PSIBLAST alignment of GI: 254780582 and protein with PDB id: 2avn

>gi|82407927|pdb|2AVN|A Chain A, Crystal Structure Of A UbiquinoneMENAQUINONE BIOSYNTHESIS Methyltransferase-Related Protein (Tm1389) From Thermotoga Maritima Msb8 At 2.35 A Resolution Length = 260
>gi|82407928|pdb|2AVN|B Chain B, Crystal Structure Of A UbiquinoneMENAQUINONE BIOSYNTHESIS Methyltransferase-Related Protein (Tm1389) From Thermotoga Maritima Msb8 At 2.35 A Resolution Length = 260
 Score = 68.2 bits (165), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 44/130 (33%), Gaps = 4/130 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF- 63
                  Y +   K     I   L     +   CR+L LG     +S F  +    +   
Sbjct: 25  ARAYDSXYETPKWKLYHRLIGSFLEEYLKN--PCRVLDLGGGTGKWSLFLQERGFEVVLV 82

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMV-HYLEFAEDPFLMLHEIWRVL 122
            P+ +      ++   +       +LP    + + VL +   L + E+      EI RVL
Sbjct: 83  DPSKEXLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVL 142

Query: 123 TSGGRMIVVV 132
              G +I  V
Sbjct: 143 VPDGLLIATV 152