PSIBLAST alignment of GI: 254780582 and protein with PDB id: 3mgg

>gi|294979860|pdb|3MGG|A Chain A, Crystal Structure Of Methyl Transferase From Methanosarcina Mazei Length = 276
>gi|294979861|pdb|3MGG|B Chain B, Crystal Structure Of Methyl Transferase From Methanosarcina Mazei Length = 276
 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 51/179 (28%), Gaps = 26/179 (14%)

Query: 21  TDAISKVLSTTWDDV----TGCRLLGLGYAIPFFSCFHGKVER---TLAFMPAGQGATNW 73
               ++ L            G ++L  G  I   +    K        +   + +     
Sbjct: 18  LSEQAETLEKLLHHDTVYPPGAKVLEAGCGIGAQTVILAKNNPDAEITSIDISPESLEKA 77

Query: 74  PDQ------YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
            +               +  +LP  DSS D + +   LE  + P   L  + +VL  GG 
Sbjct: 78  RENTEKNGIKNVKFLQANIFSLPFEDSSFDHIFVCFVLEHLQSPEEALKSLKKVLKPGGT 137

Query: 128 MIVVVPNKRG-------------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           + V+  +                    +    +  G      Q+  LL+E+ F      
Sbjct: 138 ITVIEGDHGSCYFHPEGKKAIEAWNCLIRVQAYXKGNSLVGRQIYPLLQESGFEKIRVE 196