      D   +  EI RVL SGGR     VV+    P+   
Sbjct: 64  SALELPFEDGHFDIALLQHVAMNIFDRGRLYREIRRVLKSGGRFATFDVVLRDGQPHYPL 123

Query: 138 MWARMEHTPF 147
            WAR   T F
Sbjct: 124 PWARTPATSF 133


>gi|152975380|ref|YP_001374897.1| methyltransferase type 11 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152024132|gb|ABS21902.1| Methyltransferase type 11 [Bacillus cytotoxicus NVH 391-98]
          Length = 225

 Score = 38.5 bits (88), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVV 132
           LP  +     ++ ++ LE+ EDP   LHEI R+L SGG   + +
Sbjct: 104 LPFENERFSAIVAINSLEWTEDPLQSLHEIKRILYSGGYACIAL 147


>gi|302554697|ref|ZP_07307039.1| methyltransferase type 11 [Streptomyces viridochromogenes DSM
           40736]
 gi|302472315|gb|EFL35408.1| methyltransferase type 11 [Streptomyces viridochromogenes DSM
           40736]
          Length = 254

 Score = 38.5 bits (88), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN-KRGMWAR 141
           L   G LP  D  VD V+    L+   D    L E+ RVL  GG + V++P+ K G    
Sbjct: 142 LADAGRLPFDDGCVDGVVSTAVLQLVADRAAALAEMVRVLRPGGVLTVMIPSTKHGPAKL 201

Query: 142 MEHTPFG 148
           M   P G
Sbjct: 202 MSALPGG 208


>gi|15668819|ref|NP_247622.1| hypothetical protein MJ_0638 [Methanocaldococcus jannaschii DSM
           2661]
 gi|2496089|sp|Q58055|Y638_METJA RecName: Full=Uncharacterized protein MJ0638
 gi|1499447|gb|AAB98634.1| hypothetical protein MJ_0638 [Methanocaldococcus jannaschii DSM
           2661]
          Length = 225

 Score = 38.5 bits (88), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
           LP  D++ D VL ++ LE   +    L+EI R+L + G++IVVV NK  +
Sbjct: 96  LPFKDNTFDLVLCINVLEHV-NYLKALNEIRRILKNKGKLIVVVVNKDSL 144


>gi|147669863|ref|YP_001214681.1| methyltransferase type 11 [Dehalococcoides sp. BAV1]
 gi|146270811|gb|ABQ17803.1| Methyltransferase type 11 [Dehalococcoides sp. BAV1]
          Length = 206

 Score = 38.5 bits (88), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 81  TALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
           + L ++GN LPL + SVD      +L  AEDP  +++E+ R+L   GR+++ 
Sbjct: 86  SCLQADGNALPLKNQSVDYSFANMFLHHAEDPAGVINEMSRILLPDGRLVIT 137


>gi|325921334|ref|ZP_08183192.1| transcriptional regulator [Xanthomonas gardneri ATCC 19865]
 gi|325548192|gb|EGD19188.1| transcriptional regulator [Xanthomonas gardneri ATCC 19865]
          Length = 331

 Score = 38.5 bits (88), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 84  VSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           V EG+   LP  D+S D V+++H L +A  P   + E  RVL  GGR+++
Sbjct: 197 VREGDMHALPFPDASFDLVVLMHALTYAAKPAQAVAESARVLRPGGRLLL 246


>gi|269926413|ref|YP_003323036.1| Methyltransferase type 11 [Thermobaculum terrenum ATCC BAA-798]
 gi|269790073|gb|ACZ42214.1| Methyltransferase type 11 [Thermobaculum terrenum ATCC BAA-798]
          Length = 223

 Score = 38.5 bits (88), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           ++ LAD+SVD  + +  LEF   P +++ E+ R++   GR+++ V N    WA +
Sbjct: 97  HMALADNSVDAAVAITVLEFVSYPEIVISEMKRIVRPHGRIVLGVLNALSPWAAL 151


>gi|76802530|ref|YP_327538.1| S-adenosylmethionine-dependent methyltransferase 3 [Natronomonas
           pharaonis DSM 21