BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780582|ref|YP_003064995.1| Methyltransferase type 11
[Candidatus Liberibacter asiaticus str. psy62]
         (242 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|304394184|ref|ZP_07376107.1| ATP synthase subunits region ORF 4 [Ahrensia sp. R2A130]
 gi|303293624|gb|EFL88001.1| ATP synthase subunits region ORF 4 [Ahrensia sp. R2A130]
          Length = 269

 Score =  211 bits (536), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 115/242 (47%), Positives = 160/242 (66%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M++DIV+LRQFY++ LG     ++   L++ W  +T  RL+GLGYA P+   F    ERT
Sbjct: 1   MQMDIVDLRQFYATPLGAMARRSVQLALTSLWKPLTSERLVGLGYATPWLDAFRADAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MPA QGA +WP     +TALV + +LPLAD+S+D +L+VH LE  E+    L EIWR
Sbjct: 61  LALMPARQGAVHWPFGEDCATALVFDEDLPLADASIDRMLLVHALEHFENVDEALSEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GG++I+VVPN+RG+WARMEHTP+GSG+P+S  Q+  LLR   FT +  S +L FPP
Sbjct: 121 VLAPGGKLIIVVPNRRGVWARMEHTPYGSGRPWSGGQLSKLLRSHMFTPTSWSDALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + KK   +     E+ G  F P FAG+ V+EA K +YQGLP+ + + + +  P+L P   
Sbjct: 181 SSKKLASRFAPTMERFGRRFVPAFAGVLVVEATKQVYQGLPVRQRQSRRVFVPVLAPQGA 240

Query: 241 ST 242
           S+
Sbjct: 241 SS 242


>gi|159185822|ref|NP_356998.2| hypothetical protein Atu3613 [Agrobacterium tumefaciens str. C58]
 gi|159140956|gb|AAK89783.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 253

 Score =  209 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 133/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR+FY S LG+    AI+  LST W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MNTDIVDLREFYHSPLGRSAEQAITMALSTLWPPLPEERLVGLGYAVPFLERFRHDTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL DSS+D VLMVH LEFAE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPAGELSSTALVFDEELPLPDSSIDRVLMVHALEFAENPRESLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   ++ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T  + +LK     E+ G    P F+G+ V+EA+K LYQGLP+T+   + +  P+L P  V
Sbjct: 181 TTSRPVLKFRRYLERTGRRLWPLFSGVIVVEAQKRLYQGLPVTQRASRRVFVPVLAPQGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|332716403|ref|YP_004443869.1| methyltransferase [Agrobacterium sp. H13-3]
 gi|325063088|gb|ADY66778.1| methyltransferase [Agrobacterium sp. H13-3]
          Length = 253

 Score =  208 bits (530), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 132/242 (54%), Positives = 166/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR+FY S LG+    AI+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MNTDIVDLREFYHSPLGRSAEQAITMALSSLWPPLPEERLVGLGYAVPFLERFRHDTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL DSS+D VLMVH LEFAE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPAGELSSTALVFDEELPLPDSSIDRVLMVHALEFAENPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   ++ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T  + +LK     E  G    P F+G+ V+EA+K LYQGLP+T+   + +  P+L P  V
Sbjct: 181 TTSRPVLKFRRYLELTGRRLWPLFSGVIVVEAQKRLYQGLPVTQRASRRVFVPVLAPQGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|222149970|ref|YP_002550927.1| hypothetical protein Avi_4035 [Agrobacterium vitis S4]
 gi|221736952|gb|ACM37915.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 253

 Score =  204 bits (518), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 130/242 (53%), Positives = 170/242 (70%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VDIV+LRQFY + LG     +I+  LS+ W  +   RL+GLGY++P+   F    ERT
Sbjct: 1   MHVDIVDLRQFYHTMLGHAAEQSITMALSSLWARLPEERLVGLGYSVPYLDRFRADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+T+LV +  LPL DSS+D VLMVH LEFAE+P   L EIWR
Sbjct: 61  FAFMPAGQGAVNWPPGELSATSLVFDEELPLPDSSIDRVLMVHSLEFAENPRETLKEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   ++ +LFFPP
Sbjct: 121 VLAPGGRLVMVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASTEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + +LK+ S FE+ G +  P FAG+ V+EA+K LYQGLP+     + + +P+L P  V
Sbjct: 181 SKLRTMLKMHSAFERFGRMLSPAFAGVIVVEAQKRLYQGLPVAMRASRRVFAPVLSPQGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|153008329|ref|YP_001369544.1| type 11 methyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151560217|gb|ABS13715.1| Methyltransferase type 11 [Ochrobactrum anthropi ATCC 49188]
          Length = 259

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 119/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     AI   L+  W  V G RL+G+GY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAIRMALAGLWGHVPGERLVGMGYSLPYLDRFSADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    ++TALV +  LPL DSS+D VLMVH LE+AE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSVEKTATALVFDEELPLPDSSIDRVLMVHALEYAENPTETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLTTLLREANFTVSTVSDALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P F+G+ V+EA+K LYQGLP+ +   + +  P+L P   
Sbjct: 181 ATRRWMMRPCLALEGMGRRLWPVFSGVLVVEAQKRLYQGLPVAQRSSRRVFVPVLAPQGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|239832990|ref|ZP_04681319.1| Methyltransferase domain protein [Ochrobactrum intermedium LMG
           3301]
 gi|239825257|gb|EEQ96825.1| Methyltransferase domain protein [Ochrobactrum intermedium LMG
           3301]
          Length = 262

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     AI   L+  WD V G RL+G+GY++P+   F    ERT
Sbjct: 4   MHPDIIELRSFYDTTLGHLAERAIRMALAGLWDRVPGERLVGMGYSLPYLDRFSADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP     +TALV +  LPL DSS+D VLMVH LE+AE+P   L E+WR
Sbjct: 64  FAFMPAGQGAVAWPSVEKPATALVFDEELPLPDSSIDRVLMVHALEYAENPTETLKEMWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 124 VLAPNGRLVIVVPNRRGLWARFEHTPFGSGRPYSRTQLTTLLREANFTVSTVSDALHFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P F+G+ V+EA+K LYQGLP+ +   + +  P+L P   
Sbjct: 184 ATRRWMMRPCLALEGMGRRLWPVFSGVLVVEAQKRLYQGLPVAQRSSRRVFVPVLAPQGT 243

Query: 241 S 241
            
Sbjct: 244 P 244


>gi|116254074|ref|YP_769912.1| hypothetical protein RL4339 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258722|emb|CAK09827.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 258

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 133/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I   LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSELGRLAEQSIGMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+TALV +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSTTALVFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTNLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRTILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|254780582|ref|YP_003064995.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040259|gb|ACT57055.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 242

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT
Sbjct: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR
Sbjct: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP
Sbjct: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV
Sbjct: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240

Query: 241 ST 242
           ST
Sbjct: 241 ST 242


>gi|209551157|ref|YP_002283074.1| methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536913|gb|ACI56848.1| Methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 258

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 133/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 13  MHADIVDLRQFYHSELGRLAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 72

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST LV +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 73  FAFMPAGQGAVNWPMGSLSSTTLVFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 132

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 133 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGATAEALFFPP 192

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 193 SKLRTILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 252

Query: 241 ST 242
            T
Sbjct: 253 PT 254


>gi|241206560|ref|YP_002977656.1| methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860450|gb|ACS58117.1| Methyltransferase type 11 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 246

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 133/242 (54%), Positives = 168/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSELGRLAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+TALV +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSTTALVFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTNLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRTILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|319781261|ref|YP_004140737.1| methyltransferase type 11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167149|gb|ADV10687.1| Methyltransferase type 11 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 260

 Score =  201 bits (512), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 114/241 (47%), Positives = 162/241 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FYS+ LG+    +I+  LS+ W  V   RL+GLGY +P+   F    ER 
Sbjct: 1   MHSDIVDLRSFYSTTLGRFAERSITMALSSIWAAVPNERLVGLGYTLPWLERFGSDAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    ++TALV +  LPL DS +D +L+VH LE  E+P   L+EIWR
Sbjct: 61  FAFMPATQGAVVWPATGPTATALVFDEELPLVDSCIDRMLLVHSLEHVENPRETLNEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+++VVPN+RG+WAR EHTPFG+G+P+S  Q+  LLREANFT +  S +LFFPP
Sbjct: 121 VLSPAGRVVIVVPNRRGVWARFEHTPFGNGRPFSRGQLTELLREANFTPAAWSDALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + ++ +++  +V E+ G    P F+G+ V+EA+K LYQG+P+ +   + +  P+L PH  
Sbjct: 181 SRRRFMMRFHNVLERAGRRLWPIFSGVIVVEAQKRLYQGVPVAQRASRRVFVPVLSPHGA 240

Query: 241 S 241
           +
Sbjct: 241 T 241


>gi|15966416|ref|NP_386769.1| hypothetical protein SMc00709 [Sinorhizobium meliloti 1021]
 gi|307300547|ref|ZP_07580327.1| Methyltransferase type 11 [Sinorhizobium meliloti BL225C]
 gi|307318412|ref|ZP_07597847.1| Methyltransferase type 11 [Sinorhizobium meliloti AK83]
 gi|15075687|emb|CAC47242.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896094|gb|EFN26845.1| Methyltransferase type 11 [Sinorhizobium meliloti AK83]
 gi|306904713|gb|EFN35297.1| Methyltransferase type 11 [Sinorhizobium meliloti BL225C]
          Length = 254

 Score =  201 bits (511), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 128/242 (52%), Positives = 165/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    ++S  L++ W  +   RLLGLGYA+P+   F    ERT
Sbjct: 4   MHTDIVDLRQFYHSELGRMAEQSVSSALASIWARLPEERLLGLGYAVPYLERFRADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL D+S+D VLMVH LEFAE P   + EIWR
Sbjct: 64  FAFMPAGQGAVNWPVADLSSTALVFDEELPLPDASIDRVLMVHSLEFAESPRETMKEIWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I+VVPN+RG+WA+MEHTPFGSG+PYS  Q+ +LLRE NFT   T+ +LFFPP
Sbjct: 124 VLAPGGRLIIVVPNRRGVWAQMEHTPFGSGRPYSRGQLTALLRETNFTPGATTEALFFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +K  L+L    E+ G    P F+G+ ++EA+K LYQGLP+     + +  P+L P  V
Sbjct: 184 SKRKLALRLRHGLERFGRSLWPVFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPRGV 243

Query: 241 ST 242
            +
Sbjct: 244 PS 245


>gi|13473060|ref|NP_104627.1| hypothetical protein mll3545 [Mesorhizobium loti MAFF303099]
 gi|14023808|dbj|BAB50413.1| mll3545 [Mesorhizobium loti MAFF303099]
          Length = 262

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 114/241 (47%), Positives = 162/241 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FYS+ LG+    +I+  LS+ W  V   RL+GLGY +P+   F    ER 
Sbjct: 1   MHSDIVDLRSFYSTTLGRFAERSITMALSSIWAAVPNERLVGLGYTLPWLERFGSDAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    ++TALV +  LPL DS +D +L+VH LE  E+P   L+EIWR
Sbjct: 61  FAFMPATQGAVVWPATGPTATALVFDEELPLVDSCIDRMLLVHSLEHVENPRETLNEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+++VVPN+RG+WAR EHTPFG+G+P+S  Q+  LLREANFT +  S +LFFPP
Sbjct: 121 VLSPAGRVVIVVPNRRGVWARFEHTPFGNGRPFSRGQLTELLREANFTPAAWSDALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + ++ +++  +V E+ G    P F+G+ V+EA+K LYQG+P+ +   + +  P+L PH  
Sbjct: 181 SRRRFMMRFHNVLERAGRRLWPIFSGVIVVEAQKRLYQGVPVAQRASRRVFVPVLSPHGA 240

Query: 241 S 241
           +
Sbjct: 241 T 241


>gi|306843423|ref|ZP_07476024.1| Methyltransferase domain protein [Brucella sp. BO1]
 gi|306276114|gb|EFM57814.1| Methyltransferase domain protein [Brucella sp. BO1]
          Length = 259

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFCADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRKQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|190893648|ref|YP_001980190.1| methyltransferase [Rhizobium etli CIAT 652]
 gi|218517123|ref|ZP_03513963.1| putative methyltransferase protein [Rhizobium etli 8C-3]
 gi|190698927|gb|ACE93012.1| putative methyltransferase protein [Rhizobium etli CIAT 652]
          Length = 246

 Score =  201 bits (510), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 132/242 (54%), Positives = 166/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSDLGRFAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST L+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSSTTLIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRGILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|327193568|gb|EGE60458.1| putative methyltransferase protein [Rhizobium etli CNPAF512]
          Length = 246

 Score =  201 bits (510), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 131/242 (54%), Positives = 166/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  L++ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSDLGRFAEQSIAMALASLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST L+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSSTTLIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + IL+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 181 SKLRGILRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|260466657|ref|ZP_05812844.1| Methyltransferase type 11 [Mesorhizobium opportunistum WSM2075]
 gi|259029520|gb|EEW30809.1| Methyltransferase type 11 [Mesorhizobium opportunistum WSM2075]
          Length = 291

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 114/241 (47%), Positives = 162/241 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FYS+ LG+    +I+  LS+ W  V   RL+GLGY +P+   F    ER 
Sbjct: 33  MHSDIVDLRSFYSTTLGRFAEHSITMALSSIWATVPNERLVGLGYTLPWLERFGSDAERV 92

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    ++TALV +  LPL DS +D +L+VH LE  E+P   L+EIWR
Sbjct: 93  FAFMPATQGAVVWPTTGPTATALVFDEELPLVDSCIDRMLLVHSLEHVENPRETLNEIWR 152

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+++VVPN+RG+WAR EHTPFG+G+P+S  Q+  LLREANFT +  S +LFFPP
Sbjct: 153 VLSPAGRVVIVVPNRRGVWARFEHTPFGNGRPFSRGQLTELLREANFTPAAWSDALFFPP 212

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + ++ +++  +V E+ G    P F+G+ V+EA+K LYQG+P+ +   + +  P+L PH  
Sbjct: 213 SRRRFMMRFHNVLERAGRRLWPIFSGVIVVEAQKRLYQGVPVAQRASRRVFVPVLSPHGA 272

Query: 241 S 241
           +
Sbjct: 273 T 273


>gi|254718037|ref|ZP_05179848.1| Methyltransferase domain protein [Brucella sp. 83/13]
 gi|265982984|ref|ZP_06095719.1| methyltransferase type 11 [Brucella sp. 83/13]
 gi|306837597|ref|ZP_07470468.1| Methyltransferase domain protein [Brucella sp. NF 2653]
 gi|264661576|gb|EEZ31837.1| methyltransferase type 11 [Brucella sp. 83/13]
 gi|306407304|gb|EFM63512.1| Methyltransferase domain protein [Brucella sp. NF 2653]
          Length = 259

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFCADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVTWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|23502834|ref|NP_698961.1| hypothetical protein BR1986 [Brucella suis 1330]
 gi|62290834|ref|YP_222627.1| hypothetical protein BruAb1_1962 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700746|ref|YP_415320.1| Generic methyltransferase [Brucella melitensis biovar Abortus 2308]
 gi|161619904|ref|YP_001593791.1| ATP synthase subunits region ORF 4 [Brucella canis ATCC 23365]
 gi|189025053|ref|YP_001935821.1| Generic methyltransferase [Brucella abortus S19]
 gi|225853422|ref|YP_002733655.1| methyltransferase domain-containing protein [Brucella melitensis
           ATCC 23457]
 gi|237816348|ref|ZP_04595341.1| methyltransferase domain protein [Brucella abortus str. 2308 A]
 gi|254690124|ref|ZP_05153378.1| Methyltransferase domain protein [Brucella abortus bv. 6 str. 870]
 gi|254694614|ref|ZP_05156442.1| Methyltransferase domain protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696239|ref|ZP_05158067.1| Methyltransferase domain protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700624|ref|ZP_05162452.1| Methyltransferase domain protein [Brucella suis bv. 5 str. 513]
 gi|254704994|ref|ZP_05166822.1| Methyltransferase domain protein [Brucella suis bv. 3 str. 686]
 gi|254707489|ref|ZP_05169317.1| Methyltransferase domain protein [Brucella pinnipedialis
           M163/99/10]
 gi|254708969|ref|ZP_05170780.1| Methyltransferase domain protein [Brucella pinnipedialis B2/94]
 gi|254731157|ref|ZP_05189735.1| Methyltransferase domain protein [Brucella abortus bv. 4 str. 292]
 gi|256030496|ref|ZP_05444110.1| Methyltransferase domain protein [Brucella pinnipedialis M292/94/1]
 gi|256045587|ref|ZP_05448467.1| Methyltransferase domain protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059958|ref|ZP_05450142.1| Methyltransferase domain protein [Brucella neotomae 5K33]
 gi|256112314|ref|ZP_05453235.1| Methyltransferase domain protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158482|ref|ZP_05456380.1| Methyltransferase domain protein [Brucella ceti M490/95/1]
 gi|256253901|ref|ZP_05459437.1| Methyltransferase domain protein [Brucella ceti B1/94]
 gi|256258378|ref|ZP_05463914.1| Methyltransferase domain protein [Brucella abortus bv. 9 str. C68]
 gi|256263098|ref|ZP_05465630.1| generic methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370388|ref|YP_003107899.1| hypothetical protein BMI_I2009 [Brucella microti CCM 4915]
 gi|260546101|ref|ZP_05821841.1| generic methyltransferase [Brucella abortus NCTC 8038]
 gi|260562898|ref|ZP_05833384.1| generic methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260567532|ref|ZP_05838002.1| generic methyltransferase [Brucella suis bv. 4 str. 40]
 gi|260755663|ref|ZP_05868011.1| methyltransferase type 11 [Brucella abortus bv. 6 str. 870]
 gi|260758888|ref|ZP_05871236.1| methyltransferase type 11 [Brucella abortus bv. 4 str. 292]
 gi|260760612|ref|ZP_05872955.1| methyltransferase type 11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884688|ref|ZP_05896302.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261214938|ref|ZP_05929219.1| methyltransferase type 11 [Brucella abortus bv. 3 str. Tulya]
 gi|261221038|ref|ZP_05935319.1| methyltransferase [Brucella ceti B1/94]
 gi|261314974|ref|ZP_05954171.1| methyltransferase type 11 [Brucella pinnipedialis M163/99/10]
 gi|261316468|ref|ZP_05955665.1| methyltransferase type 11 [Brucella pinnipedialis B2/94]
 gi|261323929|ref|ZP_05963126.1| methyltransferase [Brucella neotomae 5K33]
 gi|261751133|ref|ZP_05994842.1| methyltransferase type 11 [Brucella suis bv. 5 str. 513]
 gi|261755695|ref|ZP_05999404.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
 gi|265987538|ref|ZP_06100095.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265992011|ref|ZP_06104568.1| methyltransferase type 11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993747|ref|ZP_06106304.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265996998|ref|ZP_06109555.1| methyltransferase type 11 [Brucella ceti M490/95/1]
 gi|294851223|ref|ZP_06791896.1| methyltransferase [Brucella sp. NVSL 07-0026]
 gi|297247220|ref|ZP_06930938.1| methyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|306842879|ref|ZP_07475516.1| Methyltransferase domain protein [Brucella sp. BO2]
 gi|23348859|gb|AAN30876.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196966|gb|AAX75266.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616847|emb|CAJ11943.1| Generic methyltransferase [Brucella melitensis biovar Abortus 2308]
 gi|161336715|gb|ABX63020.1| ATP synthase subunits region ORF 4 [Brucella canis ATCC 23365]
 gi|189020625|gb|ACD73347.1| Generic methyltransferase [Brucella abortus S19]
 gi|225641787|gb|ACO01701.1| Methyltransferase domain protein [Brucella melitensis ATCC 23457]
 gi|237788415|gb|EEP62630.1| methyltransferase domain protein [Brucella abortus str. 2308 A]
 gi|256000551|gb|ACU48950.1| hypothetical protein BMI_I2009 [Brucella microti CCM 4915]
 gi|260096208|gb|EEW80084.1| generic methyltransferase [Brucella abortus NCTC 8038]
 gi|260152914|gb|EEW88006.1| generic methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|260157050|gb|EEW92130.1| generic methyltransferase [Brucella suis bv. 4 str. 40]
 gi|260669206|gb|EEX56146.1| methyltransferase type 11 [Brucella abortus bv. 4 str. 292]
 gi|260671044|gb|EEX57865.1| methyltransferase type 11 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675771|gb|EEX62592.1| methyltransferase type 11 [Brucella abortus bv. 6 str. 870]
 gi|260874216|gb|EEX81285.1| methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916545|gb|EEX83406.1| methyltransferase type 11 [Brucella abortus bv. 3 str. Tulya]
 gi|260919622|gb|EEX86275.1| methyltransferase [Brucella ceti B1/94]
 gi|261295691|gb|EEX99187.1| methyltransferase type 11 [Brucella pinnipedialis B2/94]
 gi|261299909|gb|EEY03406.1| methyltransferase [Brucella neotomae 5K33]
 gi|261304000|gb|EEY07497.1| methyltransferase type 11 [Brucella pinnipedialis M163/99/10]
 gi|261740886|gb|EEY28812.1| methyltransferase type 11 [Brucella suis bv. 5 str. 513]
 gi|261745448|gb|EEY33374.1| methyltransferase type 11 [Brucella suis bv. 3 str. 686]
 gi|262551466|gb|EEZ07456.1| methyltransferase type 11 [Brucella ceti M490/95/1]
 gi|262764728|gb|EEZ10649.1| methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263003077|gb|EEZ15370.1| methyltransferase type 11 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092999|gb|EEZ17149.1| generic methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659735|gb|EEZ29996.1| methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|294819812|gb|EFG36811.1| methyltransferase [Brucella sp. NVSL 07-0026]
 gi|297174389|gb|EFH33736.1| methyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|306286966|gb|EFM58483.1| Methyltransferase domain protein [Brucella sp. BO2]
 gi|326409985|gb|ADZ67050.1| Generic methyltransferase [Brucella melitensis M28]
 gi|326539702|gb|ADZ87917.1| methyltransferase domain protein [Brucella melitensis M5-90]
          Length = 259

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|260169402|ref|ZP_05756213.1| methyltransferase [Brucella sp. F5/99]
 gi|261758925|ref|ZP_06002634.1| generic methyltransferase [Brucella sp. F5/99]
 gi|261738909|gb|EEY26905.1| generic methyltransferase [Brucella sp. F5/99]
          Length = 308

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|150397749|ref|YP_001328216.1| type 11 methyltransferase [Sinorhizobium medicae WSM419]
 gi|150029264|gb|ABR61381.1| Methyltransferase type 11 [Sinorhizobium medicae WSM419]
          Length = 250

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 129/242 (53%), Positives = 165/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    ++S  L++ W  +   RLLGLGYA+P+   F    ERT
Sbjct: 4   MHTDIVDLRQFYHSELGRMAEQSVSAALASIWARLPEERLLGLGYAVPYLERFRADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL DSS+D VLMVH LEFAE P   + EIWR
Sbjct: 64  FAFMPAGQGAVNWPVADLSSTALVFDEELPLPDSSIDRVLMVHSLEFAESPRETMKEIWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I+VVPN+RG+WA+MEHTPFGSG+PYS  Q+ +LLRE NFT   TS +LFFPP
Sbjct: 124 VLAPGGRLIIVVPNRRGVWAQMEHTPFGSGRPYSRGQLTALLRETNFTPGATSEALFFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +K  L+L    E+ G    P F+G+ ++EA+K LYQGLP+     + +  P+L P  +
Sbjct: 184 SKRKLALRLRHGLERFGRSLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPRGI 243

Query: 241 ST 242
            +
Sbjct: 244 PS 245


>gi|225628185|ref|ZP_03786220.1| Methyltransferase domain protein [Brucella ceti str. Cudo]
 gi|225617010|gb|EEH14057.1| Methyltransferase domain protein [Brucella ceti str. Cudo]
          Length = 311

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 4   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 64  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 124 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 184 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 243

Query: 241 S 241
            
Sbjct: 244 P 244


>gi|254713602|ref|ZP_05175413.1| Methyltransferase domain protein [Brucella ceti M644/93/1]
 gi|254716044|ref|ZP_05177855.1| Methyltransferase domain protein [Brucella ceti M13/05/1]
 gi|261217812|ref|ZP_05932093.1| methyltransferase type 11 [Brucella ceti M13/05/1]
 gi|261321340|ref|ZP_05960537.1| methyltransferase type 11 [Brucella ceti M644/93/1]
 gi|260922901|gb|EEX89469.1| methyltransferase type 11 [Brucella ceti M13/05/1]
 gi|261294030|gb|EEX97526.1| methyltransferase type 11 [Brucella ceti M644/93/1]
          Length = 259

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLIGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|222087364|ref|YP_002545901.1| SAM-dependent methyltransferase protein [Agrobacterium radiobacter
           K84]
 gi|221724812|gb|ACM27968.1| SAM-dependent methyltransferase protein [Agrobacterium radiobacter
           K84]
          Length = 247

 Score =  199 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 128/242 (52%), Positives = 165/242 (68%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+P+   F    ERT
Sbjct: 1   MHADIVDLRQFYHSELGRLAEQSITMALSSIWARLPEERLVGLGYAVPYLDRFRADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTAL+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMDSASSTALIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ SLLRE NFT   T+ +L FPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTSLLRETNFTPGATAEALLFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +  + +L L   FE++G    P F+G+ ++EA+K LYQGLP+     + +  P+L P  +
Sbjct: 181 SKLRTVLSLRRAFERVGRTLWPAFSGVIIVEAQKRLYQGLPVAVRASRRVFVPVLAPRGI 240

Query: 241 ST 242
            T
Sbjct: 241 PT 242


>gi|163844008|ref|YP_001628412.1| ATP synthase subunits region ORF 4 [Brucella suis ATCC 23445]
 gi|163674731|gb|ABY38842.1| ATP synthase subunits region ORF 4 [Brucella suis ATCC 23445]
          Length = 259

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 119/241 (49%), Positives = 158/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WA  EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWAHFEHTPFGSGRPYSRTQLGTLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|315121774|ref|YP_004062263.1| Methyltransferase type 11 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495176|gb|ADR51775.1| Methyltransferase type 11 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 246

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 193/242 (79%), Positives = 215/242 (88%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRVDI+ LRQFYSSFLG+   DAISKVLSTTWDD+TG RLLGLGYA+PFF CF GK E  
Sbjct: 1   MRVDIIVLRQFYSSFLGRYVRDAISKVLSTTWDDITGYRLLGLGYAVPFFPCFDGKTECN 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPAGQGATNWPDQ  SSTAL+SEG LPL DSSVDCVLM HYLEFAEDP +ML E+WR
Sbjct: 61  LAFMPAGQGATNWPDQNLSSTALISEGQLPLLDSSVDCVLMAHYLEFAEDPSVMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+SGGRMI++VPN+RG+WARME+TPFGSGQPYSW QMISLLRE+NFTLS TSR+LFFPP
Sbjct: 121 VLSSGGRMIIIVPNRRGVWARMENTPFGSGQPYSWTQMISLLRESNFTLSSTSRALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           T+K CILKLWS+FEKIGNIF PGFAGIY IEARKILY+G+PI ES KK+IS P+LVP  +
Sbjct: 181 TNKMCILKLWSIFEKIGNIFWPGFAGIYAIEARKILYEGIPIVESSKKNISVPVLVPQAI 240

Query: 241 ST 242
           ST
Sbjct: 241 ST 242


>gi|27375332|ref|NP_766861.1| hypothetical protein bll0221 [Bradyrhizobium japonicum USDA 110]
 gi|27348468|dbj|BAC45486.1| bll0221 [Bradyrhizobium japonicum USDA 110]
          Length = 246

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 101/244 (41%), Positives = 148/244 (60%), Gaps = 2/244 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR+FYS  LG      I++ +   W    G R+LG+GY  P+   F    ER 
Sbjct: 1   MSIDVVDLREFYSRRLGIVARQMINRGIRERWPRAEGQRVLGIGYPTPYLGLFREDAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG   WP    +  +LV E +LPL DS+VD +L+VH LE ++DP  +L E+WR
Sbjct: 61  LAFMPAAQGVLKWPTGRPALASLVDEFSLPLPDSAVDRILLVHALEMSDDPAALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GR+I V+PN+RG+W R ++TPFG G+PYS  Q+  LLR+  FT +    +LF PP
Sbjct: 121 VLSPSGRVIAVIPNRRGVWTRSDNTPFGHGRPYSRSQITDLLRQTWFTPTAWGEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS--SPILVPH 238
                +LK   ++E+ G      FAG++++EA K +Y+ +P    + + I    P+LVP 
Sbjct: 181 YAGGWVLKSAQMWERAGAALSLPFAGVHIVEATKQVYRAIPAKRERARLIPSLKPVLVPS 240

Query: 239 TVST 242
           +  T
Sbjct: 241 STVT 244


>gi|17986365|ref|NP_538999.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|17981954|gb|AAL51263.1| methyltransferase [Brucella melitensis bv. 1 str. 16M]
          Length = 308

 Score =  198 bits (502), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 120/241 (49%), Positives = 159/241 (65%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI+ELR FY + LG     A+   L+  W  V G RL+GLGY++P+   F    ERT
Sbjct: 1   MHPDIIELRSFYDTTLGHLAERAVRMALAGLWSHVPGERLVGLGYSLPYLDRFGADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA  WP    S+TALV +  LPL DSS+D VLMVH LE+AE+    L E+WR
Sbjct: 61  FAFMPAGQGAVAWPSAEKSTTALVFDEELPLPDSSIDRVLMVHALEYAENAQETLKEMWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++VVPN+RG+WAR EHTPFGSG+PYS  Q+ +LLREANFT+S  S +L FPP
Sbjct: 121 VLAPNGRLVIVVPNRRGVWARFEHTPFGSGRPYSRTQLATLLREANFTVSTVSNALHFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++     E +G    P FAG+ +IEA+K LYQGLP+++   + +  P+L P   
Sbjct: 181 ASRRWMMRPCLALESMGRRLWPLFAGVLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|118591319|ref|ZP_01548717.1| hypothetical protein SIAM614_26768 [Stappia aggregata IAM 12614]
 gi|118435991|gb|EAV42634.1| hypothetical protein SIAM614_26768 [Stappia aggregata IAM 12614]
          Length = 258

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 99/243 (40%), Positives = 146/243 (60%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR FY   LG+     I   +   W D+TG  LLG+GYA PF   +   V+R 
Sbjct: 1   MYLDVVHLRAFYDLPLGRLLRSLIGGPIRKMWPDLTGQALLGIGYAGPFMRPYLDTVDRA 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QGA +WP +  S++ LV + +LP  D+  D V++VH L+   DP  +L E WR
Sbjct: 61  IAAMPAPQGAVHWPRERQSASTLVEDQDLPFPDAYFDRVMLVHALDHCSDPAAVLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I VVPN+RG+WA+ E +PFG G+PYS  Q+  LL+   F ++    +LF PP
Sbjct: 121 VLAPGGRLIAVVPNRRGLWAQSELSPFGYGRPYSGSQLKDLLKSCQFNVTDDKEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           +  + IL+    +E IG    P F G+ ++EA K+++Q LP+   K +  +  P+ +P  
Sbjct: 181 SRARTILRAARTWEGIGRRIWPAFGGVLIMEAEKVVFQSLPVDGKKSRFRVLRPVFIPEG 240

Query: 240 VST 242
           V+T
Sbjct: 241 VAT 243


>gi|254503546|ref|ZP_05115697.1| Methyltransferase domain family [Labrenzia alexandrii DFL-11]
 gi|222439617|gb|EEE46296.1| Methyltransferase domain family [Labrenzia alexandrii DFL-11]
          Length = 255

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 150/243 (61%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR FY   LG+     I   ++  W D+ G  LLGLGYA PF   +HG  ER 
Sbjct: 1   MYLDVVHLRAFYDLPLGQLLRGLIGAPVAQMWPDIQGQSLLGLGYAGPFMRRYHGSAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           ++ MPA QGA +WP ++ +S ALV +  LP +D++ D +++VH L+   DP  ML E+WR
Sbjct: 61  ISAMPAPQGAIHWPREHANSCALVEDEALPFSDATFDRIMLVHALDHCSDPSAMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+IVVVPN+RG+WAR E +PFG G+PYS  Q+  L++   F +   S +LF PP
Sbjct: 121 VLAPGGRVIVVVPNRRGLWARSELSPFGYGRPYSGSQLKELMKNCQFNVLSDSEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           +    I +    +E +G  F P FAGI ++EA K++++ LP+   K +  +  P+ +P  
Sbjct: 181 SRAVSIQRTARTWENLGRRFWPAFAGILILEAEKLVFRSLPVDGKKSRLRVLRPVFIPDG 240

Query: 240 VST 242
            +T
Sbjct: 241 AAT 243


>gi|163759933|ref|ZP_02167017.1| hypothetical protein HPDFL43_16921 [Hoeflea phototrophica DFL-43]
 gi|162282891|gb|EDQ33178.1| hypothetical protein HPDFL43_16921 [Hoeflea phototrophica DFL-43]
          Length = 248

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 124/241 (51%), Positives = 169/241 (70%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY + LG     +++  LS+ W ++ G RL+GLGYA P+   F    ERT
Sbjct: 1   MHADIVDLRQFYHTRLGLLAEQSVAMALSSIWANLPGERLMGLGYAAPYLDRFRPDAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    S+TALV +  LPLAD+S+D VLMVH LEFAE+P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPAGGPSATALVFDEELPLADASLDRVLMVHSLEFAENPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++V PN+RG+WAR EHTPFG+G+PYS  Q++ LLRE+NFT    + +LFFPP
Sbjct: 121 VLAPGGRLVIVAPNRRGVWARFEHTPFGAGRPYSRGQLVRLLRESNFTPGAFAEALFFPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +  +++L S+FE++G    P F+G+ V+EA+K LYQGLP+ +   + +  P+L P T 
Sbjct: 181 SQRVVVMRLRSIFERLGRRMWPVFSGVIVVEAQKRLYQGLPVAQRASRRVFVPVLSPQTS 240

Query: 241 S 241
            
Sbjct: 241 R 241


>gi|23016510|ref|ZP_00056265.1| COG0500: SAM-dependent methyltransferases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 253

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 103/231 (44%), Positives = 141/231 (61%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V+LR FYS  LG+     I + L   W DVTG R+LGLG+A P+   F  + ER 
Sbjct: 10  MWTDVVDLRDFYSGSLGQTAQRLIRRQLRALWPDVTGQRVLGLGFATPYLRIFLAEAERV 69

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP +    T LV E +LPL D S+D +L+VH LE  E    M+ E WR
Sbjct: 70  IAAMPASQGVLPWPSEGPGLTTLVDETDLPLPDRSIDRMLLVHALESTEQVRAMMREAWR 129

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++VV PN+RG+WAR+E TPFG+G+PY+  Q+  LLR+  FT    + +LF PP
Sbjct: 130 VLADGGRLVVVAPNRRGIWARLERTPFGNGRPYTMGQLNRLLRDNMFTPVNKASALFLPP 189

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
           T  + +L+     E+IG  +   F G+ ++EA K +Y G  + E+K K  S
Sbjct: 190 TTSRMLLRSAPAVEQIGQRWFETFGGVVMVEAAKQIYAGSAVREAKGKRRS 240


>gi|227823239|ref|YP_002827211.1| putative methyltransferase [Sinorhizobium fredii NGR234]
 gi|227342240|gb|ACP26458.1| putative methyltransferase [Sinorhizobium fredii NGR234]
          Length = 254

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 131/242 (54%), Positives = 167/242 (69%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    A+S  LS+ W  +   RL+GLGYA+P+   F    ERT
Sbjct: 4   MHTDIVDLRQFYHSELGRMAEQAVSMALSSVWARMPEERLVGLGYAVPYLERFRADTERT 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SSTALV +  LPL D+S+D VLMVH LEFAE P   + EIWR
Sbjct: 64  FAFMPAGQGAVNWPVAELSSTALVFDEELPLPDASIDRVLMVHALEFAESPRETMKEIWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+ +LLRE NFT   +S +LFFPP
Sbjct: 124 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASSEALFFPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           + +K IL+L    E+ G    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V
Sbjct: 184 SRRKMILRLRHGLERFGRSVWPVFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGV 243

Query: 241 ST 242
            +
Sbjct: 244 PS 245


>gi|39933686|ref|NP_945962.1| type 11 methyltransferase [Rhodopseudomonas palustris CGA009]
 gi|192289043|ref|YP_001989648.1| methyltransferase type 11 [Rhodopseudomonas palustris TIE-1]
 gi|39647532|emb|CAE26053.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
 gi|192282792|gb|ACE99172.1| Methyltransferase type 11 [Rhodopseudomonas palustris TIE-1]
          Length = 259

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 150/243 (61%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR+FYSS LG      I++ + + W D  G R+LG GY  P+   F  + ER 
Sbjct: 4   MTIDVVDLREFYSSRLGIVARRLINRGIQSRWPDARGDRVLGFGYPTPYLGLFRDRCERC 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + ++LV E  LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 64  IAFMPAAQGVLKWPTARSTLSSLVDEHALPLPDAAVDRILLVHALEMSDDPERLLREVWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ +VPN+RG+WAR+++TPFG G+PYS  Q+  LLR   FT +  S +LF PP
Sbjct: 124 VLAPAGRLLAIVPNRRGVWARLDNTPFGHGRPYSRSQIADLLRRTWFTPTAWSEALFVPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
             +  +L+    +E+IG      FAG++V+EA K + +  P+   + + I S  P LVP 
Sbjct: 184 LGQGWLLRSAPAWERIGASTSMPFAGVHVVEATKQVVRAQPVKRERIRLIPSLEPSLVPS 243

Query: 239 TVS 241
              
Sbjct: 244 PTP 246


>gi|328541841|ref|YP_004301950.1| methyltransferase domain family [polymorphum gilvum SL003B-26A1]
 gi|326411592|gb|ADZ68655.1| Methyltransferase domain family [Polymorphum gilvum SL003B-26A1]
          Length = 275

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 92/243 (37%), Positives = 142/243 (58%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+ +LR FY   LG+     +   +   W  + G  +LG+GYA PF   +  + ER 
Sbjct: 1   MYLDVADLRTFYDLPLGRLLRSLVGGRIRALWPSLKGQSMLGVGYAGPFLRPYLDEAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP  QG   WP +  ++  LV E +LP +D+  +  L+VH L+ + DP  ML E+WR
Sbjct: 61  VAAMPGPQGVVAWPRERDNAAVLVDEAHLPFSDALFERALVVHALDLSGDPAAMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+IVVVPN+RG+W++ E +PFG G+PYS  Q+  LL+   F ++    +LF PP
Sbjct: 121 VLAPGGRVIVVVPNRRGLWSQSETSPFGYGRPYSRGQIQGLLKTCQFDVTANEEALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           T  + +L+    +E  G    P FAG+ ++EA K +Y+GLP+ E  +   +  P+ +P  
Sbjct: 181 TRARMVLRSARTWEAAGRRLWPAFAGLLLVEAEKRIYRGLPVEEGPRVLRVLRPVFIPEG 240

Query: 240 VST 242
            +T
Sbjct: 241 AAT 243


>gi|154252031|ref|YP_001412855.1| type 11 methyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154155981|gb|ABS63198.1| Methyltransferase type 11 [Parvibaculum lavamentivorans DS-1]
          Length = 252

 Score =  195 bits (495), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 146/241 (60%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FY   LG+     IS+ +   W DV G  +LGLG+A P+ + F  + +R 
Sbjct: 1   MNMDVIDLRDFYGRPLGRAAQYHISRRIRQIWPDVRGLNMLGLGFATPYLAPFLSEAQRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +  MPA QG  +WP +  S T LV E  LPL D S+D VL+VH LE +E    ML +IWR
Sbjct: 61  VGLMPARQGVLHWPPEGKSLTGLVDERELPLEDESMDRVLVVHGLEASESMRGMLRQIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WAR E TPFG GQP+S  Q+  LLRE+ F+ S    +LF PP
Sbjct: 121 VLAPGGRVLIVVPNRRGLWARREATPFGHGQPFSRVQLTQLLRESMFSPSAWEVALFAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              + +L+  S +E+ G+I  P F+G+ ++EA K +Y   P+  S+K       + P   
Sbjct: 181 FDWRPLLRSASAWERAGHILWPRFSGVIIVEATKQIYAATPLPVSRKVKARVRAIAPIPS 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|110635410|ref|YP_675618.1| methyltransferase type 11 [Mesorhizobium sp. BNC1]
 gi|110286394|gb|ABG64453.1| Methyltransferase type 11 [Chelativorans sp. BNC1]
          Length = 258

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 123/241 (51%), Positives = 162/241 (67%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR FY+S LGK    +I+  L++ W  +   RL+GLGYAIP+   F    ER 
Sbjct: 7   MNTDIVDLRAFYASLLGKLAERSIAMALASLWCKLPDERLVGLGYAIPWLDRFGADAERV 66

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QGA  WP    S+TALV E  LPLAD++VD VL+VH LE AE+P  ML E+WR
Sbjct: 67  FAFMPARQGALRWPPGRASATALVFEEELPLADAAVDRVLVVHALEHAENPRQMLIELWR 126

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WAR EHTPFG+G PYS  Q++ LLREANFT    + +L FPP
Sbjct: 127 VLAPGGRIVIVVPNRRGVWARFEHTPFGTGLPYSRSQLVELLREANFTPGAWADTLHFPP 186

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             ++ +++L  V E+ G  F P FAG+ V+EA K LYQG+P    +K+ +  P+L P   
Sbjct: 187 ARRRWLMRLHQVLERTGRRFWPLFAGVLVVEAEKRLYQGIPAKARRKRRVLVPVLSPQGA 246

Query: 241 S 241
           +
Sbjct: 247 T 247


>gi|158421849|ref|YP_001523141.1| hypothetical protein AZC_0225 [Azorhizobium caulinodans ORS 571]
 gi|158328738|dbj|BAF86223.1| conserved hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 248

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 141/241 (58%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY+  LG  T   I++ +   + DVTG  +LGLGYA P+   F  + ER 
Sbjct: 1   MFLDVVDLRSFYAQPLGLVTRRLIARSIRARFPDVTGLSILGLGYATPYLGVFREEAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +  AL  E  LPL  SS+D V+ VH LE   +   +L E+WR
Sbjct: 61  IAVMPAAQGVVRWPSTAPTLAALSDELELPLPTSSMDRVIAVHLLEMTPNAADVLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ +VPN+R +WAR++ TPFG+G P+S  Q++ LLREA FT      +L+ PP
Sbjct: 121 VLAPGGRLLAIVPNRRSVWARLDTTPFGNGSPFSRGQVVRLLREALFTPVGWGEALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              K +L+    +E+ G      FAG++V+EA K LY+  P+   +      P LVP  V
Sbjct: 181 VSSKWLLRTAIAWERAGGRLSLPFAGVHVVEATKQLYRPAPVKRVRLAPALEPGLVPVAV 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|91974576|ref|YP_567235.1| methyltransferase type 11 [Rhodopseudomonas palustris BisB5]
 gi|91681032|gb|ABE37334.1| Methyltransferase type 11 [Rhodopseudomonas palustris BisB5]
          Length = 254

 Score =  191 bits (486), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 103/242 (42%), Positives = 144/242 (59%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR FYS+ LG      I++ + T W D  G R+LGLGY  P+   F    ER 
Sbjct: 1   MTIDVVNLRDFYSNRLGLVARRLINRGIQTRWPDARGQRVLGLGYPTPYLGLFRDDCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + + LV E  LPL D++VD +L+VH LE +EDP  +L E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLVHSLEMSEDPDALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ VVPN+RG+WAR ++TPFG G+PYS  Q+  LLR   FT    S +LF PP
Sbjct: 121 VLAPSGRLLAVVPNRRGVWARSDNTPFGHGRPYSRSQISDLLRRTWFTPVGWSEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +  +L+    +E++G      FAG++V+EA K +    PI   +++    P L P  V
Sbjct: 181 LEQSWLLRSAPAWERVGAAASLPFAGVHVVEATKQV--VRPIQAKRERTRLIPALGPSLV 238

Query: 241 ST 242
            +
Sbjct: 239 PS 240


>gi|86747197|ref|YP_483693.1| methyltransferase type 11 [Rhodopseudomonas palustris HaA2]
 gi|86570225|gb|ABD04782.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 102/242 (42%), Positives = 145/242 (59%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V LR+FYS+ LG      I++ + T W D  G R+LGLGY  P+   F    ER 
Sbjct: 1   MTMDVVNLREFYSNRLGVVARRLINRGIQTRWPDARGQRVLGLGYPTPYLGLFRHNCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + + LV E  LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARATLSTLVEERALPLPDAAVDRILLVHSLEMSDDPDALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ VVPN+RG+WAR+++TPFG G+PYS  Q+  LLR   FT    S +LF PP
Sbjct: 121 VLAPSGRLLAVVPNRRGVWARIDNTPFGHGRPYSRSQISDLLRRTWFTPIGWSEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +  +L+    +E+IG       AG++V+EA K +    PI   +++    P L P  V
Sbjct: 181 LEQAWLLRWAPAWERIGAAISLPLAGVHVVEATKQV--VRPIQAKRERTRLIPSLEPSLV 238

Query: 241 ST 242
            +
Sbjct: 239 PS 240


>gi|209883260|ref|YP_002287117.1| methyltransferase type 11 [Oligotropha carboxidovorans OM5]
 gi|209871456|gb|ACI91252.1| methyltransferase type 11 [Oligotropha carboxidovorans OM5]
          Length = 247

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 105/241 (43%), Positives = 146/241 (60%), Gaps = 2/241 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VD+++LR FYS  +G      I + +   W D  G R+LG GY  P+   F    ER 
Sbjct: 1   MTVDVIDLRGFYSQRIGTVVRRMIWRGIQNHWPDAPGQRVLGFGYPTPYLGLFRDSCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG   WP    + + LV E +LPL D+++D +L+VH LE ++DP   + EIWR
Sbjct: 61  LAFMPATQGVLKWPTARPTLSTLVDELSLPLPDAALDRILLVHALEMSDDPENFMREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++VVVPN+RG+WAR ++TPFG GQPYS  Q+I LLR+  FT    S +LF PP
Sbjct: 121 VLAPSGRLMVVVPNRRGVWARGDNTPFGHGQPYSRTQLIQLLRQTWFTPVAWSEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
             K  +L+    +EK+G+     F G+ ++EA K +Y+GLP    + + I +  P LVP 
Sbjct: 181 VDKGWMLRSAPAWEKVGSALSSPFPGVLLVEATKQVYRGLPAKRERPRLIPALEPALVPR 240

Query: 239 T 239
            
Sbjct: 241 P 241


>gi|149202405|ref|ZP_01879378.1| hypothetical protein RTM1035_13798 [Roseovarius sp. TM1035]
 gi|149144503|gb|EDM32534.1| hypothetical protein RTM1035_13798 [Roseovarius sp. TM1035]
          Length = 246

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 120/241 (49%), Gaps = 2/241 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+     +   ++  W +  G  ++G G+A+PF   +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAVQKTLRAQVAEFWPEAQGQTVVGYGFAVPFLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  E   P+    VD +L+VH LE +E P  +L E W
Sbjct: 61  VIGLMPAPQGVIGWPQGMPNISVLCEETFWPVETGHVDKLLVVHGLETSEQPGAVLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+W+R + TPFG G+PYS  Q+ S L+  NF     + +L+ P
Sbjct: 121 RVLGPGGSALFIVPNRAGLWSRSDRTPFGFGRPYSQTQLESQLKSQNFLPERHATALYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ +    K   ++E++G         G+ ++EA K +          K      +L P 
Sbjct: 181 PSERPFWRKTAGMWERMGGKLSVVVSGGVLMVEATKRVQAPSGPGLRDKVRKPLSVLNPQ 240

Query: 239 T 239
            
Sbjct: 241 P 241


>gi|298293431|ref|YP_003695370.1| methyltransferase type 11 [Starkeya novella DSM 506]
 gi|296929942|gb|ADH90751.1| Methyltransferase type 11 [Starkeya novella DSM 506]
          Length = 246

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 94/241 (39%), Positives = 137/241 (56%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V LR FY+  LG  T   + + +   +D+V G  LLG+GYA P+   F  + ER+
Sbjct: 1   MYPDVVGLRSFYAQPLGVVTRRLVGRAIRARFDNVRGLSLLGIGYATPYLGMFREECERS 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMP  QG T WP    +  ALV E  LPL D  +D V+ VH LE   D   +L E+WR
Sbjct: 61  LAFMPGAQGVTRWPSAAPTLAALVDETELPLRDGMIDRVIAVHLLEMTPDAEEVLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ +VP++RG+WAR E+ PFG G+P+S  Q+  LLR A FT      +L+ PP
Sbjct: 121 VLAPGGRLLCIVPSRRGIWARTENNPFGHGRPFSRTQITDLLRGALFTPVGWDEALYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +   L+    +E++G      FAG++++EA K +Y+ +      +  +  P+L P   
Sbjct: 181 VARNWFLRSAVAWERVGATLSLPFAGVHIVEATKQVYKPVATKRRSRLRVLKPVLEPVLA 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|146337700|ref|YP_001202748.1| putative SAM-dependent methyltransferase [Bradyrhizobium sp.
           ORS278]
 gi|146190506|emb|CAL74505.1| conserved hypothetical protein; putative SAM-dependent
           methyltransferase [Bradyrhizobium sp. ORS278]
          Length = 268

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 144/243 (59%), Gaps = 3/243 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  LG      I++ +   W    G R+LG+GY  P+   F    ER 
Sbjct: 2   MFMDVIDLRNFYSGRLGIVARLLINRGIRARWPSAAGQRVLGVGYPTPYLGLFREDSERC 61

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    +  +LV E +LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 62  IAFMPAAQGVLKWPTARPTLASLVDEFSLPLPDAAVDRILIVHALEMSDDPAGLLREMWR 121

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GRMI+V+PN+RG+W R ++TPFG G+PYS  Q+  LLR+  FT S    +LF PP
Sbjct: 122 VLAPAGRMIIVIPNRRGIWTRSDNTPFGHGRPYSRSQITQLLRQTWFTPSAWGEALFMPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
                 LK    +E++G      FAG++++EA K +Y+ +P    + + I    P+L P 
Sbjct: 182 VG-GWFLKSAMAWERVGAALSLPFAGVHIVEATKQVYRVIPARRERIRLIPRLEPVLAPA 240

Query: 239 TVS 241
             +
Sbjct: 241 PSA 243


>gi|83313292|ref|YP_423556.1| SAM-dependent methyltransferase [Magnetospirillum magneticum AMB-1]
 gi|82948133|dbj|BAE52997.1| SAM-dependent methyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 240

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 103/226 (45%), Positives = 140/226 (61%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           V+LR FY S LG+     I + +   W DVTG R+LGLG+A P+   F  + ER +A MP
Sbjct: 2   VDLRDFYGSSLGQTAQRLIRRQVRALWPDVTGQRVLGLGFATPYLRIFLAEAERVIAAMP 61

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A QG   WP +    T LV E +LPL D S+D +L+VH LE AE    M+ E WRVL  G
Sbjct: 62  ASQGVLPWPPEGPGLTTLVDETDLPLPDRSIDRLLLVHALESAEQVRAMMREAWRVLADG 121

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           GR++VV PN+RG+WAR+E TPFG+G+PY+  Q+  LLR+  FT    + +LF PPT  + 
Sbjct: 122 GRLMVVAPNRRGIWARLERTPFGNGRPYTMGQLNRLLRDNMFTPINKASALFLPPTTSRM 181

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
           +L+  S  EKIG  +   F G+ ++EA K +Y G  + E+K K  S
Sbjct: 182 MLRSASAVEKIGQRWFETFGGVIMVEAAKQIYAGSAVREAKGKRRS 227


>gi|217978059|ref|YP_002362206.1| methyltransferase type 11 [Methylocella silvestris BL2]
 gi|217503435|gb|ACK50844.1| methyltransferase type 11 [Methylocella silvestris BL2]
          Length = 248

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 96/243 (39%), Positives = 148/243 (60%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FY+S  G      I++++   + +  G  +LG GYA P+   F  +  R 
Sbjct: 1   MSLDVIDLRSFYASPAGDLARRLIARIVRERFSNCAGYSILGAGYATPYLGVFRDEAVRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  +WP     ++ALV    +PL DSS+D V+++H LE  E P  +L EIWR
Sbjct: 61  LAFMPAQQGVIHWPAASSCASALVETTAMPLPDSSIDRVILIHGLETTEHPRELLTEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+V P++ G+WAR++ TPFG GQP+S  Q+  L+R+  F+ +  + +L+ PP
Sbjct: 121 VLTPGGRVIIVAPSRSGLWARLDRTPFGHGQPFSRSQLRDLMRDTLFSPTHWTEALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS--SPILVPH 238
              K +L+   +FEKIG  FG   AG+ ++EA K LY+ +P T+  ++ +   +P   P 
Sbjct: 181 FRHKTLLRAGVIFEKIGAFFGLPGAGVLIVEATKQLYRPVPATQRAQEALPQFAPAADPV 240

Query: 239 TVS 241
              
Sbjct: 241 GAP 243


>gi|316932078|ref|YP_004107060.1| type 11 methyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315599792|gb|ADU42327.1| Methyltransferase type 11 [Rhodopseudomonas palustris DX-1]
          Length = 259

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 96/243 (39%), Positives = 143/243 (58%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FYSS LG      I++ +   W D  G R+LG GY  P+   F    ER 
Sbjct: 4   MMMDVVDLRGFYSSRLGIVARRLINRSIQRRWPDARGDRVLGFGYPTPYLGLFRDSSERC 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + + LV E  LPL D++VD +L+VH LE ++DP  +L E+WR
Sbjct: 64  IAFMPAAQGVLKWPTARPTLSTLVDEHALPLPDAAVDRILLVHALEMSDDPERLLREVWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ +VPN+RG+WAR+++TPFG G+PYS  Q+  LLR   FT +    +LF PP
Sbjct: 124 VLAPAGRLLAIVPNRRGVWARLDNTPFGHGRPYSRPQIADLLRRTWFTPTGWGEALFVPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
             +  +L+    +E++G       AG++++EA K + +   +   + + I +  P LVP 
Sbjct: 184 LAQGWLLRSAPAWERVGAAASLPLAGVHMVEATKQVVRPQTVKRERTRLIPALEPSLVPS 243

Query: 239 TVS 241
              
Sbjct: 244 PTP 246


>gi|75674572|ref|YP_316993.1| hypothetical protein Nwi_0374 [Nitrobacter winogradskyi Nb-255]
 gi|74419442|gb|ABA03641.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 246

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 97/242 (40%), Positives = 142/242 (58%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  LG      IS+ +   W ++ G  + GLGY  P+   F  + ER 
Sbjct: 1   MAIDVIDLRDFYSQRLGVVARRLISRAIHAHWPNMKGQCVAGLGYPTPYLGLFREECERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV E +LPL D+  D +L+VH LE ++DP  +L E+WR
Sbjct: 61  IALMPAAQGVLKWPTARPALATLVDEFSLPLRDAVADRILLVHALEMSDDPESLLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GRM+V+VPN+RG+W R + TPFG GQPYS  Q+  LLR+  FT S    +LF PP
Sbjct: 121 VLSPSGRMMVIVPNRRGIWTRTDVTPFGHGQPYSRSQITQLLRQTWFTPSAWGEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +    L+  +V+E+IG      FAG++++EA K +Y+ +       + I  P+L P   
Sbjct: 181 INGGWFLRSAAVWERIGAALSLPFAGVHLVEATKQVYRPIAAKREHSRLI--PVLQPTLA 238

Query: 241 ST 242
            +
Sbjct: 239 PS 240


>gi|307943546|ref|ZP_07658890.1| ATP synthase subunits region ORF 4 [Roseibium sp. TrichSKD4]
 gi|307773176|gb|EFO32393.1| ATP synthase subunits region ORF 4 [Roseibium sp. TrichSKD4]
          Length = 263

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 94/242 (38%), Positives = 143/242 (59%), Gaps = 1/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+ +LR FY   +G+     I + +   W D+   RL+G+GYA PF   + G  ER 
Sbjct: 1   MYLDVADLRTFYELPMGQLLRGLIGQHIRNFWPDLEKQRLIGIGYAGPFMRPYLGNAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QGA  WP +  ++++LV +G LP +D++ D  +MVH L+ ++D   +L E WR
Sbjct: 61  IAAMPAQQGAVPWPREADTASSLVLDGCLPFSDAAFDRAMMVHVLDHSKDAAEVLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+IV+VPN+RG+WAR E +PFG G+PYS  Q+  L++   F +     +LF PP
Sbjct: 121 VLAPGGRVIVIVPNRRGLWARSELSPFGYGRPYSRSQLKELMQTCQFEVLRDEEALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           T    IL+  + +E IG    P F G+ ++EA K +++ +PI   K    +  P+ VP  
Sbjct: 181 TRAGYILRSATTWEAIGRKLWPAFGGLLIMEAEKKVFRPVPIDGKKNPLRVLRPVFVPDG 240

Query: 240 VS 241
             
Sbjct: 241 AP 242


>gi|254472290|ref|ZP_05085690.1| methyltransferase type 11 [Pseudovibrio sp. JE062]
 gi|211958573|gb|EEA93773.1| methyltransferase type 11 [Pseudovibrio sp. JE062]
          Length = 266

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 93/243 (38%), Positives = 142/243 (58%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+  L++FY   LG+     +   +   W ++ G  LLG+GYA P+   +  K  R 
Sbjct: 1   MYLDVTHLKEFYDLPLGRMLRVLVGSRVKMLWPEMRGQSLLGIGYAAPYLRPYLKKTNRV 60

Query: 61  LAFMPAGQGATNWPDQY--FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
            A MPA QG   WP +    +   L+ +G LP  DS +D +L+VH LE A  P  +L E+
Sbjct: 61  FAGMPAAQGVVKWPREVEVPNKAFLMEDGQLPFPDSCIDRILLVHSLEMAGQPGALLDEV 120

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           +RVL+ GGR+IV+VPN+RG WAR E +PFG G+PYS  Q+ + L   + ++     +LF 
Sbjct: 121 YRVLSPGGRVIVIVPNRRGAWARSEVSPFGYGRPYSRPQLDNFLSNHHLSVVSREEALFV 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           PPT+ K +LK    FE++G +  P FAG+ V EA K +Y+G+P+  S    +  P+ +P+
Sbjct: 181 PPTNSKLVLKNARSFERLGAVAWPAFAGLLVTEAEKQIYRGIPLKASHVTRVLRPVFLPN 240

Query: 239 TVS 241
             +
Sbjct: 241 GKT 243


>gi|92116088|ref|YP_575817.1| hypothetical protein Nham_0467 [Nitrobacter hamburgensis X14]
 gi|91798982|gb|ABE61357.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 246

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 141/241 (58%), Gaps = 2/241 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FY+  LG      I++ +   W  + G  ++GLGY  P+   F    ER 
Sbjct: 1   MAIDVIDLRDFYAQRLGIVARRLINRGIHAHWPSMEGQCVVGLGYPTPYLGLFREDCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    +   LV E +LPL D+  D +L+VH LE ++DP  +L E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARPALATLVDELSLPLQDAVADRILLVHALEMSDDPESLLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  GRM+V+VPN+RG+W R + TPFG G+PYS  Q+  LLR+  FT S    +LF PP
Sbjct: 121 VLSPSGRMMVIVPNRRGIWTRTDATPFGYGRPYSRSQITQLLRQTWFTPSAWGEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
            +    L+  + +E++G      FAG++++EA K +Y+ +       + I +  P L P 
Sbjct: 181 INGGWFLRSAAAWERVGAALSLPFAGVHIVEATKQVYRPIAAKRQHSRLIPALPPALAPS 240

Query: 239 T 239
           +
Sbjct: 241 S 241


>gi|85713815|ref|ZP_01044805.1| hypothetical protein NB311A_04724 [Nitrobacter sp. Nb-311A]
 gi|85699719|gb|EAQ37586.1| hypothetical protein NB311A_04724 [Nitrobacter sp. Nb-311A]
          Length = 249

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 97/242 (40%), Positives = 143/242 (59%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  LG      I++ +   W  + G  ++GLGY  P+   F  + ER 
Sbjct: 4   MAIDVIDLRDFYSQRLGIVARRLINRAIHAHWPSLEGQCVVGLGYPTPYLGLFREECERC 63

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +  ALV E +LPL D+  D +L+VH LE ++DP  +L E+WR
Sbjct: 64  IALMPAAQGVLKWPTARPALAALVDEFSLPLQDAVADRILLVHALEVSDDPQSLLREVWR 123

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L+  GRM+VVVPN+RG+W R + TPFG GQPYS  Q+  LLR+  FT S    +LF PP
Sbjct: 124 ILSPSGRMMVVVPNRRGIWTRTDTTPFGHGQPYSRSQITQLLRQTWFTPSAWGEALFVPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
            +    L+  +V+E+IG      FAG++++EA K +Y   P+   ++     P+L P   
Sbjct: 184 INGGWFLRSAAVWERIGAALSLPFAGVHLVEATKQVY--RPLAAKREHSRLMPVLPPALA 241

Query: 241 ST 242
            +
Sbjct: 242 PS 243


>gi|299132856|ref|ZP_07026051.1| Methyltransferase type 11 [Afipia sp. 1NLS2]
 gi|298592993|gb|EFI53193.1| Methyltransferase type 11 [Afipia sp. 1NLS2]
          Length = 247

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 145/241 (60%), Gaps = 2/241 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+++LR FYS  +G      IS+ ++  W D  G R+LGLGY+ P+   F    ER 
Sbjct: 1   MTIDVIDLRGFYSQRVGAVARRLISRGITRHWPDAEGQRVLGLGYSTPYLGLFRDNCERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPA QG   WP    + + LV E +LPL D++VD +L+VH LE ++DP   + E+WR
Sbjct: 61  FAFMPAAQGVLKWPTARPTLSTLVDEFSLPLPDAAVDRILLVHALEMSDDPDSFMREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+++V+PN+RG+WAR ++TPFG GQPYS  Q+  LLR   FT    S +LF PP
Sbjct: 121 VLAPSGRIMMVIPNRRGVWARGDNTPFGHGQPYSRSQITQLLRRTWFTPIAWSEALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
                +L+    +EK+G      F G+ ++EA K +Y+G+P    + + I S  P LVP 
Sbjct: 181 IDSGWMLRSAMAWEKMGAALSSPFPGVLLVEATKQVYRGIPAKRERTRLIPSLEPALVPR 240

Query: 239 T 239
            
Sbjct: 241 P 241


>gi|140222|sp|P05447|YAT4_RHOBL RecName: Full=ATP synthase subunits region ORF 4
 gi|45974|emb|CAA77310.1| URF 4 [Rhodobacter blasticus]
          Length = 255

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/236 (32%), Positives = 114/236 (48%), Gaps = 1/236 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  + LG+    AI   +   W    G  + G G+A+P    +  +  R
Sbjct: 1   MHLDVQDLRDFYYRTRLGRVAQRAIRDQMLRLWPPAAGHTVAGFGFAVPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E N PL    VD + ++H LE +E+P  +L E  
Sbjct: 61  VVGLMPGPQGVMPWPAGMQNVSVLCEENNWPLPTGLVDRLAVMHGLETSENPSAVLDEAH 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+W+R + TPFG G+PYS  Q+ + LR   FT   +   L  P
Sbjct: 121 RVLGPGGRALFVVPNRAGLWSRRDATPFGFGRPYSNAQLEAQLRRHGFTPERSLTVLHAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
           P+     L+    +EK+G        G+ ++EA K +Y                +L
Sbjct: 181 PSQTPFWLRTADAWEKLGRRLPWLSGGVLMVEASKQVYAPTRGGLGAVVKKPLRVL 236


>gi|85704174|ref|ZP_01035277.1| hypothetical protein ROS217_14286 [Roseovarius sp. 217]
 gi|85671494|gb|EAQ26352.1| hypothetical protein ROS217_14286 [Roseovarius sp. 217]
          Length = 246

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 119/241 (49%), Gaps = 2/241 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+     +   ++  W +  G  ++G G+A+PF   +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAVQKTVRAQVAEFWPEAQGQTVVGYGFAVPFLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  E   PL    VD +L+VH LE +E P  +L E W
Sbjct: 61  VIGLMPAPQGVIGWPQGLPNISVLCEETFWPLETGHVDKLLVVHGLETSEQPSAVLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+W+R + TPFG G+PYS  Q+ S L+  NF     + +L+ P
Sbjct: 121 RVLGPGGSALFIVPNRAGLWSRSDRTPFGFGRPYSQTQLESQLKSHNFLPERHATTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ +    K   ++E++G         G+ ++EA K +                 +L P 
Sbjct: 181 PSDRPFWRKTAGMWERMGAKLSVVAAGGVLMVEATKRVQAPSGPVLRDTVRKPLSVLRPQ 240

Query: 239 T 239
            
Sbjct: 241 P 241


>gi|167644351|ref|YP_001682014.1| type 11 methyltransferase [Caulobacter sp. K31]
 gi|167346781|gb|ABZ69516.1| Methyltransferase type 11 [Caulobacter sp. K31]
          Length = 277

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 91/240 (37%), Positives = 138/240 (57%), Gaps = 3/240 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY++ LG+   + + + +   W D  G  +LGLGYA PF      K  R 
Sbjct: 1   MRRDVLDLRAFYANPLGRAAREMLGRKVEEAWGDARGLDVLGLGYATPFLEAARAKARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    ++  LV E +LP  ++  D +L VH LE A+DP  +L EIWR
Sbjct: 61  VAAMPATQGVEVWPSGGANAATLVEETSLPFPNAMFDRILAVHALEEADDPAAVLREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+P+S +Q+ +LLREA+   +  +R+L+ PP
Sbjct: 121 VMAPSGRLIVAVASRDGLWAGAESTPFGHGRPFSRHQLEALLREADLEPAGWTRALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVPHT 239
           T    + +    FE++G    P FAG+ ++EA K  +   P     +  + +P +L P  
Sbjct: 181 TA--VMSRWAEGFEQVGARLWPRFAGLILMEAVKQTFAVKPRGSRARVRVFAPGVLAPSP 238


>gi|182677427|ref|YP_001831573.1| methyltransferase type 11 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633310|gb|ACB94084.1| Methyltransferase type 11 [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 257

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 96/248 (38%), Positives = 146/248 (58%), Gaps = 6/248 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY++ LG      I +V+   + +  G  +LG+GYA P+   F     R 
Sbjct: 1   MPLDVVDLRSFYTTPLGSAARRFIGQVIRQRFANCCGQSILGVGYATPYLEPFRADSLRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    SS+ALVS   +PL D+ +D VL++H LE  E P  ++ EIWR
Sbjct: 61  LAFMPAEQGVVNWPSSGLSSSALVSPTMMPLPDACIDRVLLIHALELTEHPRELMAEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +LT GGR++ V P++ G+WAR++ TPFG GQPYS  Q+  L+R   F+ +  + +L+ PP
Sbjct: 121 ILTPGGRILAVTPSRTGLWARLDTTPFGHGQPYSRGQLRDLMRVTLFSPTRWTEALYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS------SPI 234
              + +L+   + E+IG       AG+ ++EA K LY+ + + ++  + I        P+
Sbjct: 181 FQSRLVLRGAPMLERIGASLSLPGAGVQIVEATKQLYRPVILRQAMPQAIPQALPGLRPV 240

Query: 235 LVPHTVST 242
           LVP    T
Sbjct: 241 LVPQAART 248


>gi|146278241|ref|YP_001168400.1| hypothetical protein Rsph17025_2205 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556482|gb|ABP71095.1| hypothetical protein Rsph17025_2205 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 262

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 131/252 (51%), Gaps = 10/252 (3%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++L  FY  + LG+    A+   +   W D  G  + G G+++P    +  +  R
Sbjct: 1   MHLDVLDLHSFYYRTPLGRVAQRAVRDQVQKLWPDAKGQTVAGFGFSVPLLRPYLEQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  EG+ PL+   VD ++M+H LE +E P  +L E W
Sbjct: 61  VIALMPGPQGVMPWPVGMGNVSVLCDEGSWPLSTGMVDKLVMLHGLETSEHPSEVLAEAW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG+ + +VP++ G+WAR + TPFG G+PYS+ Q+ + L+  +FT   T  +LF P
Sbjct: 121 RVLGPGGKALFIVPSRSGLWARRDGTPFGFGRPYSFNQLETQLKRHDFTPERTLAALFAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPIT--------ESKKKHI 230
           P H++  LK    +E  G  F P    G+ ++EA K +Y                  + I
Sbjct: 181 PLHQRFWLKTADFWETGGRRFAPWLVGGVLIVEASKQMYAPTRSGLKSVVTNPLRALEGI 240

Query: 231 SSPILVPHTVST 242
             P+  P + ++
Sbjct: 241 PQPLPAPASRTS 252


>gi|163851932|ref|YP_001639975.1| methyltransferase type 11 [Methylobacterium extorquens PA1]
 gi|163663537|gb|ABY30904.1| Methyltransferase type 11 [Methylobacterium extorquens PA1]
          Length = 244

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 147/243 (60%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 1   MRLDVTDLRAFYASPLGVVTHRVVGRTIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S TAL     LPL +++VD V++VH LE  E P  +L E+WR
Sbjct: 61  LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEAAVDRVILVHGLEAVESPSELLSEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+VVPN+ G+WAR + TPFG GQPYS  Q+  L+R+  F+    + +L+ PP
Sbjct: 121 VLTPGGRLILVVPNRTGVWARRDATPFGHGQPYSRSQLSRLMRDTLFSPEGWAETLYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVPH 238
              +  L+  + +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP 
Sbjct: 181 IRSRFWLRTAAAWERFGTGLAMPFAGLHVVDATKQLYRPIAVRQVRRLESRVPARVLVPA 240

Query: 239 TVS 241
              
Sbjct: 241 GQP 243


>gi|77462846|ref|YP_352350.1| hypothetical protein RSP_2295 [Rhodobacter sphaeroides 2.4.1]
 gi|126461739|ref|YP_001042853.1| hypothetical protein Rsph17029_0970 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221638715|ref|YP_002524977.1| hypothetical protein RSKD131_0616 [Rhodobacter sphaeroides KD131]
 gi|332557737|ref|ZP_08412059.1| hypothetical protein RSWS8N_01760 [Rhodobacter sphaeroides WS8N]
 gi|77387264|gb|ABA78449.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126103403|gb|ABN76081.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
 gi|221159496|gb|ACM00476.1| Hypothetical Protein RSKD131_0616 [Rhodobacter sphaeroides KD131]
 gi|332275449|gb|EGJ20764.1| hypothetical protein RSWS8N_01760 [Rhodobacter sphaeroides WS8N]
          Length = 262

 Score =  184 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 80/245 (32%), Positives = 125/245 (51%), Gaps = 4/245 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++L  FY  + LG+    A+   +   W D  G  + G G+++P    +  +  R
Sbjct: 1   MHLDVLDLHNFYYRTPLGRVAQRAVRDQVQKLWPDAQGQTVAGFGFSVPLLRPYLEQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  EG  PL+   VD ++M+H LE +E P  +L E W
Sbjct: 61  LIALMPGPQGVMPWPVGMGNVSVLCEEGAWPLSTGMVDKLVMLHGLETSEHPSEVLSEAW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VP++ G+WAR + TPFG G+PYS  Q+ + L+  +FT      +LF P
Sbjct: 121 RVLGPGGRALFIVPSRSGLWARRDGTPFGFGRPYSLNQLEAQLKRHDFTPERALAALFAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPIL--V 236
           P H++  LK    +E  G  F P    G+ ++EA K +Y                +L  +
Sbjct: 181 PLHQRFWLKTADFWETGGRRFAPWLVGGVLIVEASKQVYAPTRTGLKAAVSKPLRVLEGI 240

Query: 237 PHTVS 241
           P  + 
Sbjct: 241 PQPLP 245


>gi|254463048|ref|ZP_05076464.1| ATP synthase subunits region ORF 4 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679637|gb|EDZ44124.1| ATP synthase subunits region ORF 4 [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 273

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 76/243 (31%), Positives = 123/243 (50%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+   + T W +  G  + G G+A P    +     R
Sbjct: 20  MHLDVQDLRNFYYRSALGRAAQRAVRDRVVTLWPEAKGQTVAGFGFAAPLLRPYLKDARR 79

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE +E P  +L E W
Sbjct: 80  VMALMPGPQGVIPWPAGLPNVSVLCEEMLWPIETGRVDRLVVMHGLETSESPTTVLDECW 139

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PY+  Q+ + L+   F     + +L+ P
Sbjct: 140 RVLGPGGRALFIVPNRAGLWSRSDATPFGFGRPYTITQLETQLKRHGFLPERHAAALYQP 199

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ K+  +K   V E++G      F +G+ ++EA K ++  L      +      +L P 
Sbjct: 200 PSAKRAWMKSGKVLERMGGKIPAIFPSGVLMVEASKRVHAPLGPGSRLRVPSPMEVLSPK 259

Query: 239 TVS 241
              
Sbjct: 260 PAP 262


>gi|148258775|ref|YP_001243360.1| hypothetical protein BBta_7608 [Bradyrhizobium sp. BTAi1]
 gi|146410948|gb|ABQ39454.1| hypothetical protein BBta_7608 [Bradyrhizobium sp. BTAi1]
          Length = 255

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 143/241 (59%), Gaps = 3/241 (1%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +D+++LR FYS  LG      I++ +   W    G R+LG+GY  P+   F    ER +A
Sbjct: 1   MDVIDLRNFYSGRLGIVARLLINRGIRARWPSAAGQRVLGIGYPTPYLGLFREDSERCIA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QG   WP    +  +LV E +LPL DS+VD +L+VH LE ++DP  +L E+WRVL
Sbjct: 61  FMPAAQGVLKWPTARPTLASLVDEFSLPLPDSAVDRILIVHALEMSDDPAGLLREVWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+I+V+PN+RG+W R ++TPFG G+PYS  Q+  LLR+  FT S    +LF PP  
Sbjct: 121 APSGRLIIVIPNRRGVWTRTDNTPFGHGRPYSRSQITQLLRQTWFTPSAWGEALFMPPIG 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPHTV 240
               LK    +E++G      FAG++++EA K +Y+ +P    + + I    P+L P   
Sbjct: 181 -GWFLKSAMAWERVGAALSLPFAGVHIVEATKQVYRVIPARRERIRLIPRLEPVLAPSPS 239

Query: 241 S 241
           +
Sbjct: 240 T 240


>gi|218530683|ref|YP_002421499.1| methyltransferase type 11 [Methylobacterium chloromethanicum CM4]
 gi|240139056|ref|YP_002963531.1| hypothetical protein MexAM1_META1p2475 [Methylobacterium extorquens
           AM1]
 gi|254561650|ref|YP_003068745.1| hypothetical protein METDI3237 [Methylobacterium extorquens DM4]
 gi|218522986|gb|ACK83571.1| Methyltransferase type 11 [Methylobacterium chloromethanicum CM4]
 gi|240009028|gb|ACS40254.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
 gi|254268928|emb|CAX24889.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 250

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 147/243 (60%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 7   MRLDVTDLRAFYASPLGVVTHRVVGRTIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 66

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S TAL     LPL +++VD V++VH LE  E P  +L E+WR
Sbjct: 67  LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEAAVDRVILVHGLEAVESPSELLSEVWR 126

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+VVPN+ G+WAR + TPFG GQPYS  Q+  L+R+  F+    + +L+ PP
Sbjct: 127 VLTPGGRLILVVPNRTGVWARRDATPFGHGQPYSRSQLSRLMRDTLFSPEGWAETLYMPP 186

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVPH 238
              +  L+  + +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP 
Sbjct: 187 IRSRFWLRTAAAWERFGTGLAMPFAGLHVVDATKQLYRPIAVRQVRRLESRVPARVLVPA 246

Query: 239 TVS 241
              
Sbjct: 247 GQP 249


>gi|83952818|ref|ZP_00961548.1| hypothetical protein ISM_11710 [Roseovarius nubinhibens ISM]
 gi|83835953|gb|EAP75252.1| hypothetical protein ISM_11710 [Roseovarius nubinhibens ISM]
          Length = 246

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 120/242 (49%), Gaps = 2/242 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+     + + L   W +  G  + G G+A+PF   +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQKTLRQELLKFWPEAKGQTVAGFGFAVPFLRPYLSEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  E + PL    +D +L+VH LE +E P  +L E W
Sbjct: 61  VVGLMPAQQGVIAWPQGMPNVSVLCEETSWPLETGRIDKLLLVHALEVSERPGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GG  I V+PN+ G+W+R + TPFG G+PYS  Q+ +LL+   F       +L+ P
Sbjct: 121 RALGPGGSAIFVLPNRAGLWSRSDRTPFGYGRPYSQGQLETLLKTKGFLPERHVTTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIF-GPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ ++   K   ++E++G      G  G+ ++EA K +                 +L P 
Sbjct: 181 PSERRFWRKTAGMWERLGGKIEIIGAGGVLMVEASKRVQGQTGTGVKDAVRNPLEVLQPK 240

Query: 239 TV 240
             
Sbjct: 241 PK 242


>gi|90422033|ref|YP_530403.1| methyltransferase type 11 [Rhodopseudomonas palustris BisB18]
 gi|90104047|gb|ABD86084.1| Methyltransferase type 11 [Rhodopseudomonas palustris BisB18]
          Length = 257

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 146/241 (60%), Gaps = 2/241 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+ ELR FYS  LG      I++ +   W D  G R+LG GY+ P+   F    ER 
Sbjct: 1   MTIDVTELRDFYSQRLGVMARRLINRGIQAHWRDARGQRVLGFGYSTPYLGLFRSDSERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +AFMPA QG   WP    + ++LV E +LPL D++VD +L+VH LE ++DP  ++ E+WR
Sbjct: 61  IAFMPAAQGVLKWPTARPTLSSLVEEHSLPLPDAAVDRILLVHALEMSDDPDGLMRELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+I +VPN+RG+WAR + TPFG G+PYS  Q+  LLR + FT +  S +LF PP
Sbjct: 121 VLAPAGRLIAIVPNRRGVWARTDTTPFGHGRPYSRTQIAQLLRRSWFTPTAWSEALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
                +L+    +E++G      FAG++++EA K + + +P+   + + I +  P ++P 
Sbjct: 181 IGHNWMLRSAPAWERLGAAMSLPFAGVHIVEATKQVARAIPVRRERTRLIPALQPAMLPS 240

Query: 239 T 239
            
Sbjct: 241 P 241


>gi|188581689|ref|YP_001925134.1| methyltransferase type 11 [Methylobacterium populi BJ001]
 gi|179345187|gb|ACB80599.1| Methyltransferase type 11 [Methylobacterium populi BJ001]
          Length = 250

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 147/243 (60%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 7   MRLDVTDLRAFYASPLGVVTHRVVGRTIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 66

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S TAL     LPL +++VD V++VH LE  E P  +L E+WR
Sbjct: 67  LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEAAVDRVILVHGLEAVESPSELLAEVWR 126

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+I+VVPN+ G+WAR + TPFG GQPYS  Q+  L+R+  F+    + +L+ PP
Sbjct: 127 VLTPGGRLILVVPNRTGVWARRDATPFGHGQPYSRSQLSRLMRDTLFSPEGWAETLYMPP 186

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVPH 238
              +  L+  + +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP 
Sbjct: 187 IRSRFWLRTAAAWERFGTGLAMPFAGLHVVDATKQLYRPVAVRQVRRLESRVPARVLVPA 246

Query: 239 TVS 241
              
Sbjct: 247 GQP 249


>gi|126725794|ref|ZP_01741636.1| hypothetical protein RB2150_06298 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704998|gb|EBA04089.1| hypothetical protein RB2150_06298 [Rhodobacterales bacterium
           HTCC2150]
          Length = 250

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 131/246 (53%), Gaps = 4/246 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ EL++FY  + LG+    AI   +   W +  G  + G G+A P    + G+  R
Sbjct: 1   MHLDVRELQRFYYRTKLGRAAQKAIRDQVVAKWPEAKGLTVAGYGFAAPMLRPYLGQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            LA MP  QG  +WP    + + L  E   P+   S+D ++++H LE +E+P  +L E  
Sbjct: 61  LLALMPGPQGVMHWPVGVPNVSLLCEESFWPVTTGSLDRLIVLHGLETSENPDAILQECH 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GGR++ +VPN+ G+W+R + TPFG G+PYS  Q+   LR A FT       LF P
Sbjct: 121 RALGPGGRVLFIVPNRAGLWSRSDKTPFGYGRPYSPIQLDKQLRAAGFTPESHKTMLFSP 180

Query: 180 PTHKKCILKLWSVFEKIGNIF-GPGFAGIYVIEARKILYQG--LPITESKKKHISSPILV 236
           P++++  LK  +++E +G         G+ ++EA K +Y      + +  ++ ++    V
Sbjct: 181 PSNRRFWLKTANLWENVGRKLGFFSAGGVLMVEASKHVYAPSGTAVKDRVRRGLTILDGV 240

Query: 237 PHTVST 242
           P T  T
Sbjct: 241 PQTAPT 246


>gi|260432835|ref|ZP_05786806.1| ATP synthase subunit [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416663|gb|EEX09922.1| ATP synthase subunit [Silicibacter lacuscaerulensis ITI-1157]
          Length = 244

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 77/237 (32%), Positives = 116/237 (48%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    AI   L   W +  G  + G G+A+P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQAAIRGRLVEFWPEAKGQTVAGFGFAVPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E   P+    VD ++++H LE +E P  +L E W
Sbjct: 61  VVGLMPGPQGVMPWPAGLPNVSVLTEETAWPIETGHVDKLVVMHGLETSERPSQLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I VVPN+ G+W+R + TPFG G PYS  Q+   LR  +F       +L+ P
Sbjct: 121 RVLGPGGRAIFVVPNRAGLWSRTDRTPFGYGHPYSATQLDKQLRAHHFVPEKHCSALYMP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPIL 235
           P+ ++  L+  S+ EK G         G+ ++EA K++          ++      L
Sbjct: 181 PSFRRFWLRSGSLIEKAGQRIPTVMAGGVLMVEASKLVRPPSGTVVKDREKRPIKAL 237


>gi|115522193|ref|YP_779104.1| methyltransferase type 11 [Rhodopseudomonas palustris BisA53]
 gi|115516140|gb|ABJ04124.1| Methyltransferase type 11 [Rhodopseudomonas palustris BisA53]
          Length = 255

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 96/240 (40%), Positives = 144/240 (60%), Gaps = 2/240 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D++ELR FYS  LG      I++ +   W    G R+LG+GY+ P+   F    ER 
Sbjct: 2   MTIDVIELRDFYSKRLGVMARRLINRGIQLHWPGAHGLRVLGMGYSTPYLGLFRKDSERC 61

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG   WP    + + LV E +LPL D++VD +L+VH LE ++DP  ++ E+WR
Sbjct: 62  LAFMPAAQGVLKWPTARPTLSTLVEECSLPLPDAAVDRILLVHALEMSDDPDGLMRELWR 121

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ +VPN+RG+WAR ++TPFG G+PYS  Q+  L+R + FT    S +LF PP
Sbjct: 122 VLAPSGRLMAIVPNRRGVWARTDNTPFGHGRPYSRSQIADLMRRSWFTPVKFSEALFLPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS--PILVPH 238
                +L+    +E+ G      FAG++++EA K + + +P    +   + S  P+LVP 
Sbjct: 182 VGHDWMLQTAPAWERFGAATSLPFAGVHLVEATKEVVRAIPARRERTMLVPSLQPVLVPT 241


>gi|149913691|ref|ZP_01902224.1| hypothetical protein RAZWK3B_10321 [Roseobacter sp. AzwK-3b]
 gi|149812811|gb|EDM72640.1| hypothetical protein RAZWK3B_10321 [Roseobacter sp. AzwK-3b]
          Length = 248

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 77/236 (32%), Positives = 124/236 (52%), Gaps = 4/236 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+ K + + W +  G  + G G+A+PF   +     R
Sbjct: 1   MHLDVQDLRNFYYRSQLGRAAQAAVRKEVLSFWPEAQGQTVAGYGFAVPFLRPYLEDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E + PL    VD +L+VH LE +E+P  +L E W
Sbjct: 61  VIGLMPGPQGVIAWPQGLPNVSVLCEETSWPLETGHVDKLLVVHGLETSENPGALLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+W+R + TPFG G+PYS  Q+ S L+  NF     + +L+ P
Sbjct: 121 RVLGPGGSALFIVPNRAGLWSRSDRTPFGFGRPYSQSQLESQLKLNNFLPLRHATTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPI 234
           P+ ++   K    +E +G         G+ ++EA K ++   P     ++ +  P+
Sbjct: 181 PSERRIWRKTSMFWEALGVKMSVVLSGGVLLVEATKRVHA--PSGPGLRETVRKPL 234


>gi|114706739|ref|ZP_01439639.1| hypothetical protein FP2506_18024 [Fulvimarina pelagi HTCC2506]
 gi|114537687|gb|EAU40811.1| hypothetical protein FP2506_18024 [Fulvimarina pelagi HTCC2506]
          Length = 307

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 116/236 (49%), Positives = 150/236 (63%), Gaps = 2/236 (0%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           DI++LR FY S LG     AI   L+  W  ++  RL+ +GY  P+   F G  ER LAF
Sbjct: 58  DIIDLRDFYHSPLGIQAARAIGLSLAPLWKPISDERLVSIGYGTPYLDRFAGDAERALAF 117

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           MPA QGA  WP    S TALV   NLPL D+S+D VL+ H LEFAE P   L +IWR+L 
Sbjct: 118 MPAPQGAACWPHGGPSRTALVGPENLPLGDASIDRVLVSHALEFAESPEAFLEDIWRILA 177

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
            GGR+++VVPN+RG+WAR EHTPFGSG+P+S  Q+  LLR   FT +  S +LFFPP  K
Sbjct: 178 PGGRLVIVVPNRRGVWARFEHTPFGSGRPWSRGQLQRLLRATMFTPATFSEALFFPPFRK 237

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES--KKKHISSPILVP 237
           + +L      E+ G    P FAG+ V++A K LY+G+P+T     +K IS P+LVP
Sbjct: 238 RSLLSASLPLERFGRRAWPVFAGVVVVDAVKQLYRGVPVTTREMARKRISKPVLVP 293


>gi|288962844|ref|YP_003453138.1| SAM-dependent methyltransferase [Azospirillum sp. B510]
 gi|288915110|dbj|BAI76594.1| SAM-dependent methyltransferase [Azospirillum sp. B510]
          Length = 273

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 93/239 (38%), Positives = 138/239 (57%), Gaps = 1/239 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LR+FY S LG+     I + +   W D+    +LG+GY  P+   F G+ +R 
Sbjct: 1   MYTDIVDLREFYESGLGRTAQRMIRRRIRAIWPDLHDQIVLGIGYTTPYLRPFMGEADRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG + WP +     AL  E +LP  D+++D VL+VH LE  E    M+ EIWR
Sbjct: 61  VAVMPASQGVSFWPAEGPGMVALGDEADLPFGDNTIDRVLLVHGLEGTEQLRPMMREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ VVPN+RG+WAR + TPFG G PYS  Q+  +LR+  F    T  +LF PP
Sbjct: 121 VLAGGGRVLAVVPNRRGLWARADWTPFGHGFPYSSSQLKQVLRDTMFVPERTRHALFIPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                + K    +E++G  +   FAG+ +IEA K ++ G+    + ++ +   ++VP  
Sbjct: 181 LRSHFLQKTAPAWEEVGGRWFKAFAGVTMIEASKQIFAGV-SRRAAQQPVKRRLIVPLP 238


>gi|220920491|ref|YP_002495792.1| type 11 methyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219945097|gb|ACL55489.1| Methyltransferase type 11 [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 147/241 (60%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VD+ +LR FYS  LG  T   + + +      V G R+LGLGYA+P+        ERT
Sbjct: 1   MSVDVTDLRAFYSGPLGAVTQRLVGRTVHRFLGSVAGLRVLGLGYAVPYLGPVRHAAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S++ALV    +PL +++VD V++VH +E  E P  +L E+WR
Sbjct: 61  LAFMPAMQGVVNWPATGRSASALVDPTMMPLPEAAVDRVILVHAIEAVESPAELLQEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+++VVPN+RG+WAR + TPFG GQPYS  Q+  L+RE  F+    + +L+ PP
Sbjct: 121 VLTPGGRLVLVVPNRRGLWARRDATPFGHGQPYSRSQLGRLMRETLFSPEGWAETLYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                 L+  S +E++G      FAG++V++A K L++ + +   +   + +P+LVP   
Sbjct: 181 VEGWITLRTASAWERVGTSLSLPFAGLHVVDAIKQLHRPVTVQARRAARLRAPVLVPAPA 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|121601849|ref|YP_988396.1| putative SAM-dependent methyltransferase protein [Bartonella
           bacilliformis KC583]
 gi|120614026|gb|ABM44627.1| putative SAM-dependent methyltransferase protein [Bartonella
           bacilliformis KC583]
          Length = 244

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 139/237 (58%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ LR FY+S LG      + + L+  W ++   R+LG GY++P+ +  H + ++  A
Sbjct: 1   MDIITLRDFYASPLGTRVQTTLCEQLNIKWPNLDDKRVLGFGYSLPYLAALHARAQQCFA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QG T WP     +TALV E +LPL D+SVDC+L++H LE++E+    L+EIWRVL
Sbjct: 61  FMPANQGVTPWPCADKVATALVFEEDLPLPDASVDCILLIHALEYSENARETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G +IV+VPN+ G+WAR + TPFG GQPYS  Q++ L  E NF +      + + P  
Sbjct: 121 APNGHLIVIVPNRCGLWARNDRTPFGYGQPYSRQQIVRLFEETNFIVRSVQEIVHYMPFS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
            +        +E +     P F G+ + + +K +YQGL +   + + +  P+L P  
Sbjct: 181 GRVSRLFSLFYEPLARYLFPYFGGLLMCQVQKRVYQGLFVQRRQSRRVFIPVLSPQA 237


>gi|89053534|ref|YP_508985.1| hypothetical protein Jann_1043 [Jannaschia sp. CCS1]
 gi|88863083|gb|ABD53960.1| hypothetical protein Jann_1043 [Jannaschia sp. CCS1]
          Length = 253

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 124/243 (51%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+V+LRQFY  + LG+    A+ + +   W +  G  ++G G+A+P    +  +  R
Sbjct: 1   MHLDVVDLRQFYYRTPLGRIAQKAVRERVVEMWPNAKGETVVGFGFAVPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG   WP    + + L  EG  P+     D ++ +H LE +E P  +L E  
Sbjct: 61  VIGVMPAEQGVMPWPAGLDNVSLLCREGLWPIQTGQADKLICLHGLETSEHPASVLDECQ 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + L   +F     S +LF P
Sbjct: 121 RALAPGGRAMFIVPNRTGLWARRDGTPFGFGRPYSLGQLEAQLEAFDFIPERHSAALFAP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGP-GFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P  K+  L+   + E++G  F P    G+ +IEA K +        +++      +L  +
Sbjct: 181 PFVKRFWLQSADMLERVGTKFSPSRAGGVIIIEASKRIPARRKPGLAERVRRPLRVLEGN 240

Query: 239 TVS 241
              
Sbjct: 241 PQP 243


>gi|154245961|ref|YP_001416919.1| methyltransferase type 11 [Xanthobacter autotrophicus Py2]
 gi|154160046|gb|ABS67262.1| Methyltransferase type 11 [Xanthobacter autotrophicus Py2]
          Length = 255

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 95/235 (40%), Positives = 143/235 (60%), Gaps = 2/235 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY+  LG  T   + + + + +D+VT  R+LGLGYA P+   F  + ER 
Sbjct: 1   MFLDVVDLRNFYAQPLGIMTRRLLGRAIRSRFDNVTNLRVLGLGYATPYLGVFREEAERC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MPA QG   WP    +   L  E  LP   +S+D V+ VH LE   +   ML E+WR
Sbjct: 61  LAVMPAAQGVVRWPSAAPTLATLADETLLPFPTASMDRVVAVHALEMTPNAAEMLSEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++ VVPN+RG+WAR++ TPFG+G+P+S  Q+++LLR+A FT    + +L+ PP
Sbjct: 121 VLAPGGRLLAVVPNRRGVWARIDTTPFGNGRPFSRGQVVALLRQALFTPVGWNEALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
              +  L+    +E++G  F   F+G+ V+EA K LY+ +P  + +   +  P L
Sbjct: 181 --SRWFLRTAVAWERVGAQFSLPFSGVLVVEATKQLYRPIPARKPRLAPVLEPAL 233


>gi|255264086|ref|ZP_05343428.1| ATP synthase subunit [Thalassiobium sp. R2A62]
 gi|255106421|gb|EET49095.1| ATP synthase subunit [Thalassiobium sp. R2A62]
          Length = 259

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 125/243 (51%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+V+LR FY  S LG+     +   L   W +  G  ++G G+A+P    F G+  R
Sbjct: 1   MHLDVVDLRSFYYRSTLGRAAQKTVRNHLREMWPETKGQSVVGFGFAVPLLRPFLGEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WPD   + + L  E   P+   +VD ++++H LE ++ P  +L E W
Sbjct: 61  VVGLMPGPQGVMAWPDGADNISVLCQEMLWPIETGTVDRLVVMHGLETSDYPAALLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+W+R + TP G G+PYS  Q+ + LR+  F    T  +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRAGLWSRRDQTPLGYGRPYSLGQLETQLRKHRFVTEHTLSTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIF-GPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+H+K   K  + +E++G+        G+ ++E  K +        ++K      +L   
Sbjct: 181 PSHRKFWRKTAAFWERMGSSLPWITAGGVLMVEVSKQVAAKPRSGLTEKVRKPLRVLEGI 240

Query: 239 TVS 241
              
Sbjct: 241 ATP 243


>gi|296448079|ref|ZP_06889981.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b]
 gi|296254393|gb|EFH01518.1| Methyltransferase type 11 [Methylosinus trichosporium OB3b]
          Length = 245

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 97/240 (40%), Positives = 146/240 (60%), Gaps = 1/240 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+V+LR FY+S LG+     + +VL   W+D    R+LG+GYA P+   F  + +R 
Sbjct: 1   MALDVVDLRNFYASPLGQVARRLVGRVLRAQWEDHAALRVLGVGYATPYLVDFQARAQRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  +WP    S++ALV    +PL DSS+D +L+VH LE  E+P  +L EIWR
Sbjct: 61  LAFMPAAQGVVHWPPGARSASALVEASMMPLPDSSIDRILVVHALEVGENPRDILEEIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++++VP++ G+WAR++ TPFG G PYS  Q+ +LL+E  F       +L+ PP
Sbjct: 121 VLAPGGRVVIIVPSRSGLWARVDTTPFGHGHPYSRGQLQALLQETLFLPVFWGEALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI-SSPILVPHT 239
             +  +L+    FE+I   F    AG++V+EA K LY+      + ++ +    +L P  
Sbjct: 181 FGRASLLRSAPAFERIAGRFSLPGAGVHVVEATKQLYRPASQRRAVRRALQPIEVLAPAA 240


>gi|144897516|emb|CAM74380.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 246

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 96/236 (40%), Positives = 143/236 (60%), Gaps = 3/236 (1%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           D+V+LR FY S LG+ T   + + L   W D  G  +LGLG+A P    F  + ER +A 
Sbjct: 13  DVVDLRDFYDSGLGQTTKRLLRRHLRQLWPDTHGLCILGLGFATPLLRPFVTEAERVIAV 72

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           MPA QG  +WP +    T L  E +LPL DSS+D ++++H LE  E    M+ E+WRVL 
Sbjct: 73  MPANQGVLHWPPEGPGLTVLADESDLPLPDSSMDRIVLMHALESTEQVRAMMREVWRVLA 132

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
            GGR++++VPN+RG+WAR+E TPFG+G+PY+  Q+  LLR+  FT    S +LF PPT+ 
Sbjct: 133 DGGRLVIIVPNRRGIWARLERTPFGNGRPYTGGQLTRLLRDNMFTPVSLSGALFMPPTNS 192

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           + +L+     E++G  +    AGI+++EA K +Y   P   SK++     ++ P  
Sbjct: 193 RVLLRSAPAMEELGRRWFHTIAGIHMVEATKQIYAATPSRTSKRR---GYVIAPQG 245


>gi|163745696|ref|ZP_02153056.1| hypothetical protein OIHEL45_08895 [Oceanibulbus indolifex HEL-45]
 gi|161382514|gb|EDQ06923.1| hypothetical protein OIHEL45_08895 [Oceanibulbus indolifex HEL-45]
          Length = 248

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 122/247 (49%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   L   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQKSLRGRLLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+   +VD ++++H LE +E P  +L E W
Sbjct: 61  VMVLMPGPQGVMPWPAGMPNTSVLTEETLWPVETGAVDKLVLMHGLETSERPSELLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG+ + +VPN+ GMWAR + TPFG G+PYS  Q+ + LR+  F       +LF  
Sbjct: 121 RVLGPGGKALFIVPNRAGMWARRDRTPFGYGRPYSPGQLETQLRKHQFLPERHLGALFQF 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPIL--- 235
           P+ ++  +K   +FEK+G         G  ++EA K++Y      +      +  +L   
Sbjct: 181 PSQQRIWMKSAPLFEKVGRQMPTMMGGGAILVEATKLVYPPRGRPQRSTARRAIGVLEGI 240

Query: 236 -VPHTVS 241
             P    
Sbjct: 241 AEPQAKP 247


>gi|323136805|ref|ZP_08071886.1| Methyltransferase type 11 [Methylocystis sp. ATCC 49242]
 gi|322398122|gb|EFY00643.1| Methyltransferase type 11 [Methylocystis sp. ATCC 49242]
          Length = 248

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 144/245 (58%), Gaps = 5/245 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D+VELR FY + LG+     +S++L   W+D  G R+LG+GYA P+   F  K +R 
Sbjct: 1   MSLDVVELRAFYETALGEVARRLVSRLLRARWEDHAGLRVLGMGYATPYLGEFREKAQRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  +WP    S+TALV     PL D+S+D +L+VH LE  E P  +L E+WR
Sbjct: 61  LAFMPATQGVVHWPLDGRSATALVEASMTPLPDASIDRILLVHSLEVEEHPQDLLEEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L  GGR+++V P++ G+WAR++ TPFG G PYS  Q+ SLL+ A F       +L+ PP
Sbjct: 121 ILAPGGRVVIVAPSRTGLWARVDTTPFGHGHPYSRGQLQSLLQGAQFLPVFWGEALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS-----PIL 235
             +  +L+    FE+I   F     G++++EA K LY+ +     ++  +       P+L
Sbjct: 181 FQRASLLRSAPAFERIAGRFSLPGGGVHLVEAMKQLYRPVLRRAVRRVALPVEPELEPVL 240

Query: 236 VPHTV 240
            P   
Sbjct: 241 EPEGA 245


>gi|295687842|ref|YP_003591535.1| methyltransferase type 11 [Caulobacter segnis ATCC 21756]
 gi|295429745|gb|ADG08917.1| Methyltransferase type 11 [Caulobacter segnis ATCC 21756]
          Length = 259

 Score =  178 bits (452), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 91/241 (37%), Positives = 132/241 (54%), Gaps = 3/241 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY++ LG+     +++ +   W D  G  +LGLGYA PF         R 
Sbjct: 1   MRRDVLDLRAFYAAPLGRAARTMLTRKVEEAWGDTRGLDVLGLGYATPFLDAARANARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV E  LPL ++  D VL VH LE A+DP  +L EI R
Sbjct: 61  VAAMPAQQGVEVWPHGGRNQACLVEETALPLPNALFDRVLAVHALEEADDPAALLAEIGR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+PYS  Q+ SL+REA    +  +R+L+ PP
Sbjct: 121 VMAPTGRLIVAVSSRDGVWAGAEGTPFGHGRPYSRSQLESLIREAGLEPAGWTRALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVPHT 239
                +      FE++G    P FAG+ ++EA K  +   P     +  + +P +L+P  
Sbjct: 181 FA--AMSGWAEGFEQVGARLWPRFAGVILMEAIKQTFAVKPQGRKARARVFAPGVLLPSP 238

Query: 240 V 240
            
Sbjct: 239 A 239


>gi|110680698|ref|YP_683705.1| hypothetical protein RD1_3538 [Roseobacter denitrificans OCh 114]
 gi|109456814|gb|ABG33019.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 244

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 123/243 (50%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQMSLRSRMMEIWPEAKGQTVVGFGFAAPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE +E    +L E W
Sbjct: 61  VMALMPGPQGVMPWPSGLPNVSVLTEEVAWPIETGHVDKLVLLHGLETSERVSDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGLWARRDRTPFGYGRPYSTSQLETQLRKHQFLPERHLGALYQV 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ ++  +K  +  EKIG       A G +++EA K++Y      E K++     +L P 
Sbjct: 181 PSSQRLWMKSGAALEKIGRRMPTFIASGAFMVEATKLVYPPKGKVEPKRRVAPVGVLKPA 240

Query: 239 TVS 241
              
Sbjct: 241 AKP 243


>gi|126734142|ref|ZP_01749889.1| hypothetical protein RCCS2_08284 [Roseobacter sp. CCS2]
 gi|126717008|gb|EBA13872.1| hypothetical protein RCCS2_08284 [Roseobacter sp. CCS2]
          Length = 269

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 84/252 (33%), Positives = 125/252 (49%), Gaps = 10/252 (3%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++LR FY  S LG+     I   L T W +  G  ++G G+A+P    F     R
Sbjct: 13  MHLDVLDLRNFYYRSALGRAAQKVIRDELCTMWPEAKGQMVVGFGFALPLLRPFLKDARR 72

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  +   P+    VD ++M+H LE  E P L+L E W
Sbjct: 73  VIGLMPGPQGVMPWPADGQNVSVLCEDTLWPIETGHVDKLVMLHGLETTEQPSLLLDEAW 132

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PYS  Q+ + LR   F    T  +L+ P
Sbjct: 133 RVLGPGGRAVFIVPNRAGLWSRSDATPFGYGRPYSLSQLDAQLRRHQFVTERTMSALYQP 192

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLP--ITESKKKHIS----- 231
           P+ +K   K  S  EKIG+        G+ ++E  K +       +TE+ KK +      
Sbjct: 193 PSARKIWRKSASFLEKIGHNVPVVAAGGVLIVEVSKQMAAPTRPGLTEAVKKPLKALEGI 252

Query: 232 -SPILVPHTVST 242
             P   P    +
Sbjct: 253 AKPKPKPEAAPS 264


>gi|84500104|ref|ZP_00998370.1| hypothetical protein OB2597_09189 [Oceanicola batsensis HTCC2597]
 gi|84392038|gb|EAQ04306.1| hypothetical protein OB2597_09189 [Oceanicola batsensis HTCC2597]
          Length = 251

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 123/237 (51%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S +G+     +   L   W +  G  + G G+A+P    +    +R
Sbjct: 1   MHLDVQDLRNFYYRSTVGRAAQTQVRAELLRLWPEAHGQTVAGFGFAVPLLRPYLADSKR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG  NWP    + + L  E   P+    VD ++++H LE +E+P  +L E +
Sbjct: 61  VIALMPGPQGVMNWPQGMPNISVLSEETRWPVETGHVDRLVVLHGLETSENPSDLLEECF 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG+ + +VP++ G+W+R + TPFG G+PYS  Q+ + L+  +F       +L+ P
Sbjct: 121 RVLGPGGKAVFIVPHRAGLWSRSDRTPFGYGRPYSQGQLEAQLKRHSFLPERHVHTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPIL 235
           P+HK+   K    +EK+G  F      G+ ++EA K ++      E   +     +L
Sbjct: 181 PSHKRFWRKTAPFWEKMGKSFSMILSGGVLMVEASKRVHMPSGPGERVNRPSRLKVL 237


>gi|209967191|ref|YP_002300106.1| hypothetical protein RC1_3952 [Rhodospirillum centenum SW]
 gi|209960657|gb|ACJ01294.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 251

 Score =  178 bits (450), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 135/243 (55%), Gaps = 1/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V+LR+FY   LG+     I + +   W DVTG R+LG+GYA P+   F  + ER 
Sbjct: 1   MYSDVVDLREFYEGSLGQVVRRLIRRRVRELWPDVTGQRVLGIGYATPYLRPFRDEAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MPA QG   WP +      L  E  LPL D SVD VL++H LE+ E    ML E+WR
Sbjct: 61  LAMMPASQGVVFWPQEGPGLVTLTDEAELPLPDMSVDRVLLIHGLEYTEHLRPMLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+I +VPN+R +WAR + TPFG+G PYS  Q+   LR   F     S +LF PP
Sbjct: 121 VLAGGGRLIAIVPNRRSIWARSDRTPFGNGSPYSSSQLKKTLRANLFVPEKESCALFMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ-GLPITESKKKHISSPILVPHT 239
              + +L     +E+IG  +   FAG+ V+EA K +Y     +   ++  + +P   P  
Sbjct: 181 ARSRFLLAGAGAWEEIGARWFKAFAGVIVVEASKQIYASAGRVKAPERSRLLAPAARPVF 240

Query: 240 VST 242
             +
Sbjct: 241 GRS 243


>gi|56697999|ref|YP_168370.1| hypothetical protein SPO3167 [Ruegeria pomeroyi DSS-3]
 gi|56679736|gb|AAV96402.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 250

 Score =  178 bits (450), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 125/249 (50%), Gaps = 10/249 (4%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+   L   W +  G  + G G+A+P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQAAVRGRLLEIWPEAKGQTVAGFGFAVPLLRPYLTQARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG  +WP    + + L  E   P+    VD ++++H LE +E P  +L E W
Sbjct: 61  VIGLMPGPQGVMHWPAGMANVSVLCEETLWPIETGHVDRLVVMHGLETSEHPTQVLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I VVPN+ G+W+R + TPFG G+PY+  Q+ + LR+  F       +L+ P
Sbjct: 121 RVLGPGGRAIFVVPNRAGLWSRSDKTPFGFGRPYTLGQLETQLRKHQFLPEFHCSALYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKI--------LYQGLPITESKKKHI 230
           P+ K+  LK  ++ E+ G         G++++E  K         +    P      + +
Sbjct: 181 PSFKRFWLKSGALIERTGTRLPTIMAGGVFMVEVSKQTNPQKGNMIRAKTPGRIRVLEGL 240

Query: 231 SSPILVPHT 239
           S+P+  P +
Sbjct: 241 SNPMPEPAS 249


>gi|221233491|ref|YP_002515927.1| methyltransferase [Caulobacter crescentus NA1000]
 gi|220962663|gb|ACL94019.1| methyltransferase [Caulobacter crescentus NA1000]
          Length = 268

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 90/241 (37%), Positives = 132/241 (54%), Gaps = 3/241 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY+S LG+     +++ +   W D     +LG+GYA PF      K  R 
Sbjct: 1   MRRDVLDLRAFYASPLGRVARTMLTRKVEEAWGDTRDLDVLGVGYATPFLDAARAKARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV +  LPL ++  D VL VH LE A+DP  +L EI R
Sbjct: 61  VAAMPAQQGVEVWPQGGRNQACLVEDAALPLPNALFDRVLAVHALEEADDPAALLAEIGR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+PYS  Q+ SL+REA    +  +R+L+ PP
Sbjct: 121 VMAPTGRLIVAVSSRDGVWAGAERTPFGHGRPYSRSQLESLIREAELEPAGWTRALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVPHT 239
                +      FE++G    P FAG+ ++EA K  +   P     +  + +P +L+P  
Sbjct: 181 LA--AMSSWAEGFEQVGATLWPRFAGVILMEAIKQTFAVKPRGHRARARVFAPGVLLPSP 238

Query: 240 V 240
            
Sbjct: 239 A 239


>gi|163737809|ref|ZP_02145226.1| hypothetical protein RGBS107_19798 [Phaeobacter gallaeciensis
           BS107]
 gi|161389335|gb|EDQ13687.1| hypothetical protein RGBS107_19798 [Phaeobacter gallaeciensis
           BS107]
          Length = 248

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 125/247 (50%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W +  G  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLLELWPEAAGQTVAGFGFAAPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L +E   P+    VD ++++H LE ++ P  +L E W
Sbjct: 61  VIALMPGPQGVMQWPAGMPNVSVLCAETAWPIETGHVDRLVLLHGLETSDRPSHLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+   S +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRAGLWARSDVTPFGFGRPYTLSQVENQLRLHQFTVERHSAALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQ----GLPITESKKKHISSPI 234
           P+ ++  LK   +FE++G+        G++++E  K ++        +       +   +
Sbjct: 181 PSQRRFWLKSGPLFERMGDRLPAMLGGGVFLVEVSKQVHSQRGEMTRLRPPSPIRVLEGL 240

Query: 235 LVPHTVS 241
             P    
Sbjct: 241 SNPLPEP 247


>gi|163732299|ref|ZP_02139745.1| hypothetical protein RLO149_02572 [Roseobacter litoralis Och 149]
 gi|161394597|gb|EDQ18920.1| hypothetical protein RLO149_02572 [Roseobacter litoralis Och 149]
          Length = 244

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 123/243 (50%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQMSLRSRMMEIWPEAKGQTVVGFGFAAPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE +E    +L E W
Sbjct: 61  VMALMPGPQGVMPWPSGLPNVSVLTEEVAWPIETGHVDKLVLLHGLETSERASDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGLWARRDRTPFGYGRPYSTSQLETQLRKHQFLPERHLGALYQV 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFA-GIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ ++  +K  +  EKIG       A G +++EA K++Y      E K++     +L P 
Sbjct: 181 PSSQRLWMKSGAALEKIGRRMPTFIASGAFMVEATKLVYPPKGKVEPKRRVAPVSVLKPS 240

Query: 239 TVS 241
              
Sbjct: 241 VKP 243


>gi|312115066|ref|YP_004012662.1| methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220195|gb|ADP71563.1| Methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
          Length = 263

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 100/235 (42%), Positives = 134/235 (57%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+  LR FY+S LG+     I+  +   WD+V+G  ++GLGYA P+   F G+   T
Sbjct: 1   MYDDVTHLRDFYASPLGQHARRIIAHRVRARWDNVSGLDVVGLGYAAPYLRIFSGEARTT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A MP  QGA  WP +     ALVS+  LP+ D SVDCVL+VH LE  +     L EIWR
Sbjct: 61  AALMPYRQGAVQWPSEGPFRAALVSDTELPMRDKSVDCVLVVHGLEHVDARHNYLREIWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+I+V PN+RG WAR E TPFG G+PYS  QM  LLR+A F     +  LF PP
Sbjct: 121 VLMPHGRLILVAPNRRGAWARFESTPFGHGRPYSLRQMEDLLRDALFEPVGVTPCLFAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
              + +    + +E+ G    P FAG+ ++EA K+ Y  + ++  K    S P L
Sbjct: 181 FRARYLPFAATAWERAGAGLWPAFAGVLIVEAVKLAYAEIRVSVKKPAFASMPAL 235


>gi|319899470|ref|YP_004159567.1| enzyme [Bartonella clarridgeiae 73]
 gi|319403438|emb|CBI77006.1| putative enzyme [Bartonella clarridgeiae 73]
          Length = 244

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 141/237 (59%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W ++   R++GLGYA+P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGMRVQMTLCDQLNAFWPNLIDKRIMGLGYALPYLSVLRKRAKQCYA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+S+DCVL+VH LE+ E+    L+EIWR+L
Sbjct: 61  FMPASQGASPWPCSDKVATALVFEEDLPLPDASIDCVLLVHALEYTENSRQTLNEIWRIL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+I++VPN+ G+WAR +HTPFG G+PYS  Q++ L +E NF +      + + P+ 
Sbjct: 121 IPNGRLIIIVPNRCGLWARNDHTPFGYGEPYSRQQVVRLFQETNFIIESVQEVVHYMPSS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                     +E + +   P F G+ +  A+K +YQ L +   + + +  P L P T
Sbjct: 181 SYVSRLFSFFYESLASHIFPYFGGLLMCSAQKRVYQDLLVHCRQSRRVFIPTLTPQT 237


>gi|16124775|ref|NP_419339.1| hypothetical protein CC_0520 [Caulobacter crescentus CB15]
 gi|13421703|gb|AAK22507.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 284

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 90/241 (37%), Positives = 132/241 (54%), Gaps = 3/241 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D+++LR FY+S LG+     +++ +   W D     +LG+GYA PF      K  R 
Sbjct: 17  MRRDVLDLRAFYASPLGRVARTMLTRKVEEAWGDTRDLDVLGVGYATPFLDAARAKARRV 76

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG   WP    +   LV +  LPL ++  D VL VH LE A+DP  +L EI R
Sbjct: 77  VAAMPAQQGVEVWPQGGRNQACLVEDAALPLPNALFDRVLAVHALEEADDPAALLAEIGR 136

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V+   GR+IV V ++ G+WA  E TPFG G+PYS  Q+ SL+REA    +  +R+L+ PP
Sbjct: 137 VMAPTGRLIVAVSSRDGVWAGAERTPFGHGRPYSRSQLESLIREAELEPAGWTRALYVPP 196

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVPHT 239
                +      FE++G    P FAG+ ++EA K  +   P     +  + +P +L+P  
Sbjct: 197 LA--AMSSWAEGFEQVGATLWPRFAGVILMEAIKQTFAVKPRGHRARARVFAPGVLLPSP 254

Query: 240 V 240
            
Sbjct: 255 A 255


>gi|163742885|ref|ZP_02150269.1| hypothetical protein RG210_12225 [Phaeobacter gallaeciensis 2.10]
 gi|161383849|gb|EDQ08234.1| hypothetical protein RG210_12225 [Phaeobacter gallaeciensis 2.10]
          Length = 248

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 125/247 (50%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W +  G  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLLELWPEAAGQTVAGFGFAAPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L +E   P+    VD ++++H LE ++ P  +L E W
Sbjct: 61  VIALMPGPQGVMQWPAGMPNVSVLCAETAWPIETGHVDRLVLLHGLETSDRPSHLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+   S +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRAGLWARSDVTPFGFGRPYTLSQVENQLRLYQFTVERHSAALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQ----GLPITESKKKHISSPI 234
           P+ ++  LK   VFE++G+        G+++IE  K ++        +       +   +
Sbjct: 181 PSQRRFWLKSGPVFERMGDRLPAMLGGGVFLIEVSKQVHSQRGEMTRLRPPSPIRVLEGL 240

Query: 235 LVPHTVS 241
             P    
Sbjct: 241 SNPLPEP 247


>gi|84514772|ref|ZP_01002135.1| hypothetical protein SKA53_11148 [Loktanella vestfoldensis SKA53]
 gi|84510931|gb|EAQ07385.1| hypothetical protein SKA53_11148 [Loktanella vestfoldensis SKA53]
          Length = 254

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 120/247 (48%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++LR FY  S LG+     I   L T W +  G  + G G+A+P    +     R
Sbjct: 1   MHLDVLDLRNFYYRSALGRAAQQVIRNELVTLWPEAKGQVVAGFGFAVPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP +  + + L  +   P+    +D ++++H LE +E P  +L E+W
Sbjct: 61  VIGLMPGPQGVMPWPPEGRNVSILCEDTLWPIETGHIDKLVVMHGLETSEHPTALLDEMW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR +VVVPN+ G+W+R + TPFG G+PYS  Q+ + LR+  F    T  +LF P
Sbjct: 121 RVLGPGGRAVVVVPNRAGLWSRTDKTPFGYGRPYSLTQLDAQLRKHRFVTERTLSTLFQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGP-GFAGIYVIEARKILYQGLPITESKKKHISSPIL--- 235
           P+  +   +  ++FE++G         G+ ++E  K           +        L   
Sbjct: 181 PSRSRFWRRSAAMFERVGPKIPVIAAGGVLMVEVTKQSAAPTRPGLKEAVRRPLKALEGI 240

Query: 236 -VPHTVS 241
             P    
Sbjct: 241 TAPQPKP 247


>gi|86136459|ref|ZP_01055038.1| hypothetical protein MED193_20089 [Roseobacter sp. MED193]
 gi|85827333|gb|EAQ47529.1| hypothetical protein MED193_20089 [Roseobacter sp. MED193]
          Length = 269

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 122/247 (49%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   L   W +  G  + G G+A P    +  +  R
Sbjct: 22  MHLDVQDLRNFYYRSTLGRAAQASVRNRLLEFWPEAAGQTVAGFGFAAPLMRPYLAEARR 81

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    VD ++++H LE +E P  +L E  
Sbjct: 82  VIALMPGPQGVMQWPAGMPNVSVLCEETSWPIETGRVDRLVVMHGLETSERPTQVLEECR 141

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I VVPN+ G WAR + TPFG G+PY+  Q+ + LR   FT+   + +L+  
Sbjct: 142 RVLGPGGRAIFVVPNRAGFWARSDQTPFGYGRPYTLIQLENQLRLHEFTIERHAAALYRL 201

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQ----GLPITESKKKHISSPI 234
           P+ ++  LK  ++FE+IG         G++++E  K  +        +  +    +   +
Sbjct: 202 PSQRRFWLKSGALFERIGRQLPAMLAGGVFMVEVSKQTHPQHGHMTKVKRANPIRVLEGL 261

Query: 235 LVPHTVS 241
             P    
Sbjct: 262 SNPLPEP 268


>gi|254475575|ref|ZP_05088961.1| ATP synthase subunits region ORF 4 [Ruegeria sp. R11]
 gi|214029818|gb|EEB70653.1| ATP synthase subunits region ORF 4 [Ruegeria sp. R11]
          Length = 248

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 123/247 (49%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W + TG  + G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLRDLWPEATGQTVAGFGFAAPLLRPYLKDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    VD ++++H LE ++ P  +L E W
Sbjct: 61  VMALMPGPQGVMQWPAGMANVSVLCEETAWPIETGHVDRLVLLHGLETSDRPSHLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+     +L+ P
Sbjct: 121 RVLGPGGRAVFVVPNRSGLWARSDDTPFGFGRPYTLSQVENQLRLHQFTIERHLGALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILY----QGLPITESKKKHISSPI 234
           P+ ++  L+   +FE++G+        G++++E  K  +    +   +       +   +
Sbjct: 181 PSQRRFWLRAGPLFERLGDRLPAMLGGGVFLVEVSKQTHIQRGEMTRLKPPNPIRVLEGL 240

Query: 235 LVPHTVS 241
             P    
Sbjct: 241 SNPMPEP 247


>gi|254441570|ref|ZP_05055063.1| hypothetical protein OA307_985 [Octadecabacter antarcticus 307]
 gi|198251648|gb|EDY75963.1| hypothetical protein OA307_985 [Octadecabacter antarcticus 307]
          Length = 266

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/238 (31%), Positives = 119/238 (50%), Gaps = 4/238 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR+FY  S LG+     +   L   W +  G  + G G+A+P    +     R
Sbjct: 19  MHLDVHDLREFYYRSPLGRAAQKVVRDELVRLWPEAKGQTVAGFGFAVPLLRPYLADSRR 78

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WPD   + + L  +   PLA  SVD ++++H LE ++ P  +L E W
Sbjct: 79  VIALMPGPQGVMPWPDNKPNVSVLCEDTLWPLASGSVDKLVLLHGLETSDTPMALLDECW 138

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PYS  Q+   LR+       T  +L+ P
Sbjct: 139 RVLGPGGRAVFIVPNRTGLWSRSDATPFGFGRPYSLGQLEKQLRDVGLIPVNTLSTLYQP 198

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
           P+ +K   +     E  G         G+ ++EA K +    P      + +  P+ V
Sbjct: 199 PSARKIWRQFAKAMEGAGRHIPVFAAGGVLMVEAAKQV--PQPRRPGLAEAVKRPLRV 254


>gi|89069068|ref|ZP_01156449.1| hypothetical protein OG2516_17316 [Oceanicola granulosus HTCC2516]
 gi|89045437|gb|EAR51502.1| hypothetical protein OG2516_17316 [Oceanicola granulosus HTCC2516]
          Length = 253

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/244 (30%), Positives = 116/244 (47%), Gaps = 4/244 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY    LG+     I   L   W D  G  ++G G+A P    F     R
Sbjct: 1   MHLDVTDLRSFYYRKALGRAVQRVIRDELRRMWPDTKGQMVVGFGFAAPLLRPFLDDSRR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG  +WP    + + L  +   P+    VD ++M+H LE ++ P  +L E W
Sbjct: 61  VIALMPGPQGVMHWPAGQPNVSVLCEDTLWPIQTGQVDRLVMLHGLETSDHPGALLEEAW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+P+S  Q+ S LR   F +     +L+ P
Sbjct: 121 RVLGPGGRAVFIVPNRAGLWSRSDRTPFGYGRPFSRTQLESQLRRHRFQVDHVVSTLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF--AGIYVIEARKILYQGLPITESKKKHISSPILVP 237
           P+ ++   +     E +G    P F   G+ ++EA K +        S        +L  
Sbjct: 181 PSDRRGWRRAAGWMEGVG-RHVPVFKTGGVLMVEASKQVAAPTRPGLSDAVKRPFEVLEG 239

Query: 238 HTVS 241
               
Sbjct: 240 MGAP 243


>gi|126739848|ref|ZP_01755539.1| hypothetical protein RSK20926_14209 [Roseobacter sp. SK209-2-6]
 gi|126719080|gb|EBA15791.1| hypothetical protein RSK20926_14209 [Roseobacter sp. SK209-2-6]
          Length = 269

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 117/247 (47%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   L   W    G  + G G+A P    +     R
Sbjct: 22  MHLDVQDLRNFYYRSTLGRAAQASVRNRLLEFWPTAGGQTVAGFGFAAPLLRPYLKDARR 81

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E   P+    +D ++++H LE +E P  +L E W
Sbjct: 82  VIALMPGPQGVMQWPAGQPNVSVLCEETLWPIDTGRIDRLVVMHGLETSERPTRLLEECW 141

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           R L  GGR I VVPN+ G WAR + TPFG G+PY+  Q+ + LR   F +   + +L+  
Sbjct: 142 RCLGPGGRAIFVVPNRAGFWARSDKTPFGYGRPYTLVQLENQLRLHEFAIERHAAALYRL 201

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQ----GLPITESKKKHISSPI 234
           P+ ++  LK  ++FE+ G         G++++E  K  +        I  +    +   +
Sbjct: 202 PSSRRFWLKSGALFERFGRRIPAMLAGGVFMVEVSKQTHSQKGHMTRIRPANPIRVLEGL 261

Query: 235 LVPHTVS 241
             P    
Sbjct: 262 SNPMPEP 268


>gi|84683663|ref|ZP_01011566.1| hypothetical protein 1099457000264_RB2654_19858 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84668406|gb|EAQ14873.1| hypothetical protein RB2654_19858 [Rhodobacterales bacterium
           HTCC2654]
          Length = 260

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 80/247 (32%), Positives = 122/247 (49%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTW-DDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M +D  +LR FY  S LG+     I   +   W     G  +LG G+A P    F     
Sbjct: 1   MHLDAQDLRAFYYRSALGRVAQKNIRDEVCRLWSGSAKGQTVLGYGFAAPLLRPFLADAR 60

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           R +A MPA QG   WP    + + L  E   P+     D ++M+H LE + +   +L E 
Sbjct: 61  RVIALMPAPQGVMAWPAGMPNVSVLCEEVLWPIDTGVADKLIMLHGLETSTNAPTLLDEA 120

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           +RVL  GGR + +VPN+ G+W+R ++TPFG G+PYS  Q+   LR+  F +   S +L+ 
Sbjct: 121 YRVLGPGGRALFIVPNRAGLWSRSDNTPFGYGRPYSTGQLEHQLRDHGFAIERHSAALYQ 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL----YQGLPITESKKKHISSPI 234
           PPTH++  LK   ++EK+G        G+ ++EA K +      GLP    +   +   +
Sbjct: 181 PPTHRRFWLKTGPMWEKVGAGAPRMAGGVLLVEASKQVKAQHRPGLPEAVKRPLSVLEGL 240

Query: 235 LVPHTVS 241
             P    
Sbjct: 241 GAPEPGR 247


>gi|240851351|ref|YP_002972754.1| putative methyltransferase [Bartonella grahamii as4aup]
 gi|240268474|gb|ACS52062.1| putative methyltransferase [Bartonella grahamii as4aup]
          Length = 256

 Score =  174 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 94/236 (39%), Positives = 135/236 (57%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LG      +   L+  W D+T  R++GLGYA+P+ S    + ++  A
Sbjct: 11  LDIVTLKDFYASALGLRVQKTLCDQLNLWWPDLTDKRIMGLGYALPYLSTLRERAQQCFA 70

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+SVDC+L+VH LE+ E+ F  L+EIWRVL
Sbjct: 71  FMPASQGASPWPCAEQVATALVFEEDLPLPDASVDCILLVHALEYTENSFETLNEIWRVL 130

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G +IV+VPN+ G WAR   TPFG G+PYS  Q+  L  + NF        + + P+ 
Sbjct: 131 APNGHLIVIVPNRSGFWARNITTPFGYGEPYSRQQITRLFEKTNFVSGPIQEIVHYMPST 190

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
                     +E       P F G+ + +A+K +YQGL +   + + +  P L P 
Sbjct: 191 GYVSRLFSFFYEPFVRYLLPYFGGLLMCQAQKRVYQGLLVQRRQSRRVFIPALSPQ 246


>gi|260576488|ref|ZP_05844478.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259021371|gb|EEW24677.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 254

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 76/235 (32%), Positives = 121/235 (51%), Gaps = 3/235 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  + LG+    AI + +   W +  G  + G G+A+P    +     R
Sbjct: 1   MHLDVQDLRNFYYRTQLGRVAQRAIRERMLEVWPEAKGQTVAGFGFAVPLLRPYLEAARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E   P++   VD ++++H LE +E+P  +L E +
Sbjct: 61  VIGLMPGPQGVMPWPAGMENVSVLCEETRWPISTGMVDRLVLLHGLETSENPGAVLEESY 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ GMWAR + TPFG G PYS  Q+ S L+   FT      +L+ P
Sbjct: 121 RVLGPGGRALFVVPNRSGMWARADGTPFGFGHPYSLGQLESQLKYYGFTPERHLSALYSP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKIL-YQGLPITESKKKHISS 232
           P+ ++  L   + +E  G  F P   AG+ ++EA K +      +    ++ +  
Sbjct: 181 PSERRFWLGTAAFWENAGQKFAPWLAAGVLMVEASKQIPAPMRGLGAMVRRPLKV 235


>gi|254465111|ref|ZP_05078522.1| ATP synthase subunits region ORF 4 [Rhodobacterales bacterium Y4I]
 gi|206686019|gb|EDZ46501.1| ATP synthase subunits region ORF 4 [Rhodobacterales bacterium Y4I]
          Length = 248

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 122/247 (49%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W +  G  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGRLLELWPEAEGLTVAGFGFAAPLLRPYLAEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    +D ++++H LE +E P  +L E W
Sbjct: 61  VMALMPGPQGVMQWPAGMPNVSVLCEETSWPVDTGRIDRLVLLHGLETSERPSRLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR I +VPN+ G WAR + TPFG G+PY+  Q+   LRE  F +   + +L+  
Sbjct: 121 RVLGPGGRAIFIVPNRAGFWARSDLTPFGYGRPYTLRQLEGQLREHQFAIEQHTAALYRL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQ----GLPITESKKKHISSPI 234
           P+HK+  LK  ++ EK+G         G++++E  K  Y      +      +  +   +
Sbjct: 181 PSHKRFWLKSGAMLEKMGRKLPAMLAGGVFMVEVSKQTYPQKGHMIRSKTPSRIRVLEGL 240

Query: 235 LVPHTVS 241
             P    
Sbjct: 241 SNPMPEP 247


>gi|239787494|emb|CAX83964.1| SAM-dependent methyltransferase [uncultured bacterium]
          Length = 247

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 5/246 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+V+LR FY   LG+     I + +   W DVTG R+ GLG+A P+   F G+ ER 
Sbjct: 1   MWTDVVDLRDFYDGSLGQVARRMIRRRIRLIWPDVTGFRMAGLGFATPYLRSFKGEAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MP+ QGA +WP+       L  E +LPL D S+D +L++H LE  E    ++ E+WR
Sbjct: 61  LAVMPSSQGALSWPEGEPGLVVLAEETDLPLPDRSIDRLLLIHALESTEQVRALMREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR++VVVP++RG+WA++E TPFG+G+PY+  Q+  LLREA FT   T  +LF PP
Sbjct: 121 VLADGGRLLVVVPSRRGLWAQVERTPFGAGRPYTASQIDVLLREAMFTPIRTESALFVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-----KHISSPIL 235
           +  + ++K    +EKIG  + PGFAG+ ++EA K +Y         +        S  ++
Sbjct: 181 SRSRMLMKSAPAWEKIGARWFPGFAGVLLVEAAKQIYAAPLNRALSRNQRNAVSGSRTVI 240

Query: 236 VPHTVS 241
            P T  
Sbjct: 241 TPQTRR 246


>gi|297172498|gb|ADI23470.1| SAM-dependent methyltransferases [uncultured nuHF1 cluster
           bacterium HF0770_35I22]
          Length = 244

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 92/228 (40%), Positives = 135/228 (59%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+ +L+ FY S LGK     I + +   W +++   +LGLGY IP+ + F  +  R 
Sbjct: 2   MWTDVADLKNFYDSNLGKMACSLIQRQVRHLWPNLSREHVLGLGYPIPYLAHFIEEAYRV 61

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A MPA QG   WP    +   LV+E  +P +D+++D VL+VH  EF++     L EIWR
Sbjct: 62  TAAMPASQGTIKWPLHKPNLATLVNELEMPFSDNTIDKVLLVHGAEFSQQIRPFLREIWR 121

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L S G +I+VVPN+RG+WAR EHTPFG G PYS  Q+  LL+   FT + T  ++ FPP
Sbjct: 122 ILKSSGHVIIVVPNRRGLWARFEHTPFGRGLPYSAGQLSKLLQANMFTPTNTRWAICFPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
              + IL      EKI +     FAG+ ++EA K +Y G P++ S+++
Sbjct: 182 VRSQLILSAAPTIEKISSSVLSNFAGVIIVEAVKQIYAGQPLSTSQQR 229


>gi|170747349|ref|YP_001753609.1| methyltransferase type 11 [Methylobacterium radiotolerans JCM 2831]
 gi|170653871|gb|ACB22926.1| Methyltransferase type 11 [Methylobacterium radiotolerans JCM 2831]
          Length = 244

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 101/243 (41%), Positives = 146/243 (60%), Gaps = 2/243 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D+  LR FY+S LG+ T   + + L      V+G R+LG+GYA P+    H   ERT
Sbjct: 1   MRLDVNGLRAFYASPLGRTTHRVVGRALHDFLGSVSGLRVLGIGYATPYLGPVHCIAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    S  AL     +PL ++++D V++VH LE  E P  +L E+WR
Sbjct: 61  LAFMPASQGVVNWPSTGRSCAALADPTMMPLPEAAIDRVILVHALESVESPTELLQEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            LT GGRMI+VVPN+RG+WAR E TPFG GQPYS  Q+  L+RE  F+    + +L+ PP
Sbjct: 121 TLTPGGRMILVVPNRRGVWARREATPFGHGQPYSRSQLGRLMRETLFSPVSWAETLYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE--SKKKHISSPILVPH 238
              + +L+    +E +G      FAG++V++A K LY+ + + +    ++   + +LVP 
Sbjct: 181 ARSRLMLRTGPAWEWLGTGLSLPFAGLHVVDATKQLYRPVAVQQVRRARRLAPARVLVPA 240

Query: 239 TVS 241
              
Sbjct: 241 PSP 243


>gi|254511707|ref|ZP_05123774.1| hypothetical protein RKLH11_2248 [Rhodobacteraceae bacterium KLH11]
 gi|221535418|gb|EEE38406.1| hypothetical protein RKLH11_2248 [Rhodobacteraceae bacterium KLH11]
          Length = 244

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/236 (33%), Positives = 118/236 (50%), Gaps = 4/236 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    AI   L   W +  G  ++G G+A+P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQAAIRGRLVDLWPEAKGQTVVGFGFAVPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + + L  E   PL    VD ++++H LE +  P  +L E W
Sbjct: 61  VIGLMPGPQGVMPWPAGMPNVSVLTEETMWPLETGHVDKLVVMHGLETSSRPTQLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + VVPN+ G+W+R + TPFG GQPYS  Q+   LR  +F       +L+ P
Sbjct: 121 RVLGPGGRALFVVPNRAGLWSRSDRTPFGFGQPYSATQLEKQLRAHHFVPENHCSALYLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLP--ITESKKKHISS 232
           P+ ++  LK  S+ EK G         G+ ++E  K +         ++ K+ I +
Sbjct: 181 PSFRRFWLKSGSLIEKTGQRIPTVMAGGVLMVEVSKHIRPPSGSVTKDTAKRPIKA 236


>gi|197103901|ref|YP_002129278.1| SAM-dependent methyltransferase [Phenylobacterium zucineum HLK1]
 gi|196477321|gb|ACG76849.1| SAM-dependent methyltransferase [Phenylobacterium zucineum HLK1]
          Length = 266

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 93/240 (38%), Positives = 127/240 (52%), Gaps = 2/240 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D++ELR+FY+S LG      + + L   W D  G  +L +GY  PF   F     R 
Sbjct: 1   MRRDVLELRRFYASDLGGAARTMVQRKLVEAWGDARGLDVLAVGYGTPFVGTFRPAARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A MPA QG   WP    +   L  E  LP A++  D +L+VH +E + DP  +L E+WR
Sbjct: 61  AAAMPAQQGVEVWPAGGRNLATLTPEDALPFANALFDRILVVHAIEESADPVALLREVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR+IV V ++ GMWA  E TPFG G+PYS  Q+  LLREA    S  +R+L+ PP
Sbjct: 121 VLAPSGRVIVTVASRNGMWANTEKTPFGHGRPYSRAQLAELLREAELEPSGWTRALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                + +    FE+ G+   PGFAG+ ++EA K  +   P     K     P+L P   
Sbjct: 181 V--GWMARWAEGFEQAGSRLWPGFAGLLLMEAVKQTFAVKPKGARAKAKAVRPVLAPSPA 238


>gi|83594599|ref|YP_428351.1| hypothetical protein Rru_A3269 [Rhodospirillum rubrum ATCC 11170]
 gi|83577513|gb|ABC24064.1| conserved hypothetical protein [Rhodospirillum rubrum ATCC 11170]
          Length = 264

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 95/239 (39%), Positives = 138/239 (57%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  D+++LR FY++  G+ T   I + L   W +V GCR+LGLGYA+PF   F  + ER 
Sbjct: 5   MWSDVIDLRDFYATSQGQLTRRLIGRSLRALWPEVRGCRVLGLGYAVPFLQPFADEAERV 64

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA  GA  WP       AL  E  LPL D S+D +L++H LEFA+    +L E WR
Sbjct: 65  VAMMPAPMGAVRWPSVGPVQGALADELELPLPDRSIDRLLLIHGLEFADHAHGLLRECWR 124

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++VVVPN+R  WARME +PF +GQPYS  Q+  LLR+  FT   +S +LF PP
Sbjct: 125 VLADNGRLMVVVPNRRATWARMERSPFANGQPYSEGQLTRLLRDRLFTPIASSTALFMPP 184

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           +  + ++   S+ E+IG    P F G+ V++  K +   +  +    + +   + +   
Sbjct: 185 SRSRMVMGSASLLEQIGCRLFPAFGGVVVVDCAKQIAAPVLRSAVASRRVYVGVGLSQP 243


>gi|159045478|ref|YP_001534272.1| hypothetical protein Dshi_2938 [Dinoroseobacter shibae DFL 12]
 gi|157913238|gb|ABV94671.1| conserved hypohtetical protein [Dinoroseobacter shibae DFL 12]
          Length = 256

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 125/242 (51%), Gaps = 2/242 (0%)

Query: 2   RVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
            +D+++LRQFY  + LG+    AI   L   W D  G  ++G G+A+P    +     R 
Sbjct: 10  HLDVLDLRQFYYRTRLGRVAQGAIRDALLYHWPDAEGQTVVGFGFAVPLLRPYLTDARRV 69

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +  MP  QG  +WP    + + L  E + PL    VD ++++H LE +E P  +L E WR
Sbjct: 70  IGLMPGPQGVMHWPAGMPNISVLCDERSWPLETGGVDKLVLLHGLETSETPTDLLEECWR 129

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+ GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + L +  F     + +LF PP
Sbjct: 130 VLSPGGRAMFIVPNRAGLWARKDGTPFGYGRPYSLGQLEAQLTKHGFVNERHASALFTPP 189

Query: 181 THKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           + K+  L+   + EK G         G++++E  K +++ L    SK       +L    
Sbjct: 190 SEKRFWLRSTRMVEKTGQNLSAVLGGGVFLVEVSKQVFEPLKADRSKGLRRPLRVLEGIP 249

Query: 240 VS 241
             
Sbjct: 250 AP 251


>gi|114762055|ref|ZP_01441523.1| hypothetical protein 1100011001331_R2601_13990 [Pelagibaca
           bermudensis HTCC2601]
 gi|114545079|gb|EAU48082.1| hypothetical protein R2601_13990 [Roseovarius sp. HTCC2601]
          Length = 249

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/244 (30%), Positives = 117/244 (47%), Gaps = 5/244 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+  LR FY  S LG+    A+   +   W    G  ++G G+A+P    +     R
Sbjct: 1   MHLDVHNLRDFYYRSALGRAAQRAVRDQVQRYWPTGKGHTMVGYGFAVPLLRPYLPDARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + T L  E   PL    VD ++M+H LE ++ P  +L E +
Sbjct: 61  VIGLMPGPQGVLPWPQGQLNVTVLCEETLWPLETGHVDRLVMMHGLETSDSPSELLDECY 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + +VPN+ G+WAR + TPFG G+PYS  Q+ S L+  +F        L+ P
Sbjct: 121 RVLGPGGEALFIVPNRSGLWARSDATPFGYGRPYSLSQLDSQLKRHDFIRQSHVSVLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLPITESKKKHISSP--ILV 236
           P+ ++  ++    +E+IG         G+ ++ A K  Y         K  + +P  +L 
Sbjct: 181 PSSRRFWMRTGPAWERIGRAIPALVAGGVLIVRASKR-YPPKRTGLGDKVRVPNPLDVLT 239

Query: 237 PHTV 240
           P   
Sbjct: 240 PSPK 243


>gi|99081930|ref|YP_614084.1| hypothetical protein TM1040_2090 [Ruegeria sp. TM1040]
 gi|99038210|gb|ABF64822.1| hypothetical protein TM1040_2090 [Ruegeria sp. TM1040]
          Length = 248

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 124/248 (50%), Gaps = 6/248 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W D TG  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGQLLRMWPDATGETIAGFGFAAPLLRPYLSEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    VD ++++H LE +E P  +L E W
Sbjct: 61  LMALMPGPQGVMQWPAGMPNVSVLCEETSWPVETGRVDRLVLLHGLETSEQPSALLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RV+   GR I +VPN+ G+WAR + TPFG G+PY+  Q+ + LR   FT+   + +L+  
Sbjct: 121 RVMGPRGRAIFIVPNRAGLWARSDETPFGYGRPYTLTQLENQLRAHQFTIEQHAAALYRL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQ----GLPITESKKKHISSPI 234
           P+ ++  LK  ++ E++G        AG++++E  K  +           +    +   +
Sbjct: 181 PSSRRFWLKSGAMIERVGRRLPAMMAAGVFLVEVSKQTHPQKGHMTRARRTNPIRVLEGL 240

Query: 235 LVPHTVST 242
             P    T
Sbjct: 241 SNPIAEPT 248


>gi|49474785|ref|YP_032827.1| hypothetical protein BQ13050 [Bartonella quintana str. Toulouse]
 gi|49240289|emb|CAF26764.1| hypothetical protein BQ13050 [Bartonella quintana str. Toulouse]
          Length = 254

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 95/237 (40%), Positives = 136/237 (57%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LGK   + +   L+  W D+ G R++G GYA+P+ S    + ++  A
Sbjct: 11  LDIVTLKDFYASALGKRVQETLCDKLNLCWPDLNGKRVMGFGYALPYLSTVRARAQQCFA 70

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA  WP     +TALV E NLPL D+S+DC+L++H LE+ E+ F  LHEIWRVL
Sbjct: 71  FMPACQGALPWPCADKVATALVFEENLPLPDASIDCILLIHALEYTENSFETLHEIWRVL 130

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G +IV+VPN+ G WAR   TPFG G+PYS  QM  L  + +F        + + P+ 
Sbjct: 131 APNGHLIVIVPNRSGFWARNGCTPFGYGEPYSRQQMARLFEKTHFISGPVQEVVHYMPSS 190

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                    ++E       P F G+ + +ARK +YQGL +   + + +  P L P  
Sbjct: 191 GYVSRLFSFLYEPFSRYLLPYFGGLLICQARKHVYQGLLVHRRQSRRVFMPALSPQA 247


>gi|163869280|ref|YP_001610536.1| hypothetical protein Btr_2589 [Bartonella tribocorum CIP 105476]
 gi|161018983|emb|CAK02541.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 256

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 137/237 (57%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LG      +   L+  W ++T  R++GLGY +P+ S    + ++  A
Sbjct: 11  LDIVTLKDFYASALGLRVQKTLCDQLNLWWPNLTDKRVMGLGYTLPYLSALRERTQQCFA 70

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA++WP     +TALV E +LPL D+SVDC+L+VH LE+ E+ F  L+EIWRVL
Sbjct: 71  FMPARQGASSWPCVEQVATALVFEEDLPLPDASVDCILLVHALEYTENSFETLNEIWRVL 130

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G +IV+VPN+ G WAR   TPFG G+PY+  Q+  L  + NF        + + P+ 
Sbjct: 131 APNGHLIVIVPNRSGFWARNTTTPFGYGEPYTRQQIARLFEKTNFVSEPIEEIVHYMPST 190

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                     +E   +   P F G+ + +A+K +YQG+ +   + + I  P L P T
Sbjct: 191 GYVSRLFSFFYEPFAHHLFPYFGGLLICQAQKRVYQGVLVQRRQSRRIFIPALSPQT 247


>gi|126728274|ref|ZP_01744090.1| hypothetical protein SSE37_19827 [Sagittula stellata E-37]
 gi|126711239|gb|EBA10289.1| hypothetical protein SSE37_19827 [Sagittula stellata E-37]
          Length = 250

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 126/244 (51%), Gaps = 4/244 (1%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTW--DDVTGCRLLGLGYAIPFFSCFHGKV 57
           M +D+  LR FY  S LG+     +   +   W  +DV G  + G G+A+P    +  + 
Sbjct: 1   MHLDVQALRDFYYRSALGRAAQKIMRAEVLRGWSPEDVHGQTVAGYGFAVPMLRPYLKEA 60

Query: 58  ERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
            R +A MPA QG   WP    + + L  E + PL    VD ++++H LE +E P  +L E
Sbjct: 61  RRVVALMPAPQGVMPWPAGLPNVSVLSEEVSWPLETGHVDRLILMHGLETSERPSDLLDE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            +RVL  GGR + ++PN+ G+WAR + TPFG G+PYS  Q+ + L+  +F        L+
Sbjct: 121 AYRVLGPGGRALFILPNRSGLWARADWTPFGYGRPYSIGQLETQLKLHDFVPERHVSVLY 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            PP+ ++  +K    +E++G +      G+ ++EA K  +        +KK + +P+ V 
Sbjct: 181 QPPSARRFWMKTGPFWERLGRLIPFTAGGVMIVEASKR-HPPTRAGLGQKKRVPNPLEVL 239

Query: 238 HTVS 241
               
Sbjct: 240 SPKP 243


>gi|49476267|ref|YP_034308.1| hypothetical protein BH16150 [Bartonella henselae str. Houston-1]
 gi|49239075|emb|CAF28378.1| hypothetical protein BH16150 [Bartonella henselae str. Houston-1]
          Length = 244

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 94/240 (39%), Positives = 144/240 (60%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LGK   + +   L+  W D+TG R++G GYA+P+ S    + ++ LA
Sbjct: 1   MDIVTLKDFYASVLGKRVQETLCGQLNLCWPDLTGKRVMGFGYALPYLSALRMRAQQCLA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPAGQGA  WP     +TALV E +LPL D+S+DC+L++H LE+ E+ F  L+EIWRVL
Sbjct: 61  FMPAGQGALPWPCADKVATALVFEEDLPLPDASIDCILLIHALEYTENSFETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G++IV+VPN+ G+WAR   TPFG G+PYS  Q++ L  + +F        + + P+ 
Sbjct: 121 VPNGQLIVIVPNRSGLWARNACTPFGYGEPYSRQQIVRLFEKTHFVSGSIQEVVHYMPSS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                     +E +     P F G+ + +A+K +YQGL +   + + +  P L+P    +
Sbjct: 181 GSVSRFFSFFYEPVARHLLPYFGGLLICQAQKRVYQGLLLQRRQSRRVFMPALLPQARES 240


>gi|114769422|ref|ZP_01447048.1| hypothetical protein OM2255_06810 [alpha proteobacterium HTCC2255]
 gi|114550339|gb|EAU53220.1| hypothetical protein OM2255_06810 [alpha proteobacterium HTCC2255]
          Length = 258

 Score =  171 bits (433), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 82/248 (33%), Positives = 128/248 (51%), Gaps = 7/248 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+++LR+FY  + LG+    A+   +   + D  G  +LG G+A P    F     R
Sbjct: 1   MHLDVIDLRKFYYRTKLGRIVQRALRDKVERLFGDTKGQTVLGYGFAAPMLRPFLKSSRR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP+   + + L  E + PLA   VD ++++H LE + +   +L EIW
Sbjct: 61  VICLMPGQQGVMPWPEGQLNRSVLTPEISWPLATGIVDKMVILHGLETSNNQNGLLEEIW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR++++VPN+ G+WAR E TPFG GQPYS  Q+ + LR   F++     ++FFP
Sbjct: 121 RVLGPGGRVLIIVPNRSGLWARSEKTPFGYGQPYSISQLETQLRIHKFSVERHMSAMFFP 180

Query: 180 PTHKKCILKLWSVFEKIG-NIFGPGFAGIYVIEARKILYQGLPITESKKKH-----ISSP 233
           P+HK   L++    E +G     P  +G+ ++EA K +Y                 +   
Sbjct: 181 PSHKPFWLRVSKYLEGVGLKGVIPLASGVVIVEATKQIYARPKSGLGATVKNPLGGVLRG 240

Query: 234 ILVPHTVS 241
           I  P    
Sbjct: 241 IKSPAGKP 248


>gi|83859177|ref|ZP_00952698.1| hypothetical protein OA2633_12270 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852624|gb|EAP90477.1| hypothetical protein OA2633_12270 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 261

 Score =  171 bits (433), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 84/251 (33%), Positives = 128/251 (50%), Gaps = 9/251 (3%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D +++ +FY +  G+   D + + +   W DV G  +LG GYA P+   F G+  RT
Sbjct: 1   MRTDALDIARFYRTPPGRAARDMVQRRILALWPDVDGLDMLGFGYAPPYLEPFRGRARRT 60

Query: 61  LAFMPAGQGATNWPDQYFS---STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
           +AFMPA QGA  WP         + L  E      ++  D V++VH LE A DP  +L E
Sbjct: 61  IAFMPAAQGAVPWPAPGVGKGGLSMLGDEQRFAFKEALFDRVILVHALEEAADPARLLRE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           +WRV+   GR++V+  ++ G+W+R + TPFG G+P++  Q+  LL ++ F     SR+LF
Sbjct: 121 VWRVMAPEGRLLVIAAHRTGLWSRADSTPFGHGRPFTRSQLTGLLSDSLFEPIAWSRALF 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL------PITESKKKHIS 231
            PP    C  K    FE  G    P F G+ + EA K +           +     + ++
Sbjct: 181 TPPWRFTCGPKTARAFESAGERLWPAFGGLILSEAVKHVGAVRAGGATQRVRRKALEGVT 240

Query: 232 SPILVPHTVST 242
            P L P +  T
Sbjct: 241 RPALSPRSDRT 251


>gi|254486521|ref|ZP_05099726.1| ATP synthase subunits region ORF 4 [Roseobacter sp. GAI101]
 gi|214043390|gb|EEB84028.1| ATP synthase subunits region ORF 4 [Roseobacter sp. GAI101]
          Length = 248

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/237 (31%), Positives = 120/237 (50%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    A+   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQHALRSRMLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+    VD ++++H LE +E    +L E W
Sbjct: 61  VMTLMPGPQGVMPWPAGMANTSVLTEETLWPIETGHVDRLVLLHGLETSERQGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGLWARRDITPFGYGRPYSPGQLETQLRKHQFLPERQLGALYQM 180

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
           P++++  ++   +FEKIG         G +++E  K++Y          K  S  +L
Sbjct: 181 PSNRRVWMRSGKLFEKIGRHMPTMMAGGAFMVEVTKLVYPPKGKASRVPKRRSIRML 237


>gi|86359394|ref|YP_471286.1| putative SAM-dependent methyltransferase protein [Rhizobium etli
           CFN 42]
 gi|86283496|gb|ABC92559.1| putative SAM-dependent methyltransferase protein [Rhizobium etli
           CFN 42]
          Length = 221

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 118/216 (54%), Positives = 149/216 (68%)

Query: 27  VLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSE 86
            LS+ W  +   RL+GLGYA+PF   F    ERT AFMPAGQGA NWP    SST L+ +
Sbjct: 2   ALSSLWVRLPQERLVGLGYAVPFLDRFQADTERTFAFMPAGQGAVNWPMGSLSSTTLIFD 61

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
             LPL DSS+D VLMVH LEFAE P   L E+WRVL  GGR+++VVPN+RG+WARMEHTP
Sbjct: 62  EELPLPDSSIDRVLMVHSLEFAESPRETLKELWRVLAPGGRLVIVVPNRRGVWARMEHTP 121

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
           FGSG+PYS  Q+  LLRE NFT   T+ +LFFPP+  + IL+L   FE++G    P F+G
Sbjct: 122 FGSGRPYSRGQLTHLLRETNFTPGATAEALFFPPSKLRTILRLRRAFERVGRTLWPAFSG 181

Query: 207 IYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           + ++EA+K LYQGLP+     + +  P+L PH V T
Sbjct: 182 VIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGVPT 217


>gi|259415930|ref|ZP_05739850.1| ATP synthase subunit [Silicibacter sp. TrichCH4B]
 gi|259347369|gb|EEW59146.1| ATP synthase subunit [Silicibacter sp. TrichCH4B]
          Length = 248

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/237 (31%), Positives = 122/237 (51%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    +I   L   W D TG  + G G+A P    +  +  R
Sbjct: 1   MHLDVQDLRNFYYRSTLGRAAQASIRGQLLRMWPDATGETIAGFGFAAPLLRPYLSEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WP    + + L  E + P+    VD ++++H LE +E P  +L E W
Sbjct: 61  IMALMPGPQGVMQWPAGQPNVSVLCEETSWPVETGRVDRLVLLHGLETSEQPSALLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RV+   GR I +VPN+ G+W R + TPFG G+PY+  Q+ + LR   FT+   + +L+  
Sbjct: 121 RVMAPRGRAIFIVPNRGGLWVRSDATPFGYGRPYTLTQLENQLRGHQFTIEQHAAALYRL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPIL 235
           P+ ++  LK  ++ E++G        AG++++E  K  +         ++     +L
Sbjct: 181 PSPRRFWLKSGAMIERVGRRLPAMMAAGVFLVEVSKQTHPQKGHMIRARRTNPIRVL 237


>gi|310815411|ref|YP_003963375.1| hypothetical protein EIO_0927 [Ketogulonicigenium vulgare Y25]
 gi|308754146|gb|ADO42075.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 120/248 (48%), Gaps = 7/248 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +L+ FY  S LG+     +   L   W +  G  + G G+A+P    F  +  R
Sbjct: 1   MYLDVQDLKNFYYRSALGRAVQQVLRGRLRQMWPETKGMTIAGFGFALPLLRPFLPEARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    + T LV E   PL   SVD ++M+H LE ++DP  +L E  
Sbjct: 61  VIGLMPGPQGVMAWPPGLPNITTLVEEALWPLETGSVDRLVMLHGLEMSDDPGALLQEAR 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PY+  Q+   LR  +F     +  L+ P
Sbjct: 121 RVLGPGGRAVFIVPNRAGIWSRTDRTPFGYGKPYTIGQLEGALRLHDFAPERAATVLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGP-GFAGIYVIEARKILYQGLPITES-----KKKHISSP 233
           P+ ++   +L  + E +G         G+ ++EA K+     P         +   I  P
Sbjct: 181 PSVRRTWRRLGPMLESVGTHLPAIYAGGVLMVEAVKVPAPRTPARPRSVLEKRSLRILGP 240

Query: 234 ILVPHTVS 241
              P  + 
Sbjct: 241 ATSPAAMR 248


>gi|319409424|emb|CBI83070.1| putative enzyme [Bartonella schoenbuchensis R1]
          Length = 253

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 92/237 (38%), Positives = 131/237 (55%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DIV L+ FY+S LG      I   L+  W ++   R++G GYA+P+ S    + +   A
Sbjct: 1   MDIVTLKDFYASTLGLRVQTTICDQLNFYWPNLADKRVMGFGYAVPYLSVLCTRAKHCFA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA  WP     +TALV E +LPL D+S+DCVL+VH LE+ E+    L EIWRVL
Sbjct: 61  FMPASQGALPWPCADRVATALVFEEDLPLPDASIDCVLLVHALEYTENSRETLKEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           T  G +IV+VPN+ G WAR + TPFG G+PYS  Q++ L  E NF        +++ P+ 
Sbjct: 121 TPNGHLIVIVPNRSGFWARNDRTPFGYGEPYSRQQIVRLFEETNFISGPVQEIVYYTPSL 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                     +        P F G+ + +A K +YQG+ I   + + +  P L P  
Sbjct: 181 NYTARLFSFFYRPFVRHLFPYFGGLLMCQAHKRIYQGISIQRRQSRRVFIPTLSPQA 237


>gi|163793797|ref|ZP_02187771.1| SAM-dependent methyltransferase [alpha proteobacterium BAL199]
 gi|159180908|gb|EDP65425.1| SAM-dependent methyltransferase [alpha proteobacterium BAL199]
          Length = 250

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 140/245 (57%), Gaps = 4/245 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +D VELR FY+  LG      I + L   W ++ G  LLG+GYA+P+   + G+ ER 
Sbjct: 1   MYLDAVELRDFYNGPLGVLARRMIRRRLRELWPNLRGQSLLGIGYAVPYLRLYRGEAERV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MPA QG  +WP +  +++ LV E  LP  D+S+D +L+VH LE  E    M+ E WR
Sbjct: 61  IAAMPAQQGVLHWPPEGPNASLLVDEAELPFEDASIDRILLVHALETTEQRAAMMAEAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GR++ V PN+RG+WAR +HTPFG GQPY+  Q+  +LR++ FT + T  +L+ PP
Sbjct: 121 VLAGNGRLLAVAPNRRGLWARFDHTPFGHGQPYTVSQLSRVLRDSRFTPTRTVHALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL----PITESKKKHISSPILV 236
                +++  S  E++G+ +   FAG  +IEA+K +Y       P+    +  + S    
Sbjct: 181 YTSGLVIRSASALEQVGHRWFTTFAGAVMIEAQKEVYAVRRDRKPVMARARALLPSRGRA 240

Query: 237 PHTVS 241
                
Sbjct: 241 TVPAR 245


>gi|148559357|ref|YP_001259803.1| hypothetical protein BOV_1911 [Brucella ovis ATCC 25840]
 gi|148370614|gb|ABQ60593.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 234

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 109/215 (50%), Positives = 145/215 (67%)

Query: 27  VLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSE 86
            L+  W  V G RL+GLGY++P+   F    ERT AFMPAGQGA  WP    S+TALV +
Sbjct: 2   ALAGLWSHVPGERLVGLGYSLPYLDRFGADTERTFAFMPAGQGAIAWPSAEKSTTALVFD 61

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP 146
             LPL DSS+D VLMVH LE+AE+    L E+WRVL   GR+++VVPN+RG+WAR EHTP
Sbjct: 62  EELPLPDSSIDRVLMVHALEYAENAQETLKEMWRVLAPNGRLVIVVPNRRGVWARFEHTP 121

Query: 147 FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
           FGSG+PYS  Q+ +LLREANFT+S  S +L FPP  ++ +++     E +G    P FAG
Sbjct: 122 FGSGRPYSRTQLATLLREANFTVSTVSNALHFPPASRRWMMRPCLALESMGRRLWPLFAG 181

Query: 207 IYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           + +IEA+K LYQGLP+++   + +  P+L P    
Sbjct: 182 VLIIEAQKRLYQGLPVSQRSSRRVFVPVLAPRGTP 216


>gi|319406351|emb|CBI79990.1| putative enzyme [Bartonella sp. AR 15-3]
          Length = 244

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 137/237 (57%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W D+T  +++GLGYA+P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGIRVQTIVCDQLNIFWPDLTDKQVMGLGYALPYLSVLRKRAKQCYA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+S+DCVL+VH LE+ ++    L+EIWRVL
Sbjct: 61  FMPASQGASPWPYPDKVATALVFEEDLPLPDASIDCVLLVHALEYTKNSHETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+IV+VPN+ G+WAR +HTPFG G  YS  Q++ L +E NF        L + P+ 
Sbjct: 121 IPNGRLIVIVPNRCGLWARNDHTPFGYGVSYSRQQIVRLFKETNFITGAVQEILHYTPSL 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                     +E + +   P F G+ V  A K +YQG  +   + + +  P L P  
Sbjct: 181 SYVSRLFSFFYESLASHIFPYFGGLLVCSAEKHVYQGSFVQRRQSRRVFIPTLTPQA 237


>gi|83854836|ref|ZP_00948366.1| hypothetical protein NAS141_08911 [Sulfitobacter sp. NAS-14.1]
 gi|83842679|gb|EAP81846.1| hypothetical protein NAS141_08911 [Sulfitobacter sp. NAS-14.1]
          Length = 248

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 117/244 (47%), Gaps = 2/244 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQHSLRTRMLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+    VD ++++H LE ++    +L E W
Sbjct: 61  VMTLMPGPQGVMPWPAGMPNTSVLTEETLWPIETGHVDRLVLMHGLETSDRQGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGFWARSDITPFGYGRPYSLGQLETQLRKHQFLPERQLGALYLL 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ ++   +   +FEK+G         G +++E  K++Y             S  +L   
Sbjct: 181 PSTRRTFRRAGPLFEKVGRHMPTIMAGGAFMVEVTKLVYPPKGKVARTPARRSIRVLEGV 240

Query: 239 TVST 242
              T
Sbjct: 241 GAVT 244


>gi|83941359|ref|ZP_00953821.1| hypothetical protein EE36_03983 [Sulfitobacter sp. EE-36]
 gi|83847179|gb|EAP85054.1| hypothetical protein EE36_03983 [Sulfitobacter sp. EE-36]
          Length = 256

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 117/244 (47%), Gaps = 2/244 (0%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ +LR FY  S LG+    ++   +   W +  G  ++G G+A P    +     R
Sbjct: 1   MHLDVQDLRNFYYRSALGRAAQHSLRTRMLELWPEAKGQTVVGFGFAAPLLRPYLADARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MP  QG   WP    +++ L  E   P+    VD ++++H LE ++    +L E W
Sbjct: 61  VMTLMPGPQGVMPWPAGMPNTSVLTEETLWPIETGHVDRLVLMHGLETSDRQGDLLEECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G WAR + TPFG G+PYS  Q+ + LR+  F       +L+  
Sbjct: 121 RVLGPGGRALFIVPNRAGFWARSDITPFGYGRPYSLGQLETQLRKHQFLPERQLGALYLM 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P+ ++   +   +FEK+G         G +++E  K++Y             S  +L   
Sbjct: 181 PSTRRTFRRAGPLFEKVGRHMPTIMAGGAFMVEVTKLVYPPKGKVARTPARRSIRVLEGV 240

Query: 239 TVST 242
              T
Sbjct: 241 GAVT 244


>gi|260429161|ref|ZP_05783138.1| ATP synthase subunit [Citreicella sp. SE45]
 gi|260419784|gb|EEX13037.1| ATP synthase subunit [Citreicella sp. SE45]
          Length = 249

 Score =  168 bits (425), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 5/244 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M +D+ ++R FY  S LG+     +   +   W D  G  ++G G+A+P    +     R
Sbjct: 1   MHLDVHDMRDFYYRSALGRAAQRIVRDQVLQFWPDAHGHTMVGYGFAVPLLRPYLKGARR 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  MPA QG  +WP    + T L  E   PL    VD ++M+H LE +E P  +L E +
Sbjct: 61  VVGLMPAPQGVMSWPAGQPNVTVLCEETLWPLETGHVDRLIMMHGLETSERPSELLDECY 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GG  + VVPN+ G+WAR E TPFG G+PYS  Q+ + L+  +F        L+ P
Sbjct: 121 RVLGPGGEALFVVPNRSGLWARSEKTPFGYGRPYSLSQLDAQLKRHDFIRQSHVSVLYQP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLPITESKKKHISSP--ILV 236
           P+ ++  ++   V+E+IG         G+ ++   K  Y         K  + +P  +L 
Sbjct: 181 PSSRRFWMRTGPVWERIGRAIPALVAGGVLIVRVSKR-YPPERTGLGDKVRMPNPLDVLT 239

Query: 237 PHTV 240
           P   
Sbjct: 240 PAPK 243


>gi|319404866|emb|CBI78467.1| putative enzyme [Bartonella rochalimae ATCC BAA-1498]
          Length = 246

 Score =  168 bits (424), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 138/237 (58%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W D+   R++GLGY +P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGMRMQMTVYDQLNVCWPDLIDKRVMGLGYTLPYLSALRKRAKQCCA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA+ WP     +TALV E +LPL D+S+DC+L++H LE+ E+ +  L+EIWRVL
Sbjct: 61  FMPASQGASPWPYPDKVATALVFEEDLPLPDASIDCILLIHALEYTENSYETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+IV+VPN+ G+WAR + TPFG G+ YS  Q++ LL+E NF        + + P+ 
Sbjct: 121 IPNGRLIVIVPNRYGLWARNDRTPFGYGKSYSRQQIVRLLKETNFITESVQEIVHYMPSL 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                     +E + +   P F G+ +  A K +YQG  +   + + I  P L P T
Sbjct: 181 NCISRLCSFFYESLASHIFPYFGGLLMCSAEKHVYQGSFVQRHQSRRIFIPTLTPQT 237


>gi|254294709|ref|YP_003060732.1| methyltransferase type 11 [Hirschia baltica ATCC 49814]
 gi|254043240|gb|ACT60035.1| methyltransferase type 11 [Hirschia baltica ATCC 49814]
          Length = 259

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 81/236 (34%), Positives = 128/236 (54%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MRV++  L+ FY++ LGK   + I + +   W       +L  GY   F + +     R 
Sbjct: 1   MRVEVGRLKAFYNTPLGKAAYEMILRRIEAIWPHADDLDVLSFGYGQEFLNTYAQDTRRA 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +   PA QGA  WP    SST LV E  LP AD+  D +L++H LE A++P  ++ E+WR
Sbjct: 61  ICAAPAAQGAVCWPSSSNSSTTLVEEDKLPFADAVFDRILVIHGLEDADNPDRLMRELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           V     R+++V  N+ G+W++ E TPFG G+PY+  Q+  LL+ A F  +  +R+L+ PP
Sbjct: 121 VAAPEARILMVAANRSGLWSQAESTPFGHGRPYTKKQLNGLLKTAMFQPTAWTRALYAPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
              K +      +EK G I   GF G+ ++EA K LY    I  ++++ ++ P   
Sbjct: 181 VSLKLVTSAADAWEKTGEIAWKGFGGVLMVEAVKQLYIDPQIPNAQQQRVNRPARA 236


>gi|148260772|ref|YP_001234899.1| methyltransferase type 11 [Acidiphilium cryptum JF-5]
 gi|146402453|gb|ABQ30980.1| Methyltransferase type 11 [Acidiphilium cryptum JF-5]
          Length = 235

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 86/230 (37%), Positives = 122/230 (53%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D   +  FY++  G  T   I   L   W +  GC +LGLGY  P+   +  +  R 
Sbjct: 1   MRLDAPSIADFYATPRGAATARLIRARLREFWPEARGCEVLGLGYPGPYLRLWRDQAARC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A +PA  GA  WP      + LV E  LP AD SVD +L++H LE AE    +L E WR
Sbjct: 61  IAAVPAQIGAAPWPVSRPGLSVLVEEDALPFADVSVDRLLLIHGLEHAETARRLLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GRMIVVVPN+   WA +E TPFG GQPYS  Q+  +L ++ F +     +LF PP
Sbjct: 121 VLRPEGRMIVVVPNRASPWAYLERTPFGHGQPYSPSQLGRMLADSLFRVERRDAALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
              + IL+   + E+ G        GI + EA K +   +P+   +++ +
Sbjct: 181 LGGRAILRAAPLVERAGRRIAAQAGGIILTEATKDVAGVIPLRAGRRRRL 230


>gi|319407827|emb|CBI81480.1| putative enzyme [Bartonella sp. 1-1C]
          Length = 246

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 139/237 (58%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +DI+ L+ FY+S LG      +   L+  W D+   R++GLGY +P+ S    + ++  A
Sbjct: 1   MDIITLKDFYTSTLGMRVQMTVCDQLNVCWPDLIDKRVMGLGYTLPYLSALRKRAKQCYA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
           FMPA QGA++WP     +TALV E +LPL D+S+DC+L++H LE+ ++ +  L+EIWRVL
Sbjct: 61  FMPASQGASSWPYPDKVATALVFEEDLPLPDASIDCILLIHALEYTKNSYETLNEIWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              GR+IV+VPN+ G+WAR + TPFG G+ YS  Q++ LLRE NF        + + P+ 
Sbjct: 121 IPNGRLIVIVPNRYGLWARNDRTPFGYGKSYSRQQIVRLLRETNFITESVKEIVHYMPSL 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
                     ++ + +   P F G+ +  A K +YQG  +   + + I  P L P T
Sbjct: 181 SCISRLFSFFYKSLASHIFPYFGGLLMCSAEKHVYQGSFVQRHQSRRIFIPTLTPQT 237


>gi|326403971|ref|YP_004284053.1| putative methyltransferase [Acidiphilium multivorum AIU301]
 gi|325050833|dbj|BAJ81171.1| putative methyltransferase [Acidiphilium multivorum AIU301]
          Length = 235

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 86/230 (37%), Positives = 122/230 (53%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+D   +  FY++  G  T   I   L   W +  GC +LGLGY  P+   +  +  R 
Sbjct: 1   MRLDAPSIADFYATPRGAATARLIRARLREFWPEARGCEMLGLGYPGPYLRLWRDQAARC 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A +PA  GA  WP      + LV E  LP AD SVD +L++H LE AE    +L E WR
Sbjct: 61  IAAVPAQIGAAPWPVSRPGLSVLVEEDALPFADVSVDRLLLIHGLEHAETARRLLREAWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL   GRMIVVVPN+   WA +E TPFG GQPYS  Q+  +L ++ F +     +LF PP
Sbjct: 121 VLRPEGRMIVVVPNRASPWAYLERTPFGHGQPYSPSQLGRMLADSLFRVERRDAALFLPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
              + IL+   + E+ G        GI + EA K +   +P+   +++ +
Sbjct: 181 LGGRAILRAAPLVERAGRRIAAQAGGIILTEATKDVAGVIPLRAGRRRRL 230


>gi|170740306|ref|YP_001768961.1| methyltransferase type 11 [Methylobacterium sp. 4-46]
 gi|168194580|gb|ACA16527.1| Methyltransferase type 11 [Methylobacterium sp. 4-46]
          Length = 248

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 92/222 (41%), Positives = 137/222 (61%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M VD+ +LR FY   LG      + + +      V G R+LGLGYA+P+        ERT
Sbjct: 1   MSVDVTDLRAFYGGPLGAVAQRHVGRAVHRFLGSVAGLRVLGLGYAVPYLGPVRHAAERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LAFMPA QG  NWP    +++ALV    +PL +++VD V+++H +E  E P  +L E+WR
Sbjct: 61  LAFMPATQGVVNWPTTGRTASALVDPTMMPLPEAAVDRVIVIHAIEAVESPAELLQEVWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT GGR+++VVPN+RG+WAR + TPFG GQPYS  Q+  L+RE  F+    + +L+ PP
Sbjct: 121 VLTPGGRLVLVVPNRRGLWARRDATPFGHGQPYSRSQLSRLMRETLFSAEGWAETLYMPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
                 L+  S +E++G      FAG++V++A K L++ + +
Sbjct: 181 VEGWVTLRTASAWERVGTGLSLPFAGLHVVDAIKQLHRPVAV 222


>gi|294678494|ref|YP_003579109.1| hypothetical protein RCAP_rcc02975 [Rhodobacter capsulatus SB 1003]
 gi|1881513|emb|CAA67906.1| hypothetical protein [Rhodobacter capsulatus]
 gi|294477314|gb|ADE86702.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 252

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 123/247 (49%), Gaps = 6/247 (2%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDD----VTGCRLLGLGYAIPFFSCFHG 55
           M +D+++LR FY  + LG+    AI   +   W D    + G  + G G+A+P    + G
Sbjct: 1   MHLDVLDLRDFYYRTQLGRTAQKAIRDKVVELWPDTQSGMAGLTVAGYGFAVPLLRPYLG 60

Query: 56  KVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
           +  R +  MPA QG   WP    + + L +E + PL    +D ++++H LE ++DP  ++
Sbjct: 61  RARRVIGLMPAQQGVMPWPAGEPNVSVLCAETSWPLETGMIDRLVVLHGLEVSDDPDALM 120

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
            E WR L  GGR + +VPN+ G+WA  E TPFG G+PY+  Q+ +  R   F     + +
Sbjct: 121 EECWRTLGPGGRALFIVPNRVGLWAPRETTPFGFGRPYTMGQLEAQARRVGFAPERQAAA 180

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPI 234
           L+ PP+ ++  L+   ++E++G        AG+ ++E  K ++                I
Sbjct: 181 LYIPPSQRRFWLRSSEMWERLGTRAAGYLAAGVVMLEVIKQVHSVRRSGLGAAVRKPLSI 240

Query: 235 LVPHTVS 241
           L      
Sbjct: 241 LEGAPKP 247


>gi|254454124|ref|ZP_05067561.1| ATP synthase subunits region ORF 4 [Octadecabacter antarcticus 238]
 gi|198268530|gb|EDY92800.1| ATP synthase subunits region ORF 4 [Octadecabacter antarcticus 238]
          Length = 244

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 116/238 (48%), Gaps = 8/238 (3%)

Query: 1   MRVDIVELRQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
           M     +LR+FY  S +G+     +   L   W +  G  + G G+A+P    +     R
Sbjct: 1   MH----DLREFYYRSPVGRAAQKVVRDQLVRMWPEAKGQTVAGFGFAVPLLRPYLADARR 56

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MP  QG   WPD   + + L  +   PLA  SVD ++++H LE ++ P  +L E W
Sbjct: 57  VIALMPGPQGVMPWPDNKPNVSVLCEDTLWPLASGSVDKLVLLHGLETSDTPMALLDECW 116

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR + +VPN+ G+W+R + TPFG G+PYS  Q+   LR+       T  +LF P
Sbjct: 117 RVLGPGGRAVFIVPNRTGLWSRSDATPFGFGRPYSLSQLEKQLRDIGLIPVKTLSTLFQP 176

Query: 180 PTHKKCILKLWSVFEKIGNIFG-PGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
           P+ +    +  +  E  G         G+ ++EA K +    P      + +  P+ V
Sbjct: 177 PSTRAIWRQFANTIEAAGRHIPVFAAGGVLMVEAAKQV--PQPKRPGLAEAVKRPLRV 232


>gi|94311145|ref|YP_584355.1| methyltransferase type 11 [Cupriavidus metallidurans CH34]
 gi|93354997|gb|ABF09086.1| Methyltransferase-like protein [Cupriavidus metallidurans CH34]
          Length = 264

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 90/248 (36%), Gaps = 10/248 (4%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++  ++ +S  G+   +   +    T  D+ G   +  G         +      LA  
Sbjct: 6   IIDWEEWLASPPGQYVLEWEGQQYDRTVADIFGYHAVQFGLPAIDTLRENRMPFSALALD 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                         +   L     LP    S+D V + H LEF+EDP  +L E+ RVL  
Sbjct: 66  GRAGPHGPRETHPDARQLLCRFDELPFDTQSIDLVTLPHVLEFSEDPHEVLREVSRVLMP 125

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLREANFTLSITSRSL 176
            GR++V   N   +W   +        P+           ++   L+   F +       
Sbjct: 126 EGRVVVTCFNPMSLWGARQGLNRLGAMPFLPSDAQTIGFVRIKDWLKLLGFEIIRGRFGC 185

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPI 234
           + PP   +  L+  +  EK G+ + P F  +Y+I A K +     +  + K  K    P+
Sbjct: 186 YCPPYRTERWLQRAAFMEKAGDRWWPIFGAVYMISAVKRVKNIRLVGPAWKTPKSALKPV 245

Query: 235 LVPHTVST 242
             P    T
Sbjct: 246 AAPVATPT 253


>gi|194290093|ref|YP_002006000.1| hypothetical protein RALTA_A1996 [Cupriavidus taiwanensis LMG
           19424]
 gi|193223928|emb|CAQ69937.1| conserved hypothetical protein, putative methyltransferase
           [Cupriavidus taiwanensis LMG 19424]
          Length = 266

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 56/247 (22%), Positives = 91/247 (36%), Gaps = 9/247 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    + +S  G+      ++    T  D+ G   + LG         +      LA  
Sbjct: 9   IVSWEDWLASPPGEYMLRWEAQQYDRTVADIFGYHAVQLGLPYIDTLRENRMPFSALALD 68

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P+            +   L     LP    S+D V + H LEFAEDP  +L E+ RVL  
Sbjct: 69  PSSGPHGPRAAHPDARQLLCRFDELPFDTQSIDLVTLPHILEFAEDPHEVLREVSRVLMP 128

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLREANFTLSITSRSL 176
            GR++V   N   +W   +        P+           ++   L+   F +       
Sbjct: 129 EGRVVVTCFNPVSLWGARQGMNRLGATPFLPTDAQQIGFVRIKDWLKLLGFDIIRGRFGC 188

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPIL 235
           + PP      L+  +  EK G+ + P F  +Y+I A K +     +  + K K   +P+ 
Sbjct: 189 YCPPYRTDRWLQRTAFMEKAGDRWWPIFGAVYMISAIKRVRNIRLVGPAWKSKPALAPVS 248

Query: 236 VPHTVST 242
            P    T
Sbjct: 249 APVATPT 255


>gi|167562348|ref|ZP_02355264.1| hypothetical protein BoklE_07281 [Burkholderia oklahomensis EO147]
 gi|167574354|ref|ZP_02367228.1| hypothetical protein BoklC_31230 [Burkholderia oklahomensis C6786]
          Length = 270

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 58/262 (22%), Positives = 94/262 (35%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I++   +  S  G+   D     L  T  DV G   L LG         +    R L
Sbjct: 3   DRSIIDWPAWTDSPPGRYVLDWEQAQLDRTVSDVFGFHALQLGLPQLDALRENRMPCRGL 62

Query: 62  AFMPAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA             +  +        ST      +LP    SVD ++M H LEF  
Sbjct: 63  VLDPASGASAPYHYPWAREAHSAEHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTS 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W   +     + +P+           ++   
Sbjct: 123 DPHRLLREAERVLMPEGQLVITGFNSLSLWGARQSVGKMANRPFVPATRDQITFIRLKDW 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  ++  E  G+ + P F  +Y++ A K +     
Sbjct: 183 IKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRL 242

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 243 VGPIKMKKPVLAPGLTPAATPT 264


>gi|117924956|ref|YP_865573.1| methyltransferase type 11 [Magnetococcus sp. MC-1]
 gi|117608712|gb|ABK44167.1| Methyltransferase type 11 [Magnetococcus sp. MC-1]
          Length = 256

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 74/237 (31%), Positives = 119/237 (50%), Gaps = 2/237 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M ++ + L+++Y+S  G C ++ + + L     +      L LGYA P+        +R 
Sbjct: 1   MNLEALSLQRWYASQQGYCVSNILGETLKAWLKNRPVETTLALGYAQPYLPELTSASKRL 60

Query: 61  LAFMPAGQGA-TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
           L   PA  G              ++    LP+AD+S+D V+M H +E   D   +L E+W
Sbjct: 61  LIGTPAEMGVVRRASCDGCYGQLILRPDALPVADASIDRVVMCHLMEGLGDTNGVLREVW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL  GGR++ VVPN+ G WAR + +PFG G+P+S  Q+   L +A F    TS +LF P
Sbjct: 121 RVLKPGGRLLCVVPNRGGWWARRDGSPFGWGRPFSPRQLSEQLEDALFVTRQTSFALFMP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPIL 235
           P     +++  S +EK G  +     G+   EA K++Y   P+      + +S P +
Sbjct: 181 PFSSPRLIRGASRWEKAGQRWFAPLGGVIFCEAEKLVYAMTPLKVKSFIRKVSVPAI 237


>gi|167587484|ref|ZP_02379872.1| Methyltransferase type 11 [Burkholderia ubonensis Bu]
          Length = 270

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 90/259 (34%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRVVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +           ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREAHAPEHAPANRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   GR+++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGRLVITGFNSLSLWGMRQSFGKMANRPFVPAARDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     +  
Sbjct: 186 LGFDLERGRFGCYRPPLASDQWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKVKKPVLAPGLTPAASPT 264


>gi|83718692|ref|YP_443301.1| hypothetical protein BTH_I2789 [Burkholderia thailandensis E264]
 gi|167582320|ref|ZP_02375194.1| hypothetical protein BthaT_29540 [Burkholderia thailandensis TXDOH]
 gi|167620417|ref|ZP_02389048.1| hypothetical protein BthaB_29194 [Burkholderia thailandensis Bt4]
 gi|83652517|gb|ABC36580.1| conserved hypothetical protein [Burkholderia thailandensis E264]
          Length = 270

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 92/262 (35%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I++   +  S  G+         L  T  DV G   L LG         +    R L
Sbjct: 3   DRSIIDWPAWTDSPPGRYVLGWEQAQLDRTVSDVFGFHALQLGLPQLDTLRENRMPCRGL 62

Query: 62  AFMPAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA             +  +        ST      +LP    SVD ++M H LEF  
Sbjct: 63  VLDPASGASAPYHYPWAREAHSAEHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTS 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W         + +P+           ++   
Sbjct: 123 DPHRLLREAERVLMPEGQLVITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDW 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  ++  E  G+ + P F  +Y++ A K +     
Sbjct: 183 IKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRL 242

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 243 VGPIKMKKPVLAPGLTPAATPT 264


>gi|170732607|ref|YP_001764554.1| methyltransferase type 11 [Burkholderia cenocepacia MC0-3]
 gi|254245769|ref|ZP_04939090.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|124870545|gb|EAY62261.1| conserved hypothetical protein [Burkholderia cenocepacia PC184]
 gi|169815849|gb|ACA90432.1| Methyltransferase type 11 [Burkholderia cenocepacia MC0-3]
          Length = 270

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +  T        ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREAHTAAHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQTFGRMANRPFVPATRDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     +  
Sbjct: 186 LGFDLERGRFGCYRPPLATDQWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAASPT 264


>gi|161525204|ref|YP_001580216.1| type 11 methyltransferase [Burkholderia multivorans ATCC 17616]
 gi|189350057|ref|YP_001945685.1| SAM-dependent methyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|221201957|ref|ZP_03574993.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204913|ref|ZP_03577930.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|160342633|gb|ABX15719.1| Methyltransferase type 11 [Burkholderia multivorans ATCC 17616]
 gi|189334079|dbj|BAG43149.1| SAM-dependent methyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|221175770|gb|EEE08200.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221178040|gb|EEE10451.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 270

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 92/262 (35%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
             +I++   +  S  G+         L     DV G   L LG         +    R L
Sbjct: 3   DREIIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGL 62

Query: 62  AFMPAGQGATNWP------------DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA   +  +                  ST      +LP    SVD ++M H LEF  
Sbjct: 63  VLDPASGASAPYRFPHAHDAHAPHHAPADRSTTWCDLVDLPFESQSVDLIVMPHTLEFTS 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W   +     + +P+           ++   
Sbjct: 123 DPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPAAHDQIAFIRLKDW 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  +   E  G+ + P F  +Y++ A K +     
Sbjct: 183 IKLLGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRL 242

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 243 VGPIKVKKPVLAPGLTPAASPT 264


>gi|107022361|ref|YP_620688.1| methyltransferase type 11 [Burkholderia cenocepacia AU 1054]
 gi|116689308|ref|YP_834931.1| methyltransferase type 11 [Burkholderia cenocepacia HI2424]
 gi|105892550|gb|ABF75715.1| Methyltransferase type 11 [Burkholderia cenocepacia AU 1054]
 gi|116647397|gb|ABK08038.1| Methyltransferase type 11 [Burkholderia cenocepacia HI2424]
          Length = 270

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +  T        ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREAHTAAHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPATRDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     +  
Sbjct: 186 LGFDLERGRFGCYRPPLATDQWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAASPT 264


>gi|221213890|ref|ZP_03586863.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221166067|gb|EED98540.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 270

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 90/262 (34%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
             +I++   +  S  G+         L     DV G   L LG         +    R L
Sbjct: 3   DREIIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGL 62

Query: 62  AFMPAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA                         ST      +LP    SVD ++M H LEF  
Sbjct: 63  VLDPASGASAPYRFPHVHDAHAPHHAPTDRSTTWCDLVDLPFESQSVDLIVMPHTLEFTS 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W   +     + +P+           ++   
Sbjct: 123 DPHRLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPAAHDQIAFIRLKDW 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  +   E  G+ + P F  +Y++ A K +     
Sbjct: 183 IKLLGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRL 242

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 243 VGPIKVKKPVLAPGLTPAASPT 264


>gi|134295349|ref|YP_001119084.1| type 11 methyltransferase [Burkholderia vietnamiensis G4]
 gi|134138506|gb|ABO54249.1| Methyltransferase type 11 [Burkholderia vietnamiensis G4]
          Length = 270

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             + +         ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREASAPEHAPAERSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPAARDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     I  
Sbjct: 186 LGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLIGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAATPT 264


>gi|53718982|ref|YP_107968.1| hypothetical protein BPSL1343 [Burkholderia pseudomallei K96243]
 gi|53725123|ref|YP_102527.1| hypothetical protein BMA0764 [Burkholderia mallei ATCC 23344]
 gi|76812110|ref|YP_333005.1| hypothetical protein BURPS1710b_1601 [Burkholderia pseudomallei
           1710b]
 gi|121598297|ref|YP_992609.1| hypothetical protein BMASAVP1_A1274 [Burkholderia mallei SAVP1]
 gi|124384135|ref|YP_001026590.1| hypothetical protein BMA10229_A0595 [Burkholderia mallei NCTC
           10229]
 gi|126440882|ref|YP_001058510.1| hypothetical protein BURPS668_1467 [Burkholderia pseudomallei 668]
 gi|126449958|ref|YP_001080126.1| hypothetical protein BMA10247_0557 [Burkholderia mallei NCTC 10247]
 gi|126453084|ref|YP_001065770.1| hypothetical protein BURPS1106A_1497 [Burkholderia pseudomallei
           1106a]
 gi|167719047|ref|ZP_02402283.1| hypothetical protein BpseD_08479 [Burkholderia pseudomallei DM98]
 gi|167738048|ref|ZP_02410822.1| hypothetical protein Bpse14_08267 [Burkholderia pseudomallei 14]
 gi|167815232|ref|ZP_02446912.1| hypothetical protein Bpse9_08811 [Burkholderia pseudomallei 91]
 gi|167823640|ref|ZP_02455111.1| hypothetical protein Bpseu9_08167 [Burkholderia pseudomallei 9]
 gi|167845184|ref|ZP_02470692.1| hypothetical protein BpseB_07823 [Burkholderia pseudomallei B7210]
 gi|167893735|ref|ZP_02481137.1| hypothetical protein Bpse7_08241 [Burkholderia pseudomallei 7894]
 gi|167902187|ref|ZP_02489392.1| hypothetical protein BpseN_07904 [Burkholderia pseudomallei NCTC
           13177]
 gi|167910428|ref|ZP_02497519.1| hypothetical protein Bpse112_08030 [Burkholderia pseudomallei 112]
 gi|167918453|ref|ZP_02505544.1| hypothetical protein BpseBC_07842 [Burkholderia pseudomallei
           BCC215]
 gi|254178221|ref|ZP_04884876.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254188364|ref|ZP_04894875.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254259721|ref|ZP_04950775.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254358849|ref|ZP_04975122.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52209396|emb|CAH35341.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|52428546|gb|AAU49139.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|76581563|gb|ABA51038.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b]
 gi|121227107|gb|ABM49625.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124292155|gb|ABN01424.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126220375|gb|ABN83881.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126226726|gb|ABN90266.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126242828|gb|ABO05921.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|148027976|gb|EDK85997.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157936043|gb|EDO91713.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699260|gb|EDP89230.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254218410|gb|EET07794.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 270

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 92/262 (35%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I++   +  S  G+         L  T  DV G   L LG         +    R L
Sbjct: 3   DRSIIDWPAWTDSPPGRYVLGWEQAQLDRTVSDVFGFHALQLGLPQLDALRENRMPCRGL 62

Query: 62  AFMPAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA             +  +        ST      +LP    SVD ++M H LEF  
Sbjct: 63  VLDPASGASAPYHYPWAREARSAEHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTS 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W         + +P+           ++   
Sbjct: 123 DPHRLLREAERVLMPEGQLVITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDW 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  ++  E  G+ + P F  +Y++ A K +     
Sbjct: 183 IKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRL 242

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 243 VGPIKMKKPVLAPGLTPAATPT 264


>gi|206559633|ref|YP_002230394.1| putative methyltransferase [Burkholderia cenocepacia J2315]
 gi|198035671|emb|CAR51558.1| putative methyltransferase [Burkholderia cenocepacia J2315]
          Length = 270

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 57/259 (22%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +  T        ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREAHTAVHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPATRDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     +  
Sbjct: 186 LGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAASPT 264


>gi|167836207|ref|ZP_02463090.1| hypothetical protein Bpse38_06926 [Burkholderia thailandensis
           MSMB43]
          Length = 270

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 92/262 (35%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I++   +  S  G+         L  T  DV G   L LG         +    R L
Sbjct: 3   DRSIIDWPAWTDSPPGRYVLGWEQAQLDRTVSDVFGFHALQLGLPQLDALRENRMPCRGL 62

Query: 62  AFMPAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA             +  +        ST      +LP    SVD ++M H LEF  
Sbjct: 63  VLDPASGASAPYHYPWAREARSAEHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTS 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W         + +P+           ++   
Sbjct: 123 DPHRLLREAERVLMPEGQLVITGFNSLSLWGARHSVGKMARRPFVPATRDQITFIRLKDW 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  ++  E  G+ + P F  +Y++ A K +     
Sbjct: 183 IKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRL 242

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 243 VGPIKMKKPVRAPGLTPAATPT 264


>gi|78065899|ref|YP_368668.1| hypothetical protein Bcep18194_A4428 [Burkholderia sp. 383]
 gi|77966644|gb|ABB08024.1| hypothetical protein Bcep18194_A4428 [Burkholderia sp. 383]
          Length = 270

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +           ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREAHAPEHAPDGRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPATRDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     + +
Sbjct: 186 LGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGQ 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAASPT 264


>gi|330816257|ref|YP_004359962.1| hypothetical protein bgla_1g13320 [Burkholderia gladioli BSR3]
 gi|327368650|gb|AEA60006.1| hypothetical protein bgla_1g13320 [Burkholderia gladioli BSR3]
          Length = 270

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 95/259 (36%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   + +S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWSASPPGRYVLEWEQAQLDRVVSDVFGFHALQLGLPQLDSLRENRMPGRGLVLD 65

Query: 65  PAGQGATNWPDQYFSS------------TALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA   +  +   +               T       LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPFRYPWAGDPPGPHHAPSGRSTVWCDLLELPFESQSVDLIVMPHTLEFTADPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E+ RVL   GR+++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 GLLREVERVLMPEGRLVITGFNSLSLWGARQSVGRIANRPFVPTARDPIAFIRLKDWMKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F +       + PP      +  ++  E  G+ + P F  +Y++ A K + +   +  
Sbjct: 186 LGFDIERGRFGCYRPPLATDKWMARYAFMEAAGDRWWPIFGAVYMVTAVKRVREMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            + +K + +P L P    T
Sbjct: 246 IRVRKPVLAPGLAPAATPT 264


>gi|302381932|ref|YP_003817755.1| methyltransferase type 11 [Brevundimonas subvibrioides ATCC 15264]
 gi|302192560|gb|ADL00132.1| Methyltransferase type 11 [Brevundimonas subvibrioides ATCC 15264]
          Length = 254

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 90/242 (37%), Positives = 131/242 (54%), Gaps = 4/242 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  I +LR FY    G      ++K L   W +  GC +LG+GYA P+   F G   R 
Sbjct: 1   MRRAIEDLRTFYGEPTGALVRRLLAKRLDDAWGEAIGCDVLGIGYATPWLDAFVG-ARRV 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP+GQG   WP    + T LV +  LP A  S D VL+VH LE A+DP L+L E  R
Sbjct: 60  IAAMPSGQGVELWPAAGRNRTLLVDDRRLPFAAGSFDRVLLVHALEEADDPALLLSEAVR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            L   GR+I+    + G+WAR E TPFG G+P++  Q+  L+R A    +  S++L+ PP
Sbjct: 120 ALAPTGRIILAAAARGGLWARAEATPFGHGRPFTRGQLERLVRAAGLEPTAWSQTLYVPP 179

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL-PITESKKKHISSPILVPHT 239
                +L L   FE++G    PGFAG+ ++EA +  Y  + P   +++    +  L P +
Sbjct: 180 WP--PLLGLADGFEQVGRRIAPGFAGVILLEATRQAYARIRPTGVAQRVRAEARGLQPQS 237

Query: 240 VS 241
            +
Sbjct: 238 AT 239


>gi|171318242|ref|ZP_02907405.1| Methyltransferase type 11 [Burkholderia ambifaria MEX-5]
 gi|171096586|gb|EDT41480.1| Methyltransferase type 11 [Burkholderia ambifaria MEX-5]
          Length = 270

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +           ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREARGPEHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPAARDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     + +
Sbjct: 186 LGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGQ 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAATPT 264


>gi|170697941|ref|ZP_02889024.1| Methyltransferase type 11 [Burkholderia ambifaria IOP40-10]
 gi|172060230|ref|YP_001807882.1| methyltransferase type 11 [Burkholderia ambifaria MC40-6]
 gi|170137107|gb|EDT05352.1| Methyltransferase type 11 [Burkholderia ambifaria IOP40-10]
 gi|171992747|gb|ACB63666.1| Methyltransferase type 11 [Burkholderia ambifaria MC40-6]
          Length = 270

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +           ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREARGPEHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPAARDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     + +
Sbjct: 186 LGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGQ 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAATPT 264


>gi|115351216|ref|YP_773055.1| type 11 methyltransferase [Burkholderia ambifaria AMMD]
 gi|115281204|gb|ABI86721.1| Methyltransferase type 11 [Burkholderia ambifaria AMMD]
          Length = 270

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 91/259 (35%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA             +           ST      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASAPYQYPWAREARGPEHAPVDRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQSFGRMANRPFVPAARDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     + +
Sbjct: 186 LGFDLERGRFGCYRPPLVTDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGQ 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKMKKPVLAPGLTPAATPT 264


>gi|238026773|ref|YP_002911004.1| hypothetical protein bglu_1g11310 [Burkholderia glumae BGR1]
 gi|237875967|gb|ACR28300.1| Hypothetical protein bglu_1g11310 [Burkholderia glumae BGR1]
          Length = 270

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 95/259 (36%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   + +S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWSASPPGRYVLEWEQAQLDHVVSDVFGFHALQLGLPQLDSLRENRMPGRGLVLD 65

Query: 65  PAGQGATNWPDQYFSS------------TALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           PA   +  +   +               T      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PASGASEPFRYPWPGDPPGPHHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTADPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   GR+++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGRLVITGFNSLSLWGARQSVGRIANRPFVPAARDPIAFIRLKDWMKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F +       + PP      +  ++  E  G+ + P F  +Y++ A K + +   +  
Sbjct: 186 LGFDIERGRFGCYRPPLASDKWMARYAFMEAAGDRWWPIFGAVYMVTAVKRVREMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            + +K + +P L P    T
Sbjct: 246 IRVRKPVRAPGLAPAATPT 264


>gi|254252712|ref|ZP_04946030.1| hypothetical protein BDAG_01951 [Burkholderia dolosa AUO158]
 gi|124895321|gb|EAY69201.1| hypothetical protein BDAG_01951 [Burkholderia dolosa AUO158]
          Length = 270

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 89/259 (34%), Gaps = 21/259 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLD 65

Query: 65  PAGQGATNWPDQYFSSTA------------LVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           P    +  +   +                      +LP    SVD ++M H LEF  DP 
Sbjct: 66  PESGASAPYRYPWVRDAHGPKHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPH 125

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLRE 164
            +L E  RVL   G++++   N   +W   +     + +P+           ++   ++ 
Sbjct: 126 RLLREAERVLMPEGQLVITGFNSLSLWGMRQTFGRIANRPFVPAARDQIAFIRLKDWIKL 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
             F L       + PP      L  +   E  G+ + P F  +Y++ A K +     +  
Sbjct: 186 LGFDLERGRFGCYRPPLATDKWLARYGFMEAAGDRWWPIFGAVYMVTAVKRVRGMRLVGP 245

Query: 225 SK-KKHISSPILVPHTVST 242
            K KK + +P L P    T
Sbjct: 246 IKVKKPVLAPGLAPAASPT 264


>gi|315497875|ref|YP_004086679.1| methyltransferase type 11 [Asticcacaulis excentricus CB 48]
 gi|315415887|gb|ADU12528.1| Methyltransferase type 11 [Asticcacaulis excentricus CB 48]
          Length = 246

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 81/245 (33%), Positives = 127/245 (51%), Gaps = 6/245 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  + EL +FY++  G  T   +++ L+  W DVTG  +LGLGY  P+   F+G   R 
Sbjct: 1   MRRIVSELSRFYATPEGAVTRRMVTQKLAEAWPDVTGSDVLGLGYTTPYLDAFNGTARRV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP+ QGA  WP+   S + LV E ++P   +  D + ++H LE A +P  +L E  R
Sbjct: 61  IAAMPSAQGAEIWPEGLKSRSTLVDEQHMPFPSALFDRIFLMHALEEAPNPEALLVEASR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            LT+ GR+I+ V  + G+W   E TPFG GQP+S  Q+ +LLR A       S +L+ PP
Sbjct: 121 CLTTNGRLILAVVARGGLWTHAEKTPFGHGQPFSRTQLETLLRAAELEPIAWSYALYVPP 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY----QGLPITESKKKHISSPILV 236
              + +L+    FE+      P   G+ ++EA K +     +G  ++          + +
Sbjct: 181 L--RSLLRWAQTFEEWAPRVWPYRGGLILMEAGKRVIRAPVRGTAVSVIDDIRDKLGVSM 238

Query: 237 PHTVS 241
           P    
Sbjct: 239 PQPTP 243


>gi|134282729|ref|ZP_01769432.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|217423364|ref|ZP_03454865.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|237811763|ref|YP_002896214.1| methyltransferase type 11 [Burkholderia pseudomallei MSHR346]
 gi|238563613|ref|ZP_00438561.2| methyltransferase type 11 [Burkholderia mallei GB8 horse 4]
 gi|242315075|ref|ZP_04814091.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|251767847|ref|ZP_02268595.2| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|254197431|ref|ZP_04903853.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254199438|ref|ZP_04905804.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254205751|ref|ZP_04912103.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|134245815|gb|EBA45906.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|147749034|gb|EDK56108.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753194|gb|EDK60259.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|169654172|gb|EDS86865.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|217393222|gb|EEC33243.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|237505751|gb|ACQ98069.1| methyltransferase type 11 [Burkholderia pseudomallei MSHR346]
 gi|238520322|gb|EEP83783.1| methyltransferase type 11 [Burkholderia mallei GB8 horse 4]
 gi|242138314|gb|EES24716.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|243061564|gb|EES43750.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 288

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 92/262 (35%), Gaps = 21/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I++   +  S  G+         L  T  DV G   L LG         +    R L
Sbjct: 21  DRSIIDWPAWTDSPPGRYVLGWEQAQLDRTVSDVFGFHALQLGLPQLDALRENRMPCRGL 80

Query: 62  AFMPAG------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
              PA             +  +        ST      +LP    SVD ++M H LEF  
Sbjct: 81  VLDPASGASAPYHYPWAREARSAEHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTS 140

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISL 161
           DP  +L E  RVL   G++++   N   +W         + +P+           ++   
Sbjct: 141 DPHRLLREAERVLMPEGQLVITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDW 200

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           ++   F L       + PP      L  ++  E  G+ + P F  +Y++ A K +     
Sbjct: 201 IKLLGFDLERGRFGCYRPPLATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRL 260

Query: 222 ITESK-KKHISSPILVPHTVST 242
           +   K KK + +P L P    T
Sbjct: 261 VGPIKMKKPVLAPGLTPAATPT 282


>gi|300024272|ref|YP_003756883.1| methyltransferase type 11 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526093|gb|ADJ24562.1| Methyltransferase type 11 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 245

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 85/243 (34%), Positives = 129/243 (53%), Gaps = 4/243 (1%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +D   LR FY S LG+     +S V+   W ++ G  + G G+A PF   F  +  R   
Sbjct: 1   MDATNLRDFYRSPLGRLARRQLSLVIRKRWKNLDGLSVAGAGFASPFLGAFRTEAARLAC 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            MP  QGA  WP      + LVSE   PL D+S+D +L +H LE AE    +L E+WRVL
Sbjct: 61  LMPERQGALVWPHSGQCHSVLVSEAQWPLPDNSIDRLLAIHCLEQAERTGPLLREMWRVL 120

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              G M++VVPN+RG+W+R++ TPFG G P+S  Q+ + L +A F       +L+FPP  
Sbjct: 121 KPSGSMLIVVPNRRGLWSRIDATPFGYGLPFSRGQLETQLTDALFAPDRWGEALYFPPLS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPI--LVPH 238
            + +L++    E++G+    G AG+ ++EA K +   +   +     K +  P+    P 
Sbjct: 181 NRLMLRMAPTLERMGSSMSVGVAGVIIVEAHKEIMAPISGGVKAIPAKSVLKPVNTTRPA 240

Query: 239 TVS 241
            V 
Sbjct: 241 GVR 243


>gi|300312713|ref|YP_003776805.1| S-adenosylhomocysteine hydrolase [Herbaspirillum seropedicae SmR1]
 gi|300075498|gb|ADJ64897.1| S-adenosylhomocysteine hydrolase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 264

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 93/247 (37%), Gaps = 11/247 (4%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           +I++L  +  +  G        + L+    D+ G   + +G   P               
Sbjct: 15  EIIDLAAWLQTPTGNYLRQWEQRHLNALTADIFGFNAVQIG--SPQIHALQANRMPYRWL 72

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
                      +       +   G LP A  S+D V++ H LEFA +P  +L E+ RVL 
Sbjct: 73  ADKSMPEEGQSELEIPQVVIPDFGELPFATQSLDLVVLPHVLEFAAEPHQVLREVERVLI 132

Query: 124 SGGRMIVVVPNKRGMWARME--------HTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
             G++I+   N   +W   +        H     G+     ++   L+  N  ++     
Sbjct: 133 PEGQVIICGFNPSSLWGVRQVAGRLTGAHFLPQDGEFIRLPRLKDWLKLLNMEVNRGHFG 192

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES-KKKHISSPI 234
            + PP      L  +   EK G+ + P    +Y+++A K +     I  + +++ + +P 
Sbjct: 193 CYAPPCETTQWLDRFGFMEKAGDRWWPYLGAVYIVQAIKRVPGMRLIGPALQRQKVKAPR 252

Query: 235 LVPHTVS 241
            VP T  
Sbjct: 253 GVPVTNR 259


>gi|114570930|ref|YP_757610.1| type 11 methyltransferase [Maricaulis maris MCS10]
 gi|114341392|gb|ABI66672.1| Methyltransferase type 11 [Maricaulis maris MCS10]
          Length = 255

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 132/243 (54%), Gaps = 7/243 (2%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R D++EL +FY S  G+     I++ LS+ W DVT   +LG+G+A P+   + GK  R +
Sbjct: 5   RRDVLELDRFYRSRQGQAAHRMIARRLSSIWPDVTALDVLGIGFANPYLDVWQGKARRCV 64

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           +  PA QGA          TAL  E +LP  ++  D VL+VH LE  +   ++L E+WRV
Sbjct: 65  SLTPAAQGAIVSG-PSGVPTALGDETHLPFQEALFDRVLLVHALEETDSLPVLLREVWRV 123

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           L   GR+++V P++ G+WA ++ TPFG G+P++  Q+  LL +A    +  SR+L+ PP 
Sbjct: 124 LAPEGRLLIVSPSRAGIWAWLDSTPFGHGRPFTRGQLTRLLDDALLVPTAWSRALYAPPW 183

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS------PIL 235
                 ++ +++E++G    P   G+ ++EA K      P   + +   ++      P L
Sbjct: 184 GWSTHRRVANLWEEVGEYAWPALGGLILVEAVKHNAAVTPGLRTARVSRTALEGQRQPAL 243

Query: 236 VPH 238
            P 
Sbjct: 244 SPR 246


>gi|119386521|ref|YP_917576.1| methyltransferase type 11 [Paracoccus denitrificans PD1222]
 gi|119377116|gb|ABL71880.1| Methyltransferase type 11 [Paracoccus denitrificans PD1222]
          Length = 260

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 122/238 (51%), Gaps = 6/238 (2%)

Query: 1   MRVDIVELRQFYSSF-LGKCTTDAISKVLSTTWDD--VTGCRLLGLGYAIPFFSCFHGKV 57
           M  D+ ELR+FY +  LG+     +   L+  W      G  + G G+A P    +  + 
Sbjct: 1   MHHDVFELRKFYYTRALGRVVQRVLRDRLTGLWPPDQAQGMTVAGYGFAAPLLRPWLTRA 60

Query: 58  ERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
            R ++ MP  QG   WP    + + L  E   PL   SVD ++++H LE A+ P  ++ E
Sbjct: 61  RRVISLMPGPQGVMAWPAGLPNCSVLCEETAWPLDTGSVDRLVLLHALETADHPAALMDE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            WRVL  GGR++V+VPN+ G+WAR E TPFG G+ Y+  Q+    R A F    T  +L+
Sbjct: 121 AWRVLGPGGRLLVMVPNRAGLWARSETTPFGFGRSYTAGQLEVQARAAGFVTERTGAALY 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGF-AGIYVIEARKILYQGLPITESKKKHISSPI 234
            PP+ ++  LK   ++E+ G        AG+ + E  K +    P+   ++  + SP+
Sbjct: 181 IPPSDRRFWLKSAQMWERAGLRISQVLVAGVVLTEFSKQVQA--PVGPGRRVSVPSPL 236


>gi|186475634|ref|YP_001857104.1| type 11 methyltransferase [Burkholderia phymatum STM815]
 gi|184192093|gb|ACC70058.1| Methyltransferase type 11 [Burkholderia phymatum STM815]
          Length = 271

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 55/262 (20%), Positives = 92/262 (35%), Gaps = 22/262 (8%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I++   + +S  G+   +     L     DV G   L LG         +    R L
Sbjct: 3   DRSIIDWPAWTTSPPGRYVLEWEQAQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGL 62

Query: 62  AFMPAGQ-------------GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFA 108
                               G          S       +LP    SVD ++M H LEF 
Sbjct: 63  VLDAESGASAPYTFPRGVAGGLPERHAPVGRSAVWCDLLDLPFEAQSVDLLVMPHTLEFT 122

Query: 109 EDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMIS 160
            DP  +L E  RVL   G++I++  N   +W   +     +G+P+        ++ ++  
Sbjct: 123 RDPHRLLREAERVLMPEGQLIIIGFNSLSLWGARQSVGKVAGRPFVPAAHDLIAFTRLKD 182

Query: 161 LLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
            ++   F L       + PP   +  L  +   E  G+ + P F  +YV+ A K +    
Sbjct: 183 WIKLLGFDLERGRFGCYRPPLVGENWLSRYQFMEAAGDRWWPIFGAVYVVTAIKRVRGMR 242

Query: 221 PITESK-KKHISSPILVPHTVS 241
            +   K KK + +  L P    
Sbjct: 243 LVGPLKVKKPVLAAGLAPAATP 264


>gi|207723985|ref|YP_002254383.1| generic methyltransferase; protein [Ralstonia solanacearum MolK2]
 gi|206589193|emb|CAQ36155.1| generic methyltransferase; protein [Ralstonia solanacearum MolK2]
          Length = 297

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/265 (20%), Positives = 91/265 (34%), Gaps = 29/265 (10%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF- 63
           I++   + +S  G+            T  D+ G   L LG+        +          
Sbjct: 10  IIDWHHWLASPPGQYVLRWEQAQFDRTVADMFGFHALQLGHPGFDALRENRIPLIARVID 69

Query: 64  --------------MPAGQGAT-----NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHY 104
                          PA            P +  +   +     LP A  S+D   + H 
Sbjct: 70  DIDPDAPIDTLDPTDPADPPGETDADPAVPRRQATPRVICRYDELPFASQSIDLAALPHV 129

Query: 105 LEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM--------EHTPFGSGQPYSWY 156
           LEF +DP  +L E+ RVL   GR+++   N   +W           E       Q  ++ 
Sbjct: 130 LEFTDDPHEVLREVARVLMPEGRLVITGFNPLSLWGMRQGMRRLGTESFLPAQSQMIAFT 189

Query: 157 QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL 216
           ++   L+   F +       + PP      L+  +  EK G+ + P F  +Y+++A K +
Sbjct: 190 RLKDWLKLLGFDIVRGRFGCYCPPNRTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV 249

Query: 217 YQGLPITESKKKHISSPILVPHTVS 241
                +  + K    SP LVP    
Sbjct: 250 RGMRLVGPAWKTR-KSPALVPAGTP 273


>gi|294085429|ref|YP_003552189.1| hypothetical protein SAR116_1862 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665004|gb|ADE40105.1| hypothetical protein SAR116_1862 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 240

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 113/226 (50%), Gaps = 1/226 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFF-SCFHGKVER 59
           M  D V+++ FY + LG   T  +   +   WD+         GY  PF          +
Sbjct: 1   MYRDTVQIQSFYDTPLGVTVTRLLDPYIRPFWDNRADAYNAVFGYGPPFLNMIDDAAKAK 60

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +A MPA  GA  WP      T L +  NLPL D  +D +++ H LEF +DP  +L E W
Sbjct: 61  AIALMPARHGAVIWPQTGQVRTILGNGHNLPLPDVQLDRLMLTHALEFDDDPAWLLDECW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RVL   G+++V+VPN+RG+W   E TP G G+P+S  Q+ + L +  F ++   R +F P
Sbjct: 121 RVLDGAGKLLVMVPNRRGIWTHRETTPLGHGRPFSRRQLETALTQHGFEVNHVHRVVFIP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
           P  +  +L+  S  E+ G    P    I +IEA K+LY     T  
Sbjct: 181 PMQRGPLLRFASTCEQFGQRCWPALGAILLIEATKMLYAPAGNTRK 226


>gi|300703804|ref|YP_003745406.1| s-adenosyl-l-methionine-dependent methyltransferase [Ralstonia
           solanacearum CFBP2957]
 gi|299071467|emb|CBJ42787.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Ralstonia solanacearum CFBP2957]
          Length = 297

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 53/265 (20%), Positives = 91/265 (34%), Gaps = 29/265 (10%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF- 63
           I++   + +S  G+            T  D+ G   L LG+        +          
Sbjct: 10  IIDWHHWLASPPGQYVLRWEQAQFDRTVADMFGFHALQLGHPGFDALRENRIPLIARVID 69

Query: 64  --------------MPAGQGAT-----NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHY 104
                          PA            P +  +   +     LP A  S+D   + H 
Sbjct: 70  DIDPDAPIDTLDPTDPADPPGETDADPAVPRRQATPRVICRYDELPFASQSIDLAALPHV 129

Query: 105 LEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM--------EHTPFGSGQPYSWY 156
           LEF +DP  +L E+ RVL   GR+++   N   +W           E       Q  ++ 
Sbjct: 130 LEFTDDPHEVLREVARVLMPEGRLVITGFNPLSLWGMRQGMRRLGTESFLPAQSQMIAFT 189

Query: 157 QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL 216
           ++   L+   F +       + PP      L+  +  EK G+ + P F  +Y+++A K +
Sbjct: 190 RLKDWLKLLGFDIVRGRFGCYCPPNRTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV 249

Query: 217 YQGLPITESKKKHISSPILVPHTVS 241
                +  + K    SP LVP    
Sbjct: 250 RSMRLVGPAWKTR-KSPALVPAGTP 273


>gi|83747772|ref|ZP_00944806.1| Methyltransferase [Ralstonia solanacearum UW551]
 gi|207742895|ref|YP_002259287.1| generic methyltransferase; protein [Ralstonia solanacearum IPO1609]
 gi|83725544|gb|EAP72688.1| Methyltransferase [Ralstonia solanacearum UW551]
 gi|206594290|emb|CAQ61217.1| generic methyltransferase; protein [Ralstonia solanacearum IPO1609]
          Length = 297

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 53/265 (20%), Positives = 91/265 (34%), Gaps = 29/265 (10%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF- 63
           I++   + +S  G+            T  D+ G   L LG+        +          
Sbjct: 10  IIDWHHWLASPPGQYVLRWEQAQFDRTVADMFGFHALQLGHPGFDALRENRIPLIARVID 69

Query: 64  --------------MPAGQGAT-----NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHY 104
                          PA            P +  +   +     LP A  S+D   + H 
Sbjct: 70  DIDPDAPIDTLDPTDPADPPGETDADPAVPRRQATPRVICRYDELPFASQSIDLAALPHV 129

Query: 105 LEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM--------EHTPFGSGQPYSWY 156
           LEF +DP  +L E+ RVL   GR+++   N   +W           E       Q  ++ 
Sbjct: 130 LEFTDDPHEVLREVARVLMPEGRLVITGFNPLSLWGMRQGMRRLGTESFLPAQSQMIAFT 189

Query: 157 QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL 216
           ++   L+   F +       + PP      L+  +  EK G+ + P F  +Y+++A K +
Sbjct: 190 RLKDWLKLLGFDIVRGRFGCYCPPNRTDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRV 249

Query: 217 YQGLPITESKKKHISSPILVPHTVS 241
                +  + K    SP LVP    
Sbjct: 250 RGTRLVGPAWKTR-KSPALVPAGTP 273


>gi|113868433|ref|YP_726922.1| methyltransferase [Ralstonia eutropha H16]
 gi|113527209|emb|CAJ93554.1| Methyltransferase [Ralstonia eutropha H16]
          Length = 243

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/231 (22%), Positives = 83/231 (35%), Gaps = 9/231 (3%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSS 80
               ++       D+ G   + LG         +      LA  P+            + 
Sbjct: 2   LRWEAQQYDRIVTDIFGYHAVQLGLPFIDTLRENRMPFSALALDPSSGPHGPRAAHPDAR 61

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
             L     LP    S+D V + H LEFAEDP  +L E+ RVL   GR++V   N   +W 
Sbjct: 62  QLLCRFDELPFDTQSIDLVTLPHILEFAEDPHEVLREVSRVLMPEGRVVVTCFNPMSLWG 121

Query: 141 RMEHTPFGSGQPYSWY--------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
             +        P+           ++   L+   F +       + PP      L+  + 
Sbjct: 122 ARQGMNRLGATPFLPTDAQQIGFVRIKDWLKLLGFDIIRGRFGCYCPPYRTDRWLQRAAF 181

Query: 193 FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILVPHTVST 242
            EK G+ + P F  +Y+I A K +     +  + K K   +P+  P    T
Sbjct: 182 MEKAGDRWWPIFGAVYMISAIKRVRNIRLVGPAWKSKPALAPVSSPVATPT 232


>gi|91788149|ref|YP_549101.1| hypothetical protein Bpro_2280 [Polaromonas sp. JS666]
 gi|91697374|gb|ABE44203.1| conserved hypothetical protein [Polaromonas sp. JS666]
          Length = 278

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/267 (18%), Positives = 88/267 (32%), Gaps = 27/267 (10%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  +I+ L  + ++  G             T  D+ G   L LG         +    + 
Sbjct: 1   MNSEIIGLTDWLTTPPGGYLLRWERAHFDQTVSDIFGFHALQLGLPELDALQANRMPHKW 60

Query: 61  LA-------------FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEF 107
           LA                A             +  +     LP  +SS+D V++ H LE 
Sbjct: 61  LAQESPLIATPSPPLADRASSATPAATGSSPRAALITDSAALPFPESSLDLVVLPHTLEL 120

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ-------------PYS 154
           + DP   L E+ RVL   GR+++   N   +W   +       +                
Sbjct: 121 SGDPHATLREVERVLVPEGRVVISGFNPTSLWGFRQSRGHFYQRLGYQDLFLPKTGEFIG 180

Query: 155 WYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           ++++   LR  NF +       + P    +  L  +   +  G  + P F  +Y + A K
Sbjct: 181 YWRLRDWLRLLNFEVESGRFGCYRPALTSQKWLDRFDWMDAAGERWWPIFGAVYFLVAVK 240

Query: 215 ILYQGLPITESKKKHISSPILVPHTVS 241
            +     +  + K    +P   P  V+
Sbjct: 241 RVRGVRLLEPAWKTR-KNPAAAPTAVA 266


>gi|114800073|ref|YP_762080.1| hypothetical protein HNE_3407 [Hyphomonas neptunium ATCC 15444]
 gi|114740247|gb|ABI78372.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 247

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 75/220 (34%), Positives = 114/220 (51%), Gaps = 1/220 (0%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR D V L +FY+S LGK     ++  L+  W +  G  +LGLGYA+P    F     R 
Sbjct: 1   MRQDAVTLERFYASDLGKAAAGILAGKLTDLWGESKGLSVLGLGYALPVLDAFATGPRRI 60

Query: 61  LAFMPAGQGATNW-PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
           +A +P   G   W      ++   V +  LP +D   D V+++H LE   DP   L EIW
Sbjct: 61  IAAVPHEHGPVRWDYSGRGNAAVAVGDPRLPFSDGLFDRVIILHGLEETGDPRAYLREIW 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RV    GR+++   N+ G+W+R   TPFG G+P++  Q+ +LL    F ++ +S +L+ P
Sbjct: 121 RVTAPEGRIVLAAANRAGLWSRATRTPFGHGRPWTRSQLSNLLSTGLFQVTASSSALYMP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG 219
           P     +      +E +G +  PG  G+ +IEA K LY  
Sbjct: 181 PAALGLVTSAAEGWEAMGRVIAPGMGGVVLIEAVKRLYAP 220


>gi|296158205|ref|ZP_06841037.1| Methyltransferase type 11 [Burkholderia sp. Ch1-1]
 gi|295891541|gb|EFG71327.1| Methyltransferase type 11 [Burkholderia sp. Ch1-1]
          Length = 288

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 57/276 (20%), Positives = 93/276 (33%), Gaps = 39/276 (14%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLEWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  PAGQ------------------------------GATNWPDQYFSSTALVSEGNLPLADS 94
            A                                G    P     S       +LP    
Sbjct: 66  AASGASAPYAFPRGAGHAGGNGARNGSNNGAAQGGLAGLPAPAGRSAVWCDLLDLPFEAQ 125

Query: 95  SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY- 153
           SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G+P+ 
Sbjct: 126 SVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFV 185

Query: 154 -------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAG 206
                  ++ ++   ++   F L       + PP   +  L  +   E  G+ + P F  
Sbjct: 186 PAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLGSEQWLSRYGFMEAAGDRWWPIFGA 245

Query: 207 IYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
            Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 TYMIKAIKRVRGMRLVGPLKVKKPVLAAGLAPAATP 281


>gi|187479405|ref|YP_787430.1| hypothetical protein BAV2935 [Bordetella avium 197N]
 gi|115423992|emb|CAJ50545.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 252

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 85/244 (34%), Gaps = 12/244 (4%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IVEL +++ +  GK               DV G     +G A P     +    +     
Sbjct: 8   IVELAEWFQTPPGKYALAWERARFDEEVADVFGYYAWQMGLADPDLLANNRMPFKAWVGA 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                 T WP +            LP    SVD +++ H LE AE P  +L E+ RVL  
Sbjct: 68  DLFTSDTAWPAR-----VQAQPELLPFESQSVDLLVLPHMLECAEAPHEVLREVERVLVP 122

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQPYSW-------YQMISLLREANFTLSITSRSLF 177
            GR+++   N   +W      P                 ++   L+  +F +       F
Sbjct: 123 EGRVVISGFNPWSLWGVRNALPGMEAWLPVPLKSQVSLPRLRDWLKLLSFEVDRGHYGCF 182

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            P    +  +K W   E +G  +      +YV+ A K +     I  + KK   +    P
Sbjct: 183 IPACRNESWIKRWHFMEGLGKRWWRVGGAVYVVSAVKRVSGMRLIGPAWKKKRKAAQGAP 242

Query: 238 HTVS 241
             VS
Sbjct: 243 VGVS 246


>gi|91784547|ref|YP_559753.1| hypothetical protein Bxe_A1252 [Burkholderia xenovorans LB400]
 gi|91688501|gb|ABE31701.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 289

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 57/277 (20%), Positives = 93/277 (33%), Gaps = 40/277 (14%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLEWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  PAGQ-------------------------------GATNWPDQYFSSTALVSEGNLPLAD 93
            A                                 G    P     S       +LP   
Sbjct: 66  AASGASAPYAFPRGGAGHAGGNGTRSGLNNGAAQGGLAGLPAPAGRSAVWCDLLDLPFEA 125

Query: 94  SSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY 153
            SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G+P+
Sbjct: 126 QSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPF 185

Query: 154 --------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
                   ++ ++   ++   F L       + PP   +  L  +   E  G+ + P F 
Sbjct: 186 VPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLGSEQWLSRYGFMEAAGDRWWPIFG 245

Query: 206 GIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
             Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 ATYMIKAIKRVRGMRLVGPLKVKKPVLAAGLAPAATP 282


>gi|323526833|ref|YP_004228986.1| type 11 methyltransferase [Burkholderia sp. CCGE1001]
 gi|323383835|gb|ADX55926.1| Methyltransferase type 11 [Burkholderia sp. CCGE1001]
          Length = 290

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 58/278 (20%), Positives = 93/278 (33%), Gaps = 41/278 (14%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLEWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  --------------------------------PAGQGATNWPDQYFSSTALVSEGNLPLA 92
                                           PA  G    P     S       +LP  
Sbjct: 66  AASGASAPYSFPRAGPHGGHGGNGAGNGMHAGPAPGGYAPLPAPGGRSAVWCDLLDLPFE 125

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQP 152
             SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G+P
Sbjct: 126 AQSVDLLVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRP 185

Query: 153 Y--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGF 204
           +        ++ ++   ++   F L       + PP      L  +   E  G+ + P F
Sbjct: 186 FVPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLDSDQWLSRYGFMEAAGDRWWPIF 245

Query: 205 AGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
              Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 GATYMIKAIKRVRGMRLVGPLKVKKPVLAAGLAPAATP 283


>gi|312795586|ref|YP_004028508.1| methyltransferase [Burkholderia rhizoxinica HKI 454]
 gi|312167361|emb|CBW74364.1| Methyltransferase (EC 2.1.1.-) [Burkholderia rhizoxinica HKI 454]
          Length = 270

 Score =  147 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 90/262 (34%), Gaps = 25/262 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+         L     D+ G   L LG         +    R L   
Sbjct: 6   IIDWPTWTESPPGRYVLAWEQSQLDRLVSDMFGYYALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  PAGQGAT----------------NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFA 108
            A   +                          T      +LP    SVD +++ H LEF 
Sbjct: 66  AASGASAPYRLPGQNSHGAADTGQRHAPPQRETLWCDFLDLPFESQSVDLLILPHTLEFT 125

Query: 109 EDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMIS 160
            DP  +L E  RVL   GR+++V  N   +W   +      G  +        ++ +M  
Sbjct: 126 HDPHRLLREAERVLVPEGRLVIVGFNSLSLWGMRQSISRRGGHAFVPAAHDLIAFTRMKD 185

Query: 161 LLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
            ++   F L       + PP   +  L  ++  E  G+ + P F   Y+I A K ++   
Sbjct: 186 WIKLLGFELDRGRFGCYRPPVDTEKWLARYAFMEAAGDRWWPIFGAAYMITAIKRVHGMR 245

Query: 221 PITESK-KKHISSPILVPHTVS 241
            I  +K KK   +P L P    
Sbjct: 246 LIGPAKIKKQALTPALNPVATP 267


>gi|170695450|ref|ZP_02886595.1| Methyltransferase type 11 [Burkholderia graminis C4D1M]
 gi|170139641|gb|EDT07824.1| Methyltransferase type 11 [Burkholderia graminis C4D1M]
          Length = 290

 Score =  147 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 92/278 (33%), Gaps = 41/278 (14%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLEWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  --------------------------------PAGQGATNWPDQYFSSTALVSEGNLPLA 92
                                           PA       P     S       +LP  
Sbjct: 66  AASGASAPYSFPRADAHAGNGAGNPTHGATHGPARGAFAPLPSPTGRSAVWCDLLDLPFE 125

Query: 93  DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQP 152
             SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G+P
Sbjct: 126 AQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRP 185

Query: 153 Y--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGF 204
           +        ++ ++   ++   F L       + PP      L  +   E  G+ + P F
Sbjct: 186 FVPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLDSDQWLSRYGFMEAAGDRWWPIF 245

Query: 205 AGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
              Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 GATYMIKAIKRVRGMRLVGPLKVKKPVLAAGLAPAATP 283


>gi|71907226|ref|YP_284813.1| generic methyl-transferase [Dechloromonas aromatica RCB]
 gi|71846847|gb|AAZ46343.1| generic methyl-transferase [Dechloromonas aromatica RCB]
          Length = 238

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 93/243 (38%), Gaps = 18/243 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I  +  + +S  G+   D   + L     D+ G   L LG     F   +    R  A
Sbjct: 1   MSIPGMDAWLASAPGRYVLDWEQRQLDGIVADIFGFNALQLGLPQGDFLRANRIPLRQQA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                               L +   LP A +S+D V++ H LEF+++P  +L E+ R+L
Sbjct: 61  GEYGQ------------VDVLCNYTALPFASNSIDLVVLPHILEFSDEPHQILREVERIL 108

Query: 123 TSGGRMIVVVPNKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
              G++IV+  N   +W              +G   S  ++   L+   F +   S   +
Sbjct: 109 IPEGQVIVIGFNPLSLWGLKRKLDRNGEYPWNGTYLSINRLKDWLKLLGFEVDRGSLGCY 168

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILV 236
            PP  +   L+ W   E   N +     G+YV+ A K  +    IT   KK  + +  L 
Sbjct: 169 VPPVDQLKWLQNWRFIENATNRWWNFSGGVYVLRAIKRTHSMRLITPKWKKQAVRAKALR 228

Query: 237 PHT 239
           P  
Sbjct: 229 PIA 231


>gi|134095498|ref|YP_001100573.1| hypothetical protein HEAR2320 [Herminiimonas arsenicoxydans]
 gi|133739401|emb|CAL62451.1| Conserved hypothetical protein, putative
           S-adenosyl-L-methionine-dependent methyltransferase
           [Herminiimonas arsenicoxydans]
          Length = 259

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/247 (21%), Positives = 93/247 (37%), Gaps = 11/247 (4%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+ L  +  +  G    +     L     D+ G     LG   P                
Sbjct: 10  IISLGSWLETAAGNYVRNWEHARLDELTVDIFGFNATQLGL--PQIQALRASRMPHTWLT 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                A     +      +    +LP A SS+D +++ H LEFA++P  +L E+ RVL  
Sbjct: 68  DTNLPAPAQAGEERRVVVIEDFEDLPFASSSIDLIVLPHVLEFAKEPHQVLREVERVLIP 127

Query: 125 GGRMIVVVPNKRGMWARME--------HTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            G++I+   N   +W   +        +     G+  S  ++   L+  N  +       
Sbjct: 128 EGQVIISGFNPYSLWGARQLAGRLSESYFLPEEGEFISPMRLKDWLKLLNMEVGDGHLGC 187

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPIL 235
           + PP   +  L  +S  E  G+ + P    +YV++A K +     I  + K +  ++P  
Sbjct: 188 YAPPCETEKWLHRFSFMENAGDKWWPFLGAVYVVQAIKRVRGMRLIGPAWKTQKATAPQG 247

Query: 236 VPHTVST 242
           VP T  T
Sbjct: 248 VPATNKT 254


>gi|187924848|ref|YP_001896490.1| methyltransferase type 11 [Burkholderia phytofirmans PsJN]
 gi|187716042|gb|ACD17266.1| Methyltransferase type 11 [Burkholderia phytofirmans PsJN]
          Length = 287

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/275 (20%), Positives = 93/275 (33%), Gaps = 38/275 (13%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTHSPPGRYVLEWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  PAG-----------------------------QGATNWPDQYFSSTALVSEGNLPLADSS 95
            A                               G    P     S       +LP    S
Sbjct: 66  AASGASAPYAYPRGAGRAANGDRNGLNNGAAQSGLAGLPAPAGRSAVWCDLLDLPFEAQS 125

Query: 96  VDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPY-- 153
           VD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G+P+  
Sbjct: 126 VDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGARQSVGKMTGRPFVP 185

Query: 154 ------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
                 ++ ++   ++   F L       + PP   +  L  +   E  G+ + P F   
Sbjct: 186 AAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLGSEQWLARYGFMEAAGDRWWPIFGAT 245

Query: 208 YVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
           Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 YMIKAIKRVRGMRLVGPLKVKKPVLAAGLAPAATP 280


>gi|152982721|ref|YP_001352900.1| hypothetical protein mma_1209 [Janthinobacterium sp. Marseille]
 gi|151282798|gb|ABR91208.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 256

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/245 (20%), Positives = 89/245 (36%), Gaps = 13/245 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+ L  +  +  G    D     L     D+ G     +G   P                
Sbjct: 10  IISLGPWLETPTGNYVRDWEHARLDELTVDIFGFNATQIGL--PQIDALRANRMPHTWLT 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
             G  A    ++      +     LP A +S+D V++ H LEFA++P  +L E+ RVL  
Sbjct: 68  DTGFPAKGHDNEAHPLVVVQDFEELPYASASIDLVILPHALEFAKEPHQVLREVERVLIP 127

Query: 125 GGRMIVVVPNKRGMWARME--------HTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            G++I+   N    W   +        +     G+  S  ++   L+  N  +S      
Sbjct: 128 EGQVIICGFNPYSFWGARQIIGRLSESYFLPQQGEFISLPRVKDWLKLLNMEVSGGYFGC 187

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
           + PP   +  L  ++  E +G  + P    +YV++A K +     I  + K   +     
Sbjct: 188 YAPPCETQKWLDRFTFLENVGERWWPYLGAVYVVQAVKRVRGMHLIGPAWK---TQKAAA 244

Query: 237 PHTVS 241
           P  V 
Sbjct: 245 PQGVP 249


>gi|209517195|ref|ZP_03266040.1| Methyltransferase type 11 [Burkholderia sp. H160]
 gi|209502331|gb|EEA02342.1| Methyltransferase type 11 [Burkholderia sp. H160]
          Length = 293

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/281 (19%), Positives = 92/281 (32%), Gaps = 44/281 (15%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   D     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLDWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  PAGQGATNWPDQYFSST-----------------------------------ALVSEGNL 89
            A   +  +     +                                           +L
Sbjct: 66  AASGASAPFTYPRAARHGGVSGTSGEGNVGGDNPGNAAPESPGLHAPAGRSAVWCDLLDL 125

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS 149
           P    SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +
Sbjct: 126 PFEAQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIILGFNSLSLWGVRQSVGKMT 185

Query: 150 GQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFG 201
           G+P+        ++ ++   ++   F L       + PP      L  +   E  G+ + 
Sbjct: 186 GRPFVPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLASDQWLARYGFMEAAGDRWW 245

Query: 202 PGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
           P F   Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 PIFGATYMIKAIKRVRGMRLVGPLKVKKPVLATGLAPAATP 286


>gi|332286828|ref|YP_004418739.1| hypothetical protein PT7_3575 [Pusillimonas sp. T7-7]
 gi|330430781|gb|AEC22115.1| hypothetical protein PT7_3575 [Pusillimonas sp. T7-7]
          Length = 247

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 86/238 (36%), Gaps = 15/238 (6%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+EL ++  +  G+       K +     +  G   + +G   P +              
Sbjct: 6   ILELAEWLDTPPGQYVRGWEQKQIDAMVCNAFGYHAIQIGL--PHWDLLQANRIPFK--- 60

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            A             +  + S  +LP    S+D +++ H LE + D   +L E  RVL  
Sbjct: 61  -ARTRVLFERAAEQGAALVASPESLPFDTQSIDLLVLPHVLECSNDSHQILREAERVLVP 119

Query: 125 GGRMIVVVPNKRGMWARMEHTP--------FGSGQPYSWYQMISLLREANFTLSITSRSL 176
            GR+++   N   +W   +  P            Q  S  ++    +  +F L       
Sbjct: 120 EGRIVISGFNPWSLWGASDRIPGLDPLLPIPAHLQ-VSLPRLKDWFKLLSFDLDRGRFGC 178

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
           + PP  ++  L  W+  EK G+ + P    +YV+ A K +     I    KK  S  +
Sbjct: 179 YAPPCSEQIWLDRWAFMEKAGDRWWPVCGAVYVVSAVKRVAGMRLIGPEWKKAKSKKV 236


>gi|311103919|ref|YP_003976772.1| methyltransferase [Achromobacter xylosoxidans A8]
 gi|310758608|gb|ADP14057.1| methyltransferase domain protein 1 [Achromobacter xylosoxidans A8]
          Length = 257

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 88/241 (36%), Gaps = 13/241 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF- 63
           IVEL +++ +  G+               DV G     +G A       +    +     
Sbjct: 8   IVELAEWFQTPPGQYALAWERAQFDAAVADVFGYYAWQVGLADMNLLRANRMPFKGYVGT 67

Query: 64  -MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            +P+ + A +W     S   L     LP    SVD +++ H  E AE+P  +L E+ RVL
Sbjct: 68  EIPSAESAASW----QSRVVLAEPEALPFESQSVDLLILPHAFECAEEPHNVLREVERVL 123

Query: 123 TSGGRMIVVVPNKRGMWA---RMEHTPFGSGQPYSW----YQMISLLREANFTLSITSRS 175
              GR+++   N   MW    RM        QP S      ++    +  +  +  +   
Sbjct: 124 VPEGRVVISGFNPWSMWGARTRMPGMEPWLPQPPSSQVSLPRLKDWFKLLSLEVDASHFG 183

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
            + P    +  L+ WS  E  G  +      +YV+ A K +     I  + KK       
Sbjct: 184 CYAPACRSEKWLQRWSFLESAGARWWSLGGAVYVVSAVKRVAGMRIIGPAWKKAKPKRAR 243

Query: 236 V 236
            
Sbjct: 244 A 244


>gi|295677148|ref|YP_003605672.1| Methyltransferase type 11 [Burkholderia sp. CCGE1002]
 gi|295436991|gb|ADG16161.1| Methyltransferase type 11 [Burkholderia sp. CCGE1002]
          Length = 292

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/280 (20%), Positives = 90/280 (32%), Gaps = 43/280 (15%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   +  S  G+   D     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTDSPPGRYVLDWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  PAG----------------------------------QGATNWPDQYFSSTALVSEGNLP 90
            A                                    GA         S       +LP
Sbjct: 66  AASGASAPYTYPPPAPRGSVSGISGAGNRGDDPANAAPGAPGLHAPAGRSAVWCDLLDLP 125

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSG 150
               SVD ++M H LEF  DP  +L E  RVL   G++I++  N   +W   +     +G
Sbjct: 126 FEAQSVDLLVMPHTLEFTSDPHRLLREAERVLVPEGQLIILGFNSLSLWGVRQSIGKMTG 185

Query: 151 QPYSWY--------QMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGP 202
           +P+           ++   ++   F L       + PP      L  +   E  G+ + P
Sbjct: 186 RPFVPSAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLASDQWLARYGFMEAAGDRWWP 245

Query: 203 GFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
            F   Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 IFGATYMIKAIKRVRGMRLVGPLKVKKPVLAAGLAPAATP 285


>gi|121594112|ref|YP_986008.1| type 11 methyltransferase [Acidovorax sp. JS42]
 gi|120606192|gb|ABM41932.1| Methyltransferase type 11 [Acidovorax sp. JS42]
          Length = 259

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 87/242 (35%), Gaps = 15/242 (6%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  +I+ L  ++ +  G+       +       D+ G   L LG         +    R 
Sbjct: 1   MTGEIIGLHHWFDTAPGRYLLAWEQERYDELVADIFGYHALQLGMPGLQALRSNRMPHRW 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           LA MP  +      D       L     LP A++S+D + + H LE + DP   L E+ R
Sbjct: 61  LAVMP-PELLLERSDAQEPPALLADAVALPFAEASLDLLALPHTLELSVDPHTALREVHR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ--------------PYSWYQMISLLREAN 166
           VL   G++++   N   +W   +       +                S  ++   LR   
Sbjct: 120 VLVPEGKVVISGLNPLSLWGLRQRRSRLYQRCGAGGRLFLPDVGEFISPGRLRDWLRLLG 179

Query: 167 FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK 226
           F L   S   + P       L+ +   + +G  + P F   YVI A K +     +  S 
Sbjct: 180 FELESMSFGCYRPAVAGDRWLQRYGWMDALGARWWPIFGAAYVIVAVKRVQGMRLLEPSW 239

Query: 227 KK 228
           +K
Sbjct: 240 RK 241


>gi|291613976|ref|YP_003524133.1| methyltransferase type 11 [Sideroxydans lithotrophicus ES-1]
 gi|291584088|gb|ADE11746.1| Methyltransferase type 11 [Sideroxydans lithotrophicus ES-1]
          Length = 249

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 52/238 (21%), Positives = 86/238 (36%), Gaps = 18/238 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L ++ SS  G        +    T  D+ G   L LG     F        R  A     
Sbjct: 11  LSEWSSSEQGNYVLKREQEYFDRTVSDIFGFNALQLGLPEHDFLHSSRMPLRFTAG---- 66

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                       +   +    LP    S+D VL+ H LEFAE+P  +L E+ RVL   G 
Sbjct: 67  --------NQAGNNVRLRCDELPFDSDSLDLVLLPHVLEFAENPHQILREVERVLRPEGN 118

Query: 128 MIVVVPNKRGMWARMEHT-----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           +I+   N   +W               G+     ++   L    F ++    + + PP H
Sbjct: 119 LIISGFNPFSLWGLHRALGRKQGYPWRGRFIRLPRLKDWLALLGFEVAGGRFAAYAPPLH 178

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
           +   L+ ++  EK G+ +     G+Y + A K +     I     + +    L+P + 
Sbjct: 179 QSRWLERFAFMEKAGDRWWAVSGGVYFLHAIKRVPGMRLIKPKWNEGL-VRNLMPASA 235


>gi|293603366|ref|ZP_06685794.1| type 11 methyltransferase [Achromobacter piechaudii ATCC 43553]
 gi|292818276|gb|EFF77329.1| type 11 methyltransferase [Achromobacter piechaudii ATCC 43553]
          Length = 259

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 77/237 (32%), Gaps = 13/237 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IVEL +++ +  G+               DV G     +G A       +    +     
Sbjct: 8   IVELAEWFQTPPGQYALAWERAQFDAAVADVFGYYAWQVGLADMNLLRANRMPFKGYVGT 67

Query: 65  --PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
             P+      W     S   L     LP    SVD +++ H  E  +DP  +L E+ RVL
Sbjct: 68  ETPSADSIAAW----QSRVVLAEPEALPFESQSVDLLILPHAFECTQDPHNVLREVERVL 123

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWY-------QMISLLREANFTLSITSRS 175
              GR+++   N   MW      P                 ++    +  +  +  +   
Sbjct: 124 VPEGRVVISGFNPWSMWGARTRMPGMEPWLPQPPSSQVSLVRLKDWFKLLSLEVKESQFG 183

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            + P    +  L+ W   E  G  +      +Y++ A K +     I  + K     
Sbjct: 184 CYAPACRSEKWLQRWGFLESAGARWWSLGGAVYMVSAVKRVAGMRIIGPAWKTKPKR 240


>gi|30248165|ref|NP_840235.1| Generic methyl-transferase [Nitrosomonas europaea ATCC 19718]
 gi|30180050|emb|CAD84050.1| Generic methyl-transferase [Nitrosomonas europaea ATCC 19718]
          Length = 278

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 48/248 (19%), Positives = 92/248 (37%), Gaps = 22/248 (8%)

Query: 1   MRVDIVE--LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M   +++  ++Q+  + LG+   +   +       D+ G     +G++   F   +    
Sbjct: 1   MFDSVLQQSMQQWLETSLGQYVLEQEQRYFDRVVTDIFGYNATQIGFSGFDFLRNNRMPF 60

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
           +                    ++       LP+  SS+D VL+ H LEF  +P  +L E 
Sbjct: 61  KF------------AFGVRDGASVYAHPHFLPIKSSSIDLVLLPHTLEFNSNPHQILREA 108

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHT------PFGSGQPYSWYQMISLLREANFTLSIT 172
            RVL   G++I+   N   +W   +            G+  +  +M   L   NF +   
Sbjct: 109 HRVLIPEGKVIISGFNPFSLWGMRQRMAKSKTDFPWCGRFIALPRMQDWLELHNFEIVAG 168

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
               + PP  ++  L      E  G+ + P   G+Y ++A K       IT   +   + 
Sbjct: 169 QFGCYVPPCTREKWLSRLRFMEAAGDRWWPIAGGVYFLQAVKHECGLHIITPRWEDSPAK 228

Query: 233 P--ILVPH 238
              ++VP 
Sbjct: 229 RGTVVVPQ 236


>gi|118161393|gb|ABK64075.1| putative methyltransferase [Janthinobacterium lividum]
          Length = 258

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 94/244 (38%), Gaps = 13/244 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+ L  +  +  G        + L +   D+ G   + +G   P               +
Sbjct: 10  IIALDGWLQTPAGLYVRAWEQQCLDSLTVDIFGFNAVQIGL--PQLDALAASRMPNKWLL 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            +       P Q    T + +   LP    S+D V++ H LEFA +P  +L E+ RVL  
Sbjct: 68  DSR--LPPHPPQESRLTLVSAFDELPFDSQSLDLVVLPHVLEFAAEPHQVLREVERVLIP 125

Query: 125 GGRMIVVVPNKRGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            GR+IV   N   +W            H    +G+  S  +M   L+  N  +S +    
Sbjct: 126 EGRVIVCGFNPASLWGMRQGLGRVTGRHYLPQAGELISMPRMKDWLKLLNMGVSQSHFGC 185

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPIL 235
           + P    +  L+  +  +K G  + P    +Y+++A K +     I  +  KK  ++P  
Sbjct: 186 YAPACRTEKWLRRNAFMDKAGARWWPYLGAVYIVQAIKRVKGMRLIGPAWTKKPATAPAG 245

Query: 236 VPHT 239
            P T
Sbjct: 246 APVT 249


>gi|330813477|ref|YP_004357716.1| SAM-dependent methyltransferase 2 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486572|gb|AEA80977.1| SAM-dependent methyltransferase 2 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 237

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/223 (28%), Positives = 102/223 (45%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DI++L +FY S LGK   D I   L          +L   G+  P+ S    K    
Sbjct: 1   MYQDIIKLEKFYQSELGKAVQDRIYSKLKKYIYLHDEEKLGSFGFGEPYLSLLPKKKASI 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
             F     G          S  L+ E  LP+ D  ++ ++ +H LE +E+    L E+WR
Sbjct: 61  FNFFSQQMGIKKNIINERFSNVLLDEEQLPIEDLFLNHIICIHCLEHSENLKKTLRELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL+  G++ +++PNK+  W+    +PF SG  +S  Q+  +L +  F +    R ++FP 
Sbjct: 121 VLSPEGKIYIILPNKKSSWSFSSKSPFSSGFGFSKNQITRVLEDNFFEIQSIDRLVYFPS 180

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT 223
            + + +L      EKIG+ F   F G Y+  A K +Y      
Sbjct: 181 WNSRLLLNNRFFLEKIGSYFWRFFNGFYLCVATKRIYANSKAK 223


>gi|56479131|ref|YP_160720.1| generic methyl-transferase [Aromatoleum aromaticum EbN1]
 gi|56315174|emb|CAI09819.1| Generic methyl-transferase [Aromatoleum aromaticum EbN1]
          Length = 246

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 51/246 (20%), Positives = 89/246 (36%), Gaps = 19/246 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I+ L  +  +  G+      S        D+ G   + +G     F   +    R   
Sbjct: 1   MSILSLSDWLETPQGQYLLQWESARFDVLVADIFGYNAVQIGLPEHEFLRGNRMPFRFRC 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                        +   +  + +   LP A +++D VL+ H LEF+ +P  +L E+ RVL
Sbjct: 61  ------------ARLGEAEVMSNAEALPFATATLDLVLLPHVLEFSPNPHQVLREVERVL 108

Query: 123 TSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
              G  I+   N   +W       R +      GQ  S  +    L    F     S   
Sbjct: 109 VPEGHAIISGFNPLSLWGVRRLLARDDGAFPWRGQYLSVRRTKDWLALLGFETQSGSFGC 168

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPIL 235
           + P       L+ W   +K G+ + P F G Y+I+  K +     IT + + +  ++  L
Sbjct: 169 YAPAVTSGKWLERWRFIDKAGDRWWPIFGGTYIIQGIKRVQGMRLITPNWRDRRAAAKRL 228

Query: 236 VPHTVS 241
            P    
Sbjct: 229 SPVAQR 234


>gi|257095467|ref|YP_003169108.1| type 11 methyltransferase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047991|gb|ACV37179.1| Methyltransferase type 11 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 241

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 86/241 (35%), Gaps = 19/241 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I  L  +  +  G+         +  T  DV G   + LG         +    R +A
Sbjct: 1   MSIAGLDAWLQTPQGRYVMAWEQARIDATVADVFGYNAIQLGLPQLDLLAQNRIPLRQVA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                       D       +     LP A  S+D ++M H LEF +DP  +L E+ RVL
Sbjct: 61  ------------DASGPVDVICDLRQLPFAAHSIDALVMAHVLEFHDDPHQILREVERVL 108

Query: 123 TSGGRMIVVVPNKRGMWARMEHT------PFGSGQPYSWYQMISLLREANFTLSITSRSL 176
              G +++   N   +W               +G   S  ++   L+   F + +     
Sbjct: 109 IPEGEVLITGFNPLSIWGLRRRLPNCPRDFPWNGHYLSVLRLKDWLQLLGFAVDLVDFGC 168

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPIL 235
           + PP   +  LK W   E  G  +     G+Y++ A K ++    I  S K +     +L
Sbjct: 169 YVPPCEHERWLKRWHFMEATGARWWSFAGGVYLMRAIKRVHAMRLILPSWKQQKAPRKVL 228

Query: 236 V 236
            
Sbjct: 229 S 229


>gi|329900787|ref|ZP_08272591.1| SAM-dependent methyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549376|gb|EGF33944.1| SAM-dependent methyltransferase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 256

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 83/240 (34%), Gaps = 12/240 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+ L  +  S  G          L     D+ G   + +G         +    +     
Sbjct: 10  IIALGPWLDSAAGAYVLAWEQSCLDALTADIFGFNAMQIGLPQINALSANRMPNKW---- 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            A            +         LP A  S+D V++ H LEF+ +P  +L E+ RVL  
Sbjct: 66  LADTHVDLASGAPRAVAIAHDLAELPFASQSLDLVVLPHVLEFSREPHQVLREVERVLRP 125

Query: 125 GGRMIVVVPNKRGMWARMEHTP--------FGSGQPYSWYQMISLLREANFTLSITSRSL 176
            GR+I+   N   +W   +              GQ     ++   L   N  +       
Sbjct: 126 EGRLIICGFNSASLWGARQMAGRLSGSAFLPRDGQFIGMPRLKDWLELLNMEVDHGYFGC 185

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
           + PP   +  L+ ++  EKIG  + P    +YV+ A K +     I  + ++  +S    
Sbjct: 186 YAPPCRTEKWLERFAFMEKIGRRWWPYLGAVYVVHAIKRVKGMHLIGPAWRRPAASSARA 245


>gi|71726090|gb|AAZ39213.1| putative methyltransferase [Janthinobacterium lividum]
          Length = 258

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 55/244 (22%), Positives = 95/244 (38%), Gaps = 13/244 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+ L  +  +  G        + L +   D+ G   + +G   P               +
Sbjct: 10  IIALDGWLQTPAGLYVRAWEQQCLDSLTVDIFGFNAVQIGL--PQLDALAANRMPNKWLL 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            A     + P Q    T + +   LP    S+D V++ H LEFA +P  +L E+ RVL  
Sbjct: 68  DAR--LPSLPPQERRLTLVSAFDELPFDSQSLDLVVLPHVLEFAAEPHQVLREVERVLIP 125

Query: 125 GGRMIVVVPNKRGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            GR+IV   N   +W            H    +G+  S  +M   L+  N  +S +    
Sbjct: 126 EGRVIVCGFNPASLWGARQGLGRVTGRHYLPQAGELISMPRMKDWLKLLNMGVSQSHFGC 185

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPIL 235
           + P    +  L+  +  +K G  + P    +Y+++A K +     I  +  KK  ++P  
Sbjct: 186 YAPACKTEKWLRRNAFMDKAGARWWPYLGAVYIVQAIKRVKGMRLIGPAWTKKPATAPAG 245

Query: 236 VPHT 239
            P T
Sbjct: 246 APVT 249


>gi|171463547|ref|YP_001797660.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193085|gb|ACB44046.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 272

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 87/232 (37%), Gaps = 10/232 (4%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            ++  S  G+   +   +       DV G   + +G   P  +            +    
Sbjct: 20  EKWLQSPPGRYVLNWEQRCFDQIVADVFGFHAVQIGL--PQINTLSENRMPLHVILVNSN 77

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
            +     +Y       S   LP A  S+D +++ H LEFA DP  +L E+ RVL   GR+
Sbjct: 78  DSRTEAGRYNWHLIEASSTELPFASESLDLIVLPHVLEFAADPHQILREVDRVLRPEGRL 137

Query: 129 IVVVPNKRGMWARMEH--------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           I+   N   +W   ++             GQ  S   +   L   NF+L       +  P
Sbjct: 138 IISGFNPTSLWGAKQYLSRLVGSPYLPRDGQFISLIHLKDWLELLNFSLDRGHFGCYKFP 197

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
              + +++  +  EK+GN + P F  ++++ A K       I  +    I +
Sbjct: 198 LQGEAVMRKMNFLEKMGNRWWPIFGAVFLVSAIKRQQGIRLIGPASLVRIPA 249


>gi|297538710|ref|YP_003674479.1| type 11 methyltransferase [Methylotenera sp. 301]
 gi|297258057|gb|ADI29902.1| methyltransferase type 11 [Methylotenera sp. 301]
          Length = 262

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 90/246 (36%), Gaps = 17/246 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            +L+ + +S  G+        +      D+ G   L +G A            R +A   
Sbjct: 10  QQLQIWLASTSGQYLQAKEQYLYDHAVVDLFGFNALQMGCAQMELLRNSRIPNRFVASEF 69

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           A             S    S+  LP AD S+D +L+ H LEF+E P   L E  RV+   
Sbjct: 70  AIDTVQ--------SQLSCSDDFLPFADMSIDLLLLPHRLEFSERPHQTLREAARVMMPE 121

Query: 126 GRMIVVVPNKRGMWA---------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
           G +++   N+  +W              +   +G+     ++   L    F +       
Sbjct: 122 GHLVISGFNQLSLWGATAGLKKITSKNSSYPWNGKFIGLTRLKDWLALLGFEVVSVEMCC 181

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
             PP  ++   K +S F+K+ +       G+Y + A+K +    PI  S K       L+
Sbjct: 182 HIPPFEQQSWHKRFSFFDKVSSRRCAMLGGVYFVVAKKRVVGMTPIKPSWKLSPLKSTLI 241

Query: 237 PHTVST 242
           P    +
Sbjct: 242 PSPTQS 247


>gi|237746603|ref|ZP_04577083.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
 gi|229377954|gb|EEO28045.1| conserved hypothetical protein [Oxalobacter formigenes HOxBLS]
          Length = 274

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 92/248 (37%), Gaps = 18/248 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + +  +  +  + +G+   +   K       D+ G   L +G+        +    R   
Sbjct: 1   MKVQTMHDWLMTPVGQYILEWEEKHFQALSADIFGYNALQIGFCEINALKENRMTNRWYT 60

Query: 63  --FMPAGQ--------GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
             FMP                 D     + +     LP A  S+D +++ H  EFA  P 
Sbjct: 61  NPFMPESGIRQMTDNGHPEKTEDSPVRISLVHDIDELPFASESIDLIILPHAFEFAHSPH 120

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP--------FGSGQPYSWYQMISLLRE 164
            +L E+ RVL   G++I+   N   +W   +H              +  S  ++   L+ 
Sbjct: 121 QILREVDRVLIPEGQVIISGFNPASLWGVRQHFGRLWGNRFLPEHAEFLSLSRLKDWLKL 180

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
            NF +S      + PP   +  L+ ++  EK GN + P    IY+I A K ++    I  
Sbjct: 181 LNFEISRGYFGCYRPPCRTRRWLRRFAFMEKAGNRWWPYLGAIYLIGAIKRVHGVHLINP 240

Query: 225 SKKKHISS 232
           + +K    
Sbjct: 241 AFRKSPRR 248


>gi|254418305|ref|ZP_05032029.1| Methyltransferase domain family [Brevundimonas sp. BAL3]
 gi|196184482|gb|EDX79458.1| Methyltransferase domain family [Brevundimonas sp. BAL3]
          Length = 249

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 86/242 (35%), Positives = 130/242 (53%), Gaps = 3/242 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  I ELR FY    G      +++ L   W +   C +LG+GYA P+   F G   R 
Sbjct: 1   MRRSIDELRTFYGEPTGALVRRLLARRLDDAWGEAPDCDVLGVGYATPWLDAFVG-ARRV 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +A MP+GQG  +WP    + T LV +  LP A  S D +L+VH LE A+DP  +L E  R
Sbjct: 60  VAAMPSGQGVEHWPSVGRNRTLLVDDRRLPFAAGSFDRILLVHALEEADDPAALLLEAVR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            L   GR+I+    + G+WAR E+TPFG G+P++  Q+  L+REA    +  S++L+ PP
Sbjct: 120 ALAPTGRIILAAAARGGLWARAENTPFGHGRPFTRGQLERLVREAGLEPAAWSQTLYVPP 179

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                +L L   FE++G    P  AG+ ++EA +  Y  +  +   ++  + P L P   
Sbjct: 180 WT--PLLPLADGFEQVGRRIAPNTAGVILLEASRQAYARIRPSGLAQRVPARPALTPQPA 237

Query: 241 ST 242
           ++
Sbjct: 238 AS 239


>gi|149927489|ref|ZP_01915743.1| Methyltransferase type 11 [Limnobacter sp. MED105]
 gi|149823762|gb|EDM82988.1| Methyltransferase type 11 [Limnobacter sp. MED105]
          Length = 272

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 83/242 (34%), Gaps = 13/242 (5%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L  + ++  G+  T      + +   D+ G R + LG           +           
Sbjct: 20  LDAWLNTPAGRYFTSREQAWIDSVVPDLFGFRAVQLGT---RLVDGLKESRIPHRAYVQQ 76

Query: 68  QGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
               + P+     T         LP    S+D +++ H LEF+EDP  +L E+ RVL   
Sbjct: 77  GLVASKPEGVEVVTPDCFAEFEELPFESQSLDMIVLPHVLEFSEDPHQLLREVERVLMPE 136

Query: 126 GRMIVVVPNKRGMWARMEHT-------PFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           GR+++   N   +W                  +P    ++   L+  +          + 
Sbjct: 137 GRVVITGFNPMSLWGLRHAALKRWAPVWPEGCEPIHLSRLKDWLKLLSCEPEFGRFGCYR 196

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILVP 237
            P   +  L      E  G+ + P    +Y + A K +     I  + K K +S+  L P
Sbjct: 197 FPAFTEKGLSRMGFMEHAGDRWWPVCGAVYFVCAVKRVRGMRLIGPAFKDKKVSARQLKP 256

Query: 238 HT 239
             
Sbjct: 257 VA 258


>gi|226196222|ref|ZP_03791807.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254298051|ref|ZP_04965504.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157807623|gb|EDO84793.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|225931808|gb|EEH27810.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
          Length = 250

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 54/243 (22%), Positives = 85/243 (34%), Gaps = 21/243 (8%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG------------Q 68
                  L  T  DV G   L LG         +    R L   PA             +
Sbjct: 2   LGWEQAQLDRTVSDVFGFHALQLGLPQLDALRENRMPCRGLVLDPASGASAPYHYPWARE 61

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +        ST      +LP    SVD ++M H LEF  DP  +L E  RVL   G++
Sbjct: 62  ARSAEHAPAGRSTVWCDLLDLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQL 121

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLREANFTLSITSRSLFFPP 180
           ++   N   +W         + +P+           ++   ++   F L       + PP
Sbjct: 122 VITGFNSLSLWGARHSVGKMAKRPFVPATRDQITFIRLKDWIKLLGFDLERGRFGCYRPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHT 239
                 L  ++  E  G+ + P F  +Y++ A K +     +   K KK + +P L P  
Sbjct: 182 LATDKWLSRYAFMEAAGDRWWPIFGAVYMVTAIKRVRGMRLVGPIKMKKPVLAPGLTPAA 241

Query: 240 VST 242
             T
Sbjct: 242 TPT 244


>gi|262277920|ref|ZP_06055713.1| putative SAM-dependent methyltransferase protein [alpha
           proteobacterium HIMB114]
 gi|262225023|gb|EEY75482.1| putative SAM-dependent methyltransferase protein [alpha
           proteobacterium HIMB114]
          Length = 235

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 3/235 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M +DI+  ++FY S +GK     I   L           +   GYA P+ S F  +   +
Sbjct: 1   MYLDILNYQKFYVSAIGKFLAHRIENQLKKYCYLYDNQNIGCFGYAHPYLS-FLKEYNLS 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +++  + +   +          L+ E  +P  DS  D V ++HYLE   +  L L EIWR
Sbjct: 60  ISYCYSKRMGISDEAVIKGKKILIDEERIPFQDSFFDHVFLIHYLENNNNTKLSLREIWR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            L+  G++ +++PNK+  W   + +PF SG  +S  Q+  LL E+ F +    R ++FP 
Sbjct: 120 SLSPEGKLYILIPNKKSSWYLSDKSPFSSGNGFSKKQISQLLEESFFDIQSIERLIYFPN 179

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
            + K I     + EK G+I    F G+Y    +K +Y  +   +  K  +   ++
Sbjct: 180 LNIKFI--NHDLIEKFGSILFKYFNGVYFCVVKKRIYANIKNQDLIKSSLVKKVI 232


>gi|82702747|ref|YP_412313.1| generic methyl-transferase [Nitrosospira multiformis ATCC 25196]
 gi|82410812|gb|ABB74921.1| generic methyl-transferase [Nitrosospira multiformis ATCC 25196]
          Length = 259

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 49/238 (20%), Positives = 89/238 (37%), Gaps = 20/238 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
           +++ + LG+   +   K       +V G   + +G+    F   +    +  A       
Sbjct: 8   EWFETCLGQYLLEREQKYFDKAVANVFGYNAVQVGFPQYDFLRTNRMPLKFCA------- 60

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                     +  L +   LP+  +S D VLM H LEF+ +P  +L E+ RVL   G +I
Sbjct: 61  -----APEKGADVLAAPDFLPIETNSTDLVLMPHMLEFSSNPHQILREVQRVLMPEGNLI 115

Query: 130 VVVPNKRGMWARM-------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           V   N R +W          E      G   +  ++   L   +F ++   +  + PP  
Sbjct: 116 VSGFNPRSLWGIRGLFGSPREGGFPWRGNFIALPRLKDWLTLLDFEITEDRQCCYAPPFS 175

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK-HISSPILVPHT 239
           ++  L  +   E+ G   G    G+Y + A K ++    I    K+       + P  
Sbjct: 176 QEKWLTRFHFMEEAGERLGRFSGGVYFLTAVKRVHGMRVIKPEWKEVRARKRAMSPIA 233


>gi|296532383|ref|ZP_06895114.1| type 11 methyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296267294|gb|EFH13188.1| type 11 methyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 259

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 123/232 (53%), Gaps = 1/232 (0%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R FY+S LG      + + L+  W D++G  +LGLG+A P+   +  +  R LA      
Sbjct: 13  RDFYASPLGLVAARLLRERLARLWPDLSGRAVLGLGHAAPYLRLWREQASRILAASLPET 72

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
               WP    S TA V +  LP  D S D VL+VH LE AE+    L E+WRVL   GR+
Sbjct: 73  DTVPWPPGGASLTARVEDAALPFPDLSFDRVLLVHGLEGAENDRRALREVWRVLKDDGRV 132

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           ++V PN+RG+WA  + TPFG G+PYS  Q+  LL    FT      +LF PP   + +L+
Sbjct: 133 LIVAPNRRGLWAHRDSTPFGQGRPYSTGQLSRLLERNMFTAERRDTALFTPPFQARLLLR 192

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              ++E  G    P FAG+ ++EARK +Y  LP     +      +LVP  V
Sbjct: 193 AAGLWEGAGRSLAPRFAGLVIVEARKSIYGVLPAH-GARLRPGRRVLVPEAV 243


>gi|220934130|ref|YP_002513029.1| Methyltransferase type 11 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995440|gb|ACL72042.1| Methyltransferase type 11 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 260

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 83/224 (37%), Gaps = 16/224 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            D  +LR +Y++  G+     + +  ++    + G   L +G  +               
Sbjct: 20  RDRQDLRAWYATPPGEALRAELRRYAASVVPQLFGYHALQVG-DLGESLDMLEGSRIIHQ 78

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
              +             +  L     LP+   ++D V++ H LEF  DP  +L E+ R L
Sbjct: 79  VSLS---------LTPPAQVLAQPRALPVQSDTLDVVVLAHVLEFCSDPHQVLREVDRTL 129

Query: 123 TSGGRMIVVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
              G +++V  N   +                 G+ YS +++   LR   F L     + 
Sbjct: 130 VPEGHLLIVGFNPFSLMGLRRLFAGRGGMAPWRGRYYSVFRIKDWLRLLGFDLVACVPAG 189

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL 220
           F PP     +L+     E +G  F P F G YVI ARK +    
Sbjct: 190 FRPPLRGAGLLRRLQFMETLGARFWPYFGGAYVILARKRVATLT 233


>gi|253996675|ref|YP_003048739.1| type 11 methyltransferase [Methylotenera mobilis JLW8]
 gi|253983354|gb|ACT48212.1| methyltransferase type 11 [Methylotenera mobilis JLW8]
          Length = 262

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 88/242 (36%), Gaps = 22/242 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+ +S LG+        +      D+ G   L +G              R  +   A  
Sbjct: 15  HQWLNSALGRYLRQEEQVLYDQAVVDLFGFNALQIGCLQMDLLRNSRIAHRYSSTEYA-- 72

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                 +          +  LP+AD+S+D +++ H LEF+E P   L E  RV+   G +
Sbjct: 73  ------NVAEFPHLYCCDDFLPIADASLDLLILPHRLEFSERPHQTLREAERVMMPEGHL 126

Query: 129 IVVVPNKRGMWARM-------------EHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           ++   N   +W                  +   +G      ++   L    F +      
Sbjct: 127 LISGFNPLSLWGMALFLRNLLHSNDAAAKSFPWTGSFIGLGRLKDWLALLGFEVVSVQMC 186

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPI 234
              PP  ++   + +    K+G  +     G+Y I A+K +    P+  S K + ++SP+
Sbjct: 187 CHIPPFEQESWHRRFGFMGKLGAKWLSAIGGVYFIVAKKRVVGMTPLKPSWKAQPVTSPL 246

Query: 235 LV 236
           +V
Sbjct: 247 VV 248


>gi|307730500|ref|YP_003907724.1| methyltransferase type 11 [Burkholderia sp. CCGE1003]
 gi|307585035|gb|ADN58433.1| Methyltransferase type 11 [Burkholderia sp. CCGE1003]
          Length = 311

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 57/299 (19%), Positives = 95/299 (31%), Gaps = 62/299 (20%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I++   + +S  G+   +     L     DV G   L LG         +    R L   
Sbjct: 6   IIDWPAWTNSPPGRYVLEWEQTQLDRVVSDVFGYHALQLGLPQLDALRENRMPCRGLVLD 65

Query: 65  -----------------------------------------------------PAGQGAT 71
                                                                PA     
Sbjct: 66  AASGASAPYSFPRSAAHPGNPAGNSLNDSLKNGLNNGANGGMSNGAGHGTTHGPARNTFA 125

Query: 72  NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
             P     S       +LP    SVD ++M H LEF  DP  +L E  RVL   G++I++
Sbjct: 126 PLPAPGGRSAVWCDLLDLPFEAQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQLIIL 185

Query: 132 VPNKRGMWARMEHTPFGSGQPY--------SWYQMISLLREANFTLSITSRSLFFPPTHK 183
             N   +W   +     +G+P+        ++ ++   ++   F L       + PP   
Sbjct: 186 GFNSLSLWGARQSVGKMTGRPFVPAAVDLIAFTRLKDWIKLLGFDLERGRFGCYRPPLDS 245

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
           +  L  ++  E  G+ + P F   Y+I+A K +     +   K KK + +  L P    
Sbjct: 246 EQWLSRYAFMEAAGDRWWPIFGATYMIKAIKRVRGMRLVGPLKVKKPVLAAGLTPAATP 304


>gi|33598344|ref|NP_885987.1| hypothetical protein BPP3835 [Bordetella parapertussis 12822]
 gi|33603254|ref|NP_890814.1| hypothetical protein BB4279 [Bordetella bronchiseptica RB50]
 gi|33566902|emb|CAE39118.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33577378|emb|CAE34643.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 256

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 81/245 (33%), Gaps = 14/245 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE--RTLA 62
           IVEL +++ +  G+               D+ G     +G A P     +         A
Sbjct: 8   IVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGA 67

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            +P  + A  W           +   LP    SVD +++ H  E AE P L+L E+ RVL
Sbjct: 68  GVPPPELAQGWQA-----CVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVL 122

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSW-------YQMISLLREANFTLSITSRS 175
              GR+++   N   +W      P                 ++    +  +F +      
Sbjct: 123 VPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFG 182

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
            + P       L+ W   E+ G  +      +YV+ A K +     I  + K        
Sbjct: 183 CYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQA 242

Query: 236 VPHTV 240
               V
Sbjct: 243 ASVAV 247


>gi|74317682|ref|YP_315422.1| methyl-transferase [Thiobacillus denitrificans ATCC 25259]
 gi|74057177|gb|AAZ97617.1| methyl-transferase [Thiobacillus denitrificans ATCC 25259]
          Length = 245

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 82/236 (34%), Gaps = 18/236 (7%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           ++ + LG+       +       DV G   + +G     F        R    +      
Sbjct: 9   WFDTPLGQHLLFREQRYFDDAVSDVFGFHAVQVGLPNIDFLRNSRIPLRVNCAV------ 62

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                    S        LP    S+D +L+ H LEF+ +P  +L E  RVL   GR+++
Sbjct: 63  ------EPPSQVRADPMFLPFQSQSLDLLLLPHVLEFSANPHQVLREAERVLRPEGRLVL 116

Query: 131 VVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N R +W               +G   +  ++   +      ++  S   + PP +++
Sbjct: 117 AGFNPRSLWGLARIAQGGERGYPWNGNFLNISRVKDWMVLLGLEVAGGSMCCYRPPINRE 176

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             L+     E  G+ +     G+Y ++A K +     I       ++  +L P   
Sbjct: 177 NWLRRLRFMEPAGDRWWAMGGGVYFLQAVKRVVGMNIIQPQWSTPVARRLLSPAAK 232


>gi|33594119|ref|NP_881763.1| hypothetical protein BP3212 [Bordetella pertussis Tohama I]
 gi|33564193|emb|CAE43478.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332383535|gb|AEE68382.1| hypothetical protein BPTD_3172 [Bordetella pertussis CS]
          Length = 256

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE--RTLA 62
           IVEL +++ +  G+               D+ G     +G A P     +         A
Sbjct: 8   IVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGA 67

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            +P  + A  W           +   LP    SVD +++ H  E AE P L+L E+ RVL
Sbjct: 68  GVPPPELAQGWQA-----CVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVL 122

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSW-------YQMISLLREANFTLSITSRS 175
              GR+++   N   +W      P                 ++    +  +F +      
Sbjct: 123 VPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFG 182

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            + P       L+ W   E+ G  +      +YV+ A K +     I  + K     
Sbjct: 183 CYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKR 239


>gi|91775833|ref|YP_545589.1| methyltransferase type 11 [Methylobacillus flagellatus KT]
 gi|91709820|gb|ABE49748.1| Methyltransferase type 11 [Methylobacillus flagellatus KT]
          Length = 240

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 75/243 (30%), Gaps = 18/243 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I +  Q+  S LG+   +    +      D+ G   +  G              +  A
Sbjct: 1   MSIEKQEQWLESPLGQYLQEQEQALFDQVVHDIFGFNAMQFGMLKMPLLRHCRIPYQFNA 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                                 +   LP    S+D +L+ H L+F+E P   L E  RVL
Sbjct: 61  -------------DGGGGAIRCAPHQLPFQAESLDLLLLPHTLDFSEHPHQTLREAARVL 107

Query: 123 TSGGRMIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
              G + +   N    W                   S  ++   L   +F +     +  
Sbjct: 108 VPEGHIAITGFNPVSTWGARRLASDHEIYPWDANFLSLMRIKDWLTLLDFEVIEVRMACH 167

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            PP           + E++G  F P   G+Y + A+K +     I  +  K      L+P
Sbjct: 168 MPPFRNSSGQGKLRMIERLGARFWPLMGGVYFVLAKKRVIGMRLIKPAWNKSKLKAGLLP 227

Query: 238 HTV 240
              
Sbjct: 228 TPT 230


>gi|237748735|ref|ZP_04579215.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229380097|gb|EEO30188.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 266

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 98/236 (41%), Gaps = 9/236 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I  +  +  + +G+   +    +  T   D+ G   L +G++            R ++  
Sbjct: 10  IQIMHDWLMTPVGRYMLEWEENLFQTLSADIFGFNALQIGFSEINALKDSRIKNRWVSNQ 69

Query: 65  PAGQGAT-NWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
              +  + N  D     + +     LP A  S+D +++ H  EFAE+P ++L E+ RVL 
Sbjct: 70  FFPEPPSSNATDGAAKLSLIHDIDRLPFASESIDLIILPHAFEFAENPHMILREVDRVLI 129

Query: 124 SGGRMIVVVPNKRGMWARME--------HTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
             G++I+   N   +W   +        +      +     ++   L+  NF ++     
Sbjct: 130 PEGQVIISGFNPASLWGLRQSIGKLTGAYFLPSYAEFIGLPRLKDWLKLLNFEINRGHFG 189

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
            + PP   +  LK ++  EK GN + P   G+Y+I+A K ++    I  + +K   
Sbjct: 190 CYRPPCRTRHWLKRFAFMEKAGNRWWPFLGGVYLIQAIKRIHGVHLIDAAFRKRPR 245


>gi|260893457|ref|YP_003239554.1| Methyltransferase type 11 [Ammonifex degensii KC4]
 gi|260865598|gb|ACX52704.1| Methyltransferase type 11 [Ammonifex degensii KC4]
          Length = 225

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 80/216 (37%), Gaps = 6/216 (2%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAF 63
                 +Y++  G+   +   + L        G ++L  G      S             
Sbjct: 8   ATHYEDWYATPRGRLVWELEWRCLQKLLSLRPGEKVLDAGCGTGVVSRALAAAGAEVTGI 67

Query: 64  MPAGQGATNWPDQ---YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
             +        ++              +LP  D+S D V+    LEF  +P   L E+WR
Sbjct: 68  DISPAMLAVAREKGAGGNIVYLEGDMSSLPFPDASFDAVVCFTALEFVAEPERALEEMWR 127

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTP--FGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           VL  GGR++V V N R  WAR       F     YS  ++  LLR+ N         ++F
Sbjct: 128 VLKPGGRLLVGVLNHRSSWARRRKGKGVFAHAHFYSVRELEQLLRKLNPCRVKWQGVIYF 187

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           PP     +  L  +FE +G +F    A + +  A K
Sbjct: 188 PPELPSWLFSLVPLFEFLGRLFFKSSAAVLIFRADK 223


>gi|331000111|ref|ZP_08323805.1| methyltransferase domain protein [Parasutterella excrementihominis
           YIT 11859]
 gi|329572886|gb|EGG54509.1| methyltransferase domain protein [Parasutterella excrementihominis
           YIT 11859]
          Length = 246

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/243 (22%), Positives = 89/243 (36%), Gaps = 9/243 (3%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           + L +FYSS LG+               D  G   + LG         + ++   +A  P
Sbjct: 5   ITLEKFYSSSLGQYALRWEQNQYDKLVSDCFGYNAVQLGA-TGIDFLKNNRIGLKVAAEP 63

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
             +  T   +    +   +    +P    S+D V+M H LE +EDP  +L E++R+L  G
Sbjct: 64  TLRPLTQLLETDDRTPLQMLFEAMPFESESIDLVVMPHALEVSEDPHALLREVYRILIPG 123

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSG-------QPYSWYQMISLLREANFTLSITSRSLFF 178
           GR+I+   N   +W                  Q  S +Q+   L   +F +   +   + 
Sbjct: 124 GRVILTGFNLMSLWGLRFKMQRFGAKTFLPGKQFMSVFQIRDWLHLLSFHVDRGAFGCYG 183

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
                  I K  S  EK G+ + P    I+ I A K +     +  +  K        P 
Sbjct: 184 LTFSSAQI-KEDSWIEKAGDRWWPQCGAIFAISATKEVPGFKLVGRAVNKKFFFLGRRPA 242

Query: 239 TVS 241
             S
Sbjct: 243 PKS 245


>gi|317402507|gb|EFV83074.1| hypothetical protein HMPREF0005_02307 [Achromobacter xylosoxidans
           C54]
          Length = 259

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 78/235 (33%), Gaps = 9/235 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IVEL +++ +  G+               DV G     +G A       +    +     
Sbjct: 8   IVELAEWFQTPPGQYALAWERAQFDAAVADVFGYYAWQVGLADLNLLRANRMPFKGYVGT 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                       + S   L     LP    SVD +++ H  E   +P  +L E+ RVL  
Sbjct: 68  --ETPTAESVAGWQSRVVLAQPEALPFESQSVDLLILPHAFECTSEPHNVLREVERVLVP 125

Query: 125 GGRMIVVVPNKRGMWA---RMEHTPFGSGQPYSW----YQMISLLREANFTLSITSRSLF 177
            GR+++   N   MW    RM        QP S      ++    +  +  +  +    +
Sbjct: 126 EGRVVISGFNPWSMWGARTRMPGMEPWLPQPPSSQVSLPRLKDWFKLLSLEVEQSHFGCY 185

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            P    +  L+ W   E  G  +      +Y++ A K +     I  + K     
Sbjct: 186 APACRSEKWLQRWGFLESAGARWWSVGGAVYLVSAVKRVAGMRIIGPAWKTKPKR 240


>gi|326317358|ref|YP_004235030.1| type 11 methyltransferase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374194|gb|ADX46463.1| Methyltransferase type 11 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 279

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/266 (20%), Positives = 90/266 (33%), Gaps = 25/266 (9%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  +I+ L  ++ S  G+       +       DV G   L LG         +    R 
Sbjct: 1   MSDEIIGLHHWFDSPPGRYLLAWEQERYDEMVADVFGFHALQLGMPGLQGLRANRMPHRW 60

Query: 61  LAFM--------PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
           LA          P  +  T   D    +  L     LP  ++S+D VL+ H LE + DP 
Sbjct: 61  LALGAAEALLWPPPAETETGPADGAVRAALLADPVALPFPENSLDLVLLPHALELSVDPH 120

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ--------------PYSWYQM 158
             L E+ RVL   GR++V   N   +W   +       +                  +++
Sbjct: 121 AALREVHRVLMPEGRLVVSGLNPVSLWGLRQRRVRLYQRLGAGGQLYLPDVGEFIGHWRL 180

Query: 159 ISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ 218
              LR  NF +   S   + P       L  +   + +G  + P     Y++ A K ++ 
Sbjct: 181 RDWLRLLNFEIETISFGAYRPAVRSARWLDRYEWLDAVGARWWPILGAAYMVVAVKRVHG 240

Query: 219 GLPITESKK---KHISSPILVPHTVS 241
              +  S +      +    VP    
Sbjct: 241 MRLLEPSWRTGQAPQARAATVPVAQR 266


>gi|88857809|ref|ZP_01132451.1| hypothetical protein PTD2_10504 [Pseudoalteromonas tunicata D2]
 gi|88819426|gb|EAR29239.1| hypothetical protein PTD2_10504 [Pseudoalteromonas tunicata D2]
          Length = 256

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 80/241 (33%), Gaps = 18/241 (7%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G      I + L+     V G  LL LG            ++  +   P   
Sbjct: 14  ENWQQFPHGDYIQAEIEQKLAPWLSRVFGYHLLKLGNLSGLTDTSKCCIKHQVCVAPNSP 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
            A            +     LP  + SVD  L+ H LE+  DP  +L E  R L  GG +
Sbjct: 74  MA----------GVIAEVDELPFYEHSVDACLLSHCLEYYSDPHHILREAHRTLIPGGYI 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +                SG+ ++  ++   L    F +    R +F     
Sbjct: 124 LITGFNPLSLCGLARLLPFSRQKLPWSGRFFTPARVKDWLHLLGFEVLEDERFIFSS-LA 182

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
           +   L  + +++     +      +Y+I ARK +    PI      +   SP +    + 
Sbjct: 183 RGSRLSRFELWQNFCRQYLKPMGSVYLIVARKRVTPLTPIKPKWHARPQFSPAVKGAGLR 242

Query: 242 T 242
           +
Sbjct: 243 S 243


>gi|313201261|ref|YP_004039919.1| type 11 methyltransferase [Methylovorus sp. MP688]
 gi|312440577|gb|ADQ84683.1| methyltransferase type 11 [Methylovorus sp. MP688]
          Length = 239

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 78/243 (32%), Gaps = 18/243 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I + + + +  +G    +    +      DV G   L +G                  
Sbjct: 1   MSIDDQQSWLAKPIGAYLLEREQCLFDQAVADVFGFNALQIGLPQANLLQQCRMPFMFHT 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                               L     LP + +++D +LM H L+F+EDP   L E  RVL
Sbjct: 61  -------------DQEHGEVLSDSTQLPFSANTIDLLLMPHTLDFSEDPHQTLREAERVL 107

Query: 123 TSGGRMIVVVPNKRGMWARMEHT-----PFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            + G +++   N    W               G      ++   L    F +  T  + +
Sbjct: 108 VAEGHLMISGFNPLSSWGVKRMLGKRQGYPWHGNFLPLLRIKDWLALLGFEIISTGMTCY 167

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            PP      L+     ++ G  + P   G+Y + ARK +     I  +       P LV 
Sbjct: 168 APPWVSARWLERSRFLDQAGGRWWPMRGGVYFVVARKRVLGMRVIRPNWNAARIKPRLVA 227

Query: 238 HTV 240
              
Sbjct: 228 SPS 230


>gi|325983347|ref|YP_004295749.1| Methyltransferase type 11 [Nitrosomonas sp. AL212]
 gi|325532866|gb|ADZ27587.1| Methyltransferase type 11 [Nitrosomonas sp. AL212]
          Length = 256

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 88/229 (38%), Gaps = 18/229 (7%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
              ++Q++ S LG+   +   +       ++ G   + +G+    F   +    R     
Sbjct: 4   AQNVQQWFESSLGQYLIEHEHRYFDQVVANIFGYNAVQIGWPQFDFLRLNRMPLRFSVGC 63

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                          ++     G LP+  SS+D V++ H LEF  +P  +L E+ R+L  
Sbjct: 64  ------------ECETSVRAEAGFLPIQTSSMDLVILPHALEFNANPHQILREVHRILIP 111

Query: 125 GGRMIVVVPNKRGMWARMEH------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G ++V   N   +W    H          +G   +  ++   L+  +F ++      + 
Sbjct: 112 EGHLVVSGFNPFSLWGVCPHLKSMREEFPWNGDFIALSRLKDWLKLLDFEMAGGRLCCYV 171

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
           PP  ++   + ++  E  G+ + P   G+Y + A K  +    I    +
Sbjct: 172 PPLKQEKWRRRFAFMEAAGDRWWPISGGVYFLHAIKHTHGMRIIKPDWR 220


>gi|218661951|ref|ZP_03517881.1| putative methyltransferase protein [Rhizobium etli IE4771]
          Length = 181

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 107/180 (59%), Positives = 128/180 (71%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  DIV+LRQFY S LG+    +I+  LS+ W  +   RL+GLGYA+PF   F    ERT
Sbjct: 1   MHADIVDLRQFYHSDLGRFAEQSIAMALSSLWVRLPQERLVGLGYAVPFLDRFQADTERT 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            AFMPAGQGA NWP    SST L+ +  LPL DSS+D VLMVH LEFAE P   L E+WR
Sbjct: 61  FAFMPAGQGAVNWPMGSLSSTTLIFDEELPLPDSSIDRVLMVHSLEFAESPRETLKELWR 120

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VL  GGR+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP
Sbjct: 121 VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPP 180


>gi|253999159|ref|YP_003051222.1| type 11 methyltransferase [Methylovorus sp. SIP3-4]
 gi|253985838|gb|ACT50695.1| methyltransferase type 11 [Methylovorus sp. SIP3-4]
          Length = 239

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 78/243 (32%), Gaps = 18/243 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I + + + +  +G    +    +      DV G   L +G                  
Sbjct: 1   MSIDDQQSWLAKPIGAYLLEREQCLFDQAVADVFGFNALQIGLPQANLLQQCRMPFMFHT 60

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                               L     LP + +++D +LM H L+F+EDP   L E  RVL
Sbjct: 61  -------------DQERGEVLSDSTQLPFSANTIDLLLMPHTLDFSEDPHQTLREAERVL 107

Query: 123 TSGGRMIVVVPNKRGMWARMEHT-----PFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            + G +++   N    W               G      ++   L    F +  T  + +
Sbjct: 108 VAEGHLMISGFNPLSSWGVKRMLGKRQGYPWHGNFLPLLRIKDWLALLGFEIISTGMTCY 167

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVP 237
            PP      L+     ++ G  + P   G+Y + ARK +     I  +       P LV 
Sbjct: 168 APPWVSARWLERSRFLDQAGGRWWPMRGGVYFVVARKRVLGMRVIRPNWNAARIKPRLVA 227

Query: 238 HTV 240
              
Sbjct: 228 SPS 230


>gi|303256781|ref|ZP_07342795.1| methyltransferase type 11 [Burkholderiales bacterium 1_1_47]
 gi|302860272|gb|EFL83349.1| methyltransferase type 11 [Burkholderiales bacterium 1_1_47]
          Length = 261

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 54/243 (22%), Positives = 89/243 (36%), Gaps = 9/243 (3%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           + L +FYSS LG+               D  G   + LG         + ++   +A  P
Sbjct: 20  ITLEKFYSSSLGQYALRWEQNQYDKLVSDCFGYNAVQLGA-TGIDFLKNNRIGLKVAAEP 78

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
             +  T   +    +   +    +P    S+D V+M H LE +EDP  +L E++R+L  G
Sbjct: 79  TLRPLTQLLETDDRTPLQMLFEAMPFESESIDLVVMPHALEVSEDPHALLREVYRILIPG 138

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSG-------QPYSWYQMISLLREANFTLSITSRSLFF 178
           GR+I+   N   +W                  Q  S +Q+   L   +F +   +   + 
Sbjct: 139 GRVILTGFNLMSLWGLRFKMQRFGAKTFLPGKQFMSVFQIRDWLHLLSFHVDRGAFGCYG 198

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
                  I K  S  EK G+ + P    I+ I A K +     +  +  K        P 
Sbjct: 199 LTFSSAQI-KEDSWIEKAGDRWWPQCGAIFAISATKEVPGFKLVGRAVNKKFFFLGRRPA 257

Query: 239 TVS 241
             S
Sbjct: 258 PKS 260


>gi|145589206|ref|YP_001155803.1| methyltransferase type 11 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047612|gb|ABP34239.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 272

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 85/232 (36%), Gaps = 10/232 (4%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            ++  S  G+               DV G   + +G   P  +          A +    
Sbjct: 20  EKWLQSPPGRYVLGWEKNCFDQIVADVFGFHAVQIGL--PQINALEENRMPLQALIVHSH 77

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
            +  +  ++           LP A+ ++D +++ H LEFA DP  +L E+ RVL   GR+
Sbjct: 78  DSREYAARFNWHVIEGDSAELPFANETIDLIVLPHVLEFAADPHQILREVDRVLRPEGRL 137

Query: 129 IVVVPNKRGMWARMEH--------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           ++   N   +W   ++             GQ  S  ++   L+  N++L       +  P
Sbjct: 138 VISGFNPASLWGARQYLSRLIGSPYLPRDGQFISLIRVKDWLQLLNYSLDRGHFGCYKFP 197

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                 +      EK+GN + P F  ++++ A K       I  ++     +
Sbjct: 198 LQGHSAMGRMDFLEKMGNRWWPIFGAVFLVSAIKRHQGMRLIGPAQSIRAPA 249


>gi|222111166|ref|YP_002553430.1| type 11 methyltransferase [Acidovorax ebreus TPSY]
 gi|221730610|gb|ACM33430.1| Methyltransferase type 11 [Acidovorax ebreus TPSY]
          Length = 252

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 15/234 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             ++ +  G+       +       D+ G   L LG         +    R LA MP  +
Sbjct: 2   HHWFDTAPGRYLLAWEQERYDELVADIFGYHALQLGMPGLQALRSNRMPHRWLAVMP-PE 60

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                 D       L     LP A++S+D + + H LE + DP   L E+ RVL   G++
Sbjct: 61  LLLERSDAQEPPALLADAVALPFAEASLDLLALPHTLELSVDPHTALREVHRVLVPEGKV 120

Query: 129 IVVVPNKRGMWARMEHTPFGSGQ--------------PYSWYQMISLLREANFTLSITSR 174
           ++   N   +W   +       +                S  ++   LR   F L   S 
Sbjct: 121 VISGLNPLSLWGLRQRRSRLYQRCGAGGRLFLPDVGEFISPGRLRDWLRLLGFELESMSF 180

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
             + P       L+ +   + +G  + P F   YVI A K +     +  S +K
Sbjct: 181 GCYRPAVAGDRWLQRYGWMDALGARWWPIFGAAYVIVAVKRVQGMRLLEPSWRK 234


>gi|254480609|ref|ZP_05093856.1| Methyltransferase domain family protein [marine gamma
           proteobacterium HTCC2148]
 gi|214039192|gb|EEB79852.1| Methyltransferase domain family protein [marine gamma
           proteobacterium HTCC2148]
          Length = 271

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 46/251 (18%), Positives = 92/251 (36%), Gaps = 24/251 (9%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            EL  +Y S  G+     I + L    D+  G  +L +G           ++   +    
Sbjct: 10  AELETWYDSDRGQYLLQQIKQALQPQLDNAFGYHILQIGPLSGDPLFGACRINHRIMACD 69

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           +             +  +   G +PL   SVD V+  H LEF ++P  +L E+ R+LT  
Sbjct: 70  S---------GGEGTNLICQAGEIPLESDSVDVVIAHHTLEFVDNPHQVLRELHRILTPQ 120

Query: 126 GRMIVVVPNKRG-------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           G+++++  N          +    + + + + +P S  ++   L    F L   +     
Sbjct: 121 GQLLILGFNPHSLRGLVTRIKGLSKRSFWQAHRPVSISRLSDWLHLLGFELREGNHLYVV 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ-GLPITESKKK-------HI 230
           PPT +       +  +K          G+Y+  A K +     P++  ++         +
Sbjct: 181 PPTGQARFRAATASLDKWCVDHKLPLGGLYMQAAIKQVAAQNRPLSMLRRHGEKLIDLAV 240

Query: 231 SSPILVPHTVS 241
             P++ P    
Sbjct: 241 PKPVVAPSPAP 251


>gi|294340666|emb|CAZ89058.1| Conserved hypothetical protein, putative
           S-adenosyl-L-methionine-dependent methyltransferase
           [Thiomonas sp. 3As]
          Length = 296

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/292 (16%), Positives = 86/292 (29%), Gaps = 58/292 (19%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM--- 64
           L+ +  +  G+         +     D+ G   L LG         +    R LA     
Sbjct: 3   LQHWLQTPPGRYALAWEQSQIDRVVTDIFGYHALQLGNPALQGLAHNRMPHRWLALDGAE 62

Query: 65  ---PAGQGATNW---------------------------------------PDQYFSSTA 82
              P   G                                                +   
Sbjct: 63  SAQPDLPGVRPACLLPEHYGGEPVYAEPGLVDAVGVAAENAQLPPEPQPADAHAIHTEHL 122

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
                 LP    S+D V++ H LE+ +DP   L E+ RVL  GG++++   N   +W   
Sbjct: 123 QCDFTALPFPAQSLDLVVLPHTLEWVDDPHACLREVDRVLVPGGQIVISGFNTWSLWGMR 182

Query: 143 E--------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
           +              G+  +  ++   LR  +F ++      + P       L  W   +
Sbjct: 183 QLVGRVGGGWYLPQHGEFLAPRRVRDWLRLLSFEVTQGRFGCYRPALCSPLWLHRWRFMD 242

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPI-----TESKKKHISSPILVPHTVS 241
           + G+ + P F  +Y + A K +     +        ++     PI    T +
Sbjct: 243 QAGDRWWPVFGAVYFLAAIKRVAAMRLVGKVEMRTQRRAVALRPIAQRQTKT 294


>gi|121604584|ref|YP_981913.1| type 11 methyltransferase [Polaromonas naphthalenivorans CJ2]
 gi|120593553|gb|ABM36992.1| Methyltransferase type 11 [Polaromonas naphthalenivorans CJ2]
          Length = 273

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/250 (16%), Positives = 76/250 (30%), Gaps = 26/250 (10%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  +I+ L  +  +  G                D+ G   L LG         +    + 
Sbjct: 1   MNSEIIGLTDWLKTPPGAYLLAWERAHFDEAVSDIFGYHALQLGLPELDALQANRMPHKW 60

Query: 61  LAFMPAG-------------QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEF 107
           LA                                 L     LP  ++S+D V++ H LE 
Sbjct: 61  LALSSMPGLPLQSSLQGNPLHRMEPAAISSPQVALLTDSAALPFPENSLDLVVLPHTLEL 120

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ-------------PYS 154
             DP   L E+ RVL   GR+++   N   +W   +       +                
Sbjct: 121 GRDPHSALREVARVLVPEGRVVISGFNPASLWGLRQRRDHFYQRLGYDEFFLPNAGDYIG 180

Query: 155 WYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           ++++   LR  +F +       + P    +  L  +   +  G  + P F  +Y + A K
Sbjct: 181 YWRLRDWLRLLDFEVESARFGCYRPAFDSQKWLDRFDWMDAAGERWWPIFGAVYFLVAVK 240

Query: 215 ILYQGLPITE 224
            +     +  
Sbjct: 241 HVRGMRLLEP 250


>gi|288940136|ref|YP_003442376.1| type 11 methyltransferase [Allochromatium vinosum DSM 180]
 gi|288895508|gb|ADC61344.1| Methyltransferase type 11 [Allochromatium vinosum DSM 180]
          Length = 255

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 95/244 (38%), Gaps = 14/244 (5%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L+ +Y S LG    +     +     +  G  L+ +G +  F         R    +P  
Sbjct: 14  LQAWYRSALGAEVANHEGDCVRRLLANTFGYYLVQVGASERFGEALTASRIRHRVLLPGT 73

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                        + +     LPLA  S+D VL+ H LE+++ P  +L E+ RVL   GR
Sbjct: 74  PPTGA----VQGLSIVGEPDALPLASDSIDAVLLPHVLEYSDRPRAILAEVERVLIPEGR 129

Query: 128 MIVVVPNKRGMWARMEHTPF------GSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           +I++  +   +WA              +G+     Q+   L E  F + +  R+LF PP 
Sbjct: 130 LILLGFDPLSLWALGRLWWPACRRAPWNGRWRLAVQVEHWLNELGFEIEVCERALFCPPI 189

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH---ISSPILVPH 238
                 +     E +G  F P F G+YVI A K +    P+   +      +    + P 
Sbjct: 190 VSPAGARCA-TIESLGRRFWPLFGGLYVIRAVKRVATLTPLKPYRTSRHALLPGGAVRPT 248

Query: 239 TVST 242
           T  T
Sbjct: 249 TRGT 252


>gi|329849722|ref|ZP_08264568.1| methyltransferase domain protein [Asticcacaulis biprosthecum C19]
 gi|328841633|gb|EGF91203.1| methyltransferase domain protein [Asticcacaulis biprosthecum C19]
          Length = 246

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 75/212 (35%), Positives = 103/212 (48%), Gaps = 3/212 (1%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR  + EL +FY++  G      ++  L   W DV G  +LG+GY  P+      +  R 
Sbjct: 1   MRRSVEELNRFYAAPEGVVARRLVTAKLCEAWPDVRGLDVLGIGYCTPYLDR-FVEARRV 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           L  MPA QGA  WP        LV E  LP   +  D +LMVH LE +  P  +L E  R
Sbjct: 60  LQAMPAAQGAEIWPADLKVRATLVEEEALPFPTALFDRILMVHALEESPTPHGLLCEASR 119

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L+  GR+I+ V  + G WA  E TPFG GQPYS  Q+ + LR+A       S +L+ PP
Sbjct: 120 LLSPAGRLIIGVAARGGFWAHAEKTPFGYGQPYSRMQLENALRDAELEPLAWSYALYTPP 179

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEA 212
                 L      + I     P   G+ ++EA
Sbjct: 180 MA--PFLGWAGPLDNILPRIWPLKGGLILMEA 209


>gi|114332142|ref|YP_748364.1| generic methyl-transferase [Nitrosomonas eutropha C91]
 gi|114309156|gb|ABI60399.1| generic methyl-transferase [Nitrosomonas eutropha C91]
          Length = 235

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 83/239 (34%), Gaps = 21/239 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           +Q+  + LG+   +   +       D+ G     +G+A   F   +    + +  +    
Sbjct: 2   QQWLETALGQYVLEQEQRYFDRVVADIFGYNAAQIGFAGFDFLRNNRMPFKFVLGV---- 57

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++A      LP+  +S+D VL+ H LEF   P  + HE+ RVL   GR+
Sbjct: 58  --------EKGASASAHPAFLPIRSNSLDLVLLPHTLEFNSYPLQIFHEVQRVLIDEGRV 109

Query: 129 IVVVPNKRGMWARMEHT------PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +W                G+     ++   L   +F +       + PP  
Sbjct: 110 IISGFNPFSLWGIRWRMTKSGMDFPWRGRFIDLSRVKDWLELLDFEIVAGQFGCYVPPFT 169

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK---KKHISSPILVPH 238
            +  L      E  G+ + P   G+Y ++A K       I               +VP 
Sbjct: 170 GEKWLSRLRFMEAAGDRWWPVAGGVYFLQAVKHECGMHIIKPRWENPSVSKRRAAVVPQ 228


>gi|217970691|ref|YP_002355925.1| hypothetical protein Tmz1t_2290 [Thauera sp. MZ1T]
 gi|217508018|gb|ACK55029.1| conserved hypothetical protein [Thauera sp. MZ1T]
          Length = 241

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/246 (19%), Positives = 85/246 (34%), Gaps = 20/246 (8%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + I+ L ++  +  G+   D     L     D+ G   + LG +                
Sbjct: 1   MSILRLEEWLQTPQGRYLLDWEQDGLDRLVADIFGYHAVQLGLSGFDLLR---------- 50

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
              A +                SE  LP A  S+D VL+ H LEF+  P  +L E+ RVL
Sbjct: 51  ---ANRMPRRIDCGPQGRDLRCSEYELPFATGSLDLVLLPHVLEFSAHPHRVLREVERVL 107

Query: 123 TSGGRMIVVVPNKRGMWARMEHTP------FGSGQPYSWYQMISLLREANFTLSITSRSL 176
              G +++   N   +W               SG   S  ++   L    F +  +    
Sbjct: 108 VPEGSVVISGFNPLSLWGLRRLMARRGAEAPWSGHYRSAMRIRDWLNLLGFEIQESRFGC 167

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPIL 235
           + PP      L+ W   ++ G+ + P     Y++   K +     IT   + +  ++  L
Sbjct: 168 YAPPLRTPQWLERWGCLDRAGSRWWPVLGAGYLLHGVKRVQGMRLITPHWRGRKAAAKRL 227

Query: 236 VPHTVS 241
            P    
Sbjct: 228 SPVAQR 233


>gi|264677771|ref|YP_003277677.1| methyltransferase type 11 [Comamonas testosteroni CNB-2]
 gi|262208283|gb|ACY32381.1| Methyltransferase type 11 [Comamonas testosteroni CNB-2]
          Length = 277

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 51/263 (19%), Positives = 85/263 (32%), Gaps = 30/263 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM---- 64
             +  S LG    +   +       D+ G   L LG         +    R LA      
Sbjct: 2   HHWTDSALGHYLLEWEQQRFDEAVADIFGYHALQLGLPQLQGLRGNRMPHRWLALEGLDP 61

Query: 65  -------------------PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYL 105
                              P                   +   LP A++S+D +LM H L
Sbjct: 62  VPDAKAGTVAQAKATAVSPPLPPADEAQNFAPLMPALRTAPEALPFAEASLDLLLMPHTL 121

Query: 106 EFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYS------WYQMI 159
           E   DP   L E  RVL   GR+++   N   +          +G          ++++ 
Sbjct: 122 EACNDPHAALREAARVLVPEGRLVISGLNPSSLLGLQRRVERSAGYLPDLSLGVGYWRLR 181

Query: 160 SLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG 219
             LR  +F +       + P T  +  L  W   E +G+   P   G+Y + A K +   
Sbjct: 182 DWLRLLSFEIEAVQFGCYRPATQSEKWLSRWQFMEGLGHRCWPVMGGVYCVVAVKRVQGM 241

Query: 220 LPITESKKK-HISSPILVPHTVS 241
             ++ S +K  + + +  P T  
Sbjct: 242 RLMSPSWRKSSVPAGMKAPVTQR 264


>gi|254491115|ref|ZP_05104296.1| hypothetical protein MDMS009_1447 [Methylophaga thiooxidans DMS010]
 gi|224463628|gb|EEF79896.1| hypothetical protein MDMS009_1447 [Methylophaga thiooxydans DMS010]
          Length = 243

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 50/237 (21%), Positives = 88/237 (37%), Gaps = 21/237 (8%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           ++  ++ S LG+       + ++     + G   + +G                    P 
Sbjct: 8   QISDWWQSPLGELVLALEQEKIAGLTSPILGSFTIQIGGGAR--------------LQPL 53

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                N                LP    S+D +L++H LE+A+DP  +L E  RVL + G
Sbjct: 54  SNRIENQSWLGAEGDITALPEALPFRSHSIDNLLLLHVLEYADDPHQVLRETERVLAADG 113

Query: 127 RMIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           ++I+   N   +W               G  ++  ++   L   NF ++   + LF PP 
Sbjct: 114 KVILCCFNPISLWGLRRLFSWQDAAPWHGYFFTKTRLKDWLALLNFEVTEQHKILFRPPF 173

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILV 236
                L+     E+ G    P F  + V+ A K      P+ E+K+  +   SP LV
Sbjct: 174 KHPRWLEGSHFLERWGKRLWPWFGAVSVMVATKRTIPLTPLRENKRQHRLFPSPGLV 230


>gi|296136538|ref|YP_003643780.1| Methyltransferase type 11 [Thiomonas intermedia K12]
 gi|295796660|gb|ADG31450.1| Methyltransferase type 11 [Thiomonas intermedia K12]
          Length = 296

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 85/292 (29%), Gaps = 58/292 (19%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM--- 64
           L+ +  +  G+         +     D+ G   L LG         +    R LA     
Sbjct: 3   LQHWLQTPPGRYALAWEQSQIDRVVTDIFGYHALQLGNPALQGLAHNRMPHRWLALDGAE 62

Query: 65  ---PAGQGATNW---------------------------------------PDQYFSSTA 82
              P   G                                                +   
Sbjct: 63  SAQPNLPGVRPACLLPEHYGGEPVYAEPGLVDAVGLAAENAQLPPEPQPADAHAIHTEHL 122

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
                 LP    S+D V++ H LE+ +DP   L E+ RVL  GG++++   N   +W   
Sbjct: 123 QCDFTALPFPAQSLDLVVLPHTLEWVDDPHACLREVDRVLVPGGQIVISGFNTWSLWGMR 182

Query: 143 E--------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
           +              G+  +  ++   LR  +F ++      + P       L  W   +
Sbjct: 183 QLVGRVGGGWYLPQHGEFLAPRRVRDWLRLLSFEVTQGRFGCYRPALCSPLWLHRWRFMD 242

Query: 195 KIGNIFGPGFAGIYVIEARKILYQGLPI-----TESKKKHISSPILVPHTVS 241
           + G+ + P F  +Y + A K +     +        ++     PI      +
Sbjct: 243 QAGDRWWPVFGAVYFLAAIKRVPAMRLVGKVEMRTQRRAVALRPIAQRRAKT 294


>gi|299531592|ref|ZP_07044997.1| Methyltransferase type 11 [Comamonas testosteroni S44]
 gi|298720308|gb|EFI61260.1| Methyltransferase type 11 [Comamonas testosteroni S44]
          Length = 277

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 51/263 (19%), Positives = 86/263 (32%), Gaps = 30/263 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM---- 64
             +  S LG    +   +       D+ G   L LG         +    R LA      
Sbjct: 2   HHWTDSALGHYLLEWEQQRFDEAVADIFGYHALQLGLPQLQGLRGNRMPHRWLALEGLDP 61

Query: 65  -------------------PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYL 105
                              P                   +   LP A++S+D +LM H L
Sbjct: 62  VPDAKAGTVAQAKATAVSPPLPSVDEAQNFAPLMPALRTAPEALPFAEASLDLLLMPHTL 121

Query: 106 EFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYS------WYQMI 159
           E + DP   L E  RVL   GR+++   N   +          +G          ++++ 
Sbjct: 122 EASNDPHAALREAARVLVPEGRLVISGLNPSSLLGLQRRVERSAGYLPDLSLGVGYWRLR 181

Query: 160 SLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG 219
             LR  +F +       + P T  +  L  W   E +G+   P   G+Y + A K +   
Sbjct: 182 DWLRLLSFEIEAVQFGCYRPATQSEKWLSRWQFMEGLGHRCWPVMGGVYCVVAVKRVQGM 241

Query: 220 LPITESKKK-HISSPILVPHTVS 241
             ++ S +K  + + +  P T  
Sbjct: 242 RLMSPSWRKSSVPAGMKAPVTQR 264


>gi|319762432|ref|YP_004126369.1| methyltransferase type 11 [Alicycliphilus denitrificans BC]
 gi|330825717|ref|YP_004389020.1| type 11 methyltransferase [Alicycliphilus denitrificans K601]
 gi|317116993|gb|ADU99481.1| Methyltransferase type 11 [Alicycliphilus denitrificans BC]
 gi|329311089|gb|AEB85504.1| Methyltransferase type 11 [Alicycliphilus denitrificans K601]
          Length = 260

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 85/248 (34%), Gaps = 17/248 (6%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  +I+ L  ++ S  G+       +       D+ G   L LG         +    R 
Sbjct: 1   MSGEIIGLHHWFGSPPGRYLLAWEQERYDELVADIFGYHALQLGMPGLQGLRANRMPHRW 60

Query: 61  LAFMPAGQGA---TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
           LA              P +  +   L     LP A+ S+D V M H LE + DP   L E
Sbjct: 61  LALGGEEARLLPREASPAEAPAVALLAEAVALPFAEGSLDLVAMPHTLELSVDPHAALRE 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ--------------PYSWYQMISLLR 163
           ++RVL   GR ++   N   +W   +       +                +  ++   LR
Sbjct: 121 VYRVLVPEGRAVISGLNPLSLWGLRQWRARLYQRCGGGGQLYLPDVGEFITPGRLRDWLR 180

Query: 164 EANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT 223
              F L   S   + P    +  L+ +   + +G  + P     YVI A K +     + 
Sbjct: 181 LLGFELESISFGCYRPAAASERWLEHYGWMDGLGARWWPILGAAYVIVAAKRVQGMRLLE 240

Query: 224 ESKKKHIS 231
            S +K   
Sbjct: 241 PSWRKAPK 248


>gi|332526658|ref|ZP_08402763.1| hypothetical protein RBXJA2T_12247 [Rubrivivax benzoatilyticus JA2]
 gi|332110919|gb|EGJ11096.1| hypothetical protein RBXJA2T_12247 [Rubrivivax benzoatilyticus JA2]
          Length = 267

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/255 (17%), Positives = 80/255 (31%), Gaps = 25/255 (9%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA-------- 62
           +  S  G+   +     L     D  G   L LG         +    R +A        
Sbjct: 4   WLQSPAGRYLLEWEQDRLDRAVTDAFGFHALQLGLPEIQGLRANRMPHRWVACGSLVTPE 63

Query: 63  -FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                         Q            LP    SVD V++ H LE A DP  +L E+ R+
Sbjct: 64  PIELPPPRDALITTQPAPVALYCEFDALPFPQHSVDLVVLPHALELAADPHQLLREVERI 123

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTP----------------FGSGQPYSWYQMISLLREA 165
           L   GR+++   N   +WA  + +                   +G+   ++++   LR  
Sbjct: 124 LVPEGRLVISGLNPASLWALRQRSGHAWRGIGLGRGQPTYLPRAGEFIGYWRLRDWLRLL 183

Query: 166 NFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
            F +       + PP   +  L+ +   + +G+ + P     Y + A K +     +   
Sbjct: 184 GFHIESGRFGCYRPPLSSERWLQRFEWMDPVGDRWWPVLGAAYFLVAVKRVRGMRLVGLL 243

Query: 226 KKKHISSPILVPHTV 240
           K +            
Sbjct: 244 KNERRRVKAATAAVA 258


>gi|300112988|ref|YP_003759563.1| methyltransferase type 11 [Nitrosococcus watsonii C-113]
 gi|299538925|gb|ADJ27242.1| Methyltransferase type 11 [Nitrosococcus watsonii C-113]
          Length = 256

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/234 (22%), Positives = 89/234 (38%), Gaps = 13/234 (5%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +    LG+         L     D+ G  L+ LG                   + A    
Sbjct: 18  WLGESLGRHLLKIEQAELEKVLPDLFGYHLVQLGSVRRGMDLLSSSCIWHRVVLEAE--- 74

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                +  + + L     LP A ++VD +++ H LE+ E+P  +L E+ RVL   G + +
Sbjct: 75  --IWPEAQAPSLLSHVDALPFASATVDGIILPHVLEYEENPHQVLREVQRVLVPYGTLAI 132

Query: 131 VVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +  N    W           +    G+ YS  ++   L    F        LF PP  + 
Sbjct: 133 LGFNPWSFWGFWRFILYRRGSMPWCGRFYSPTRIQDWLALLGFKTVELRYFLFRPPLRQP 192

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK--KKHISSPILV 236
            +++     E IG  + P FAG Y++ A+K + +  PI      K+ +  P+L 
Sbjct: 193 RLMRRLRFLELIGRRWCPFFAGGYLVVAKKQVVRLNPIDSLWCEKESLDMPVLA 246


>gi|226939808|ref|YP_002794881.1| Generic methyl-transferase [Laribacter hongkongensis HLHK9]
 gi|226714734|gb|ACO73872.1| Generic methyl-transferase [Laribacter hongkongensis HLHK9]
          Length = 255

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 81/236 (34%), Gaps = 17/236 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L Q+ +S LG+               D  G R + LG+        +    + L      
Sbjct: 16  LSQWLASPLGRYVLAREQAFYDKAVADCFGYRAVQLGWTGVPLMRCNRIPWQCLVG---- 71

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                   Q   +        LP A  S+D +LM H L+F+  P   L E  RVL   GR
Sbjct: 72  --------QTGLAGVQALPYQLPFATRSLDLLLMPHTLDFSAHPRETLREAERVLAPEGR 123

Query: 128 MIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +++   N   ++             +    S  ++   L   +F L+  +   + PPT  
Sbjct: 124 LVLTGFNPVSLFGLRRVWSRQQAPWNAHFLSLRRLKDWLELLDFDLASGAFLCYAPPTGS 183

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           +     +   E  G+ + P  +G+Y + A K +     I           I VP  
Sbjct: 184 EEWRSRFRFMESAGDRWWPAASGVYALHAIKRVRGMRLIRPGWSLRRPI-IAVPQP 238


>gi|332535811|ref|ZP_08411544.1| SAM-dependent methyltransferase in cluster with
           hydroxyacylglutathione hydrolase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332034789|gb|EGI71327.1| SAM-dependent methyltransferase in cluster with
           hydroxyacylglutathione hydrolase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 261

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 77/232 (33%), Gaps = 18/232 (7%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G      I + +      + G  +L LG      +     ++  +        
Sbjct: 15  SWQQFPHGDYLRTDIERKMEQWLPRMFGYHMLKLGNLSGELNTSISTIKHQVCV------ 68

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                +    +  +     LP  + S+D  ++ H LE+  DP  +L E  R L  GG ++
Sbjct: 69  ----AEPGPYTGVVADIDELPFYEHSIDACILSHCLEYHSDPHHILREAHRTLIPGGYIL 124

Query: 130 VVVPNKRGMWARMEHTP------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           V   N   +    +  P        +G+ ++  ++   L    F +    R ++      
Sbjct: 125 VTGFNPFSLCGLAQMLPFSGQKLPWTGRFFTPARVKDWLNLLGFEIVSDERFIYSSLARG 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPI 234
             + +    +      +      +Y++ ARK +    PI      +   +P+
Sbjct: 185 NRLSRF-EFWRTFAKQYLKPMGSVYMLVARKRVAPLTPIKPKWHARPQFAPV 235


>gi|309782458|ref|ZP_07677182.1| methyltransferase type 11 [Ralstonia sp. 5_7_47FAA]
 gi|308918795|gb|EFP64468.1| methyltransferase type 11 [Ralstonia sp. 5_7_47FAA]
          Length = 265

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 84/241 (34%), Gaps = 33/241 (13%)

Query: 33  DDVTGCRLLGLGY-AIPFFSCFH----------------GKVERTLAFMPAGQGATNW-- 73
            D+ G   L LG+                           +    +   PA         
Sbjct: 2   ADMFGYHALQLGHPGFGALRENRIPLIARVVDDIDPTAPTETLDPMDGDPAESADAADGE 61

Query: 74  -----PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+
Sbjct: 62  PDTSTPPRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRL 121

Query: 129 IVVVPNKRGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           I+   N   +W           E       Q  ++ ++   L+   F +       + PP
Sbjct: 122 IITGFNPLSLWGMRQGMRRLGTESFLPAQSQMIAFTRLKDWLKLLGFDIVRGRFGCYCPP 181

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                 L+  +  EK G+ + P F  +Y+++A K +     +  + K    SP LVP   
Sbjct: 182 NRSDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRVRAMRLVGPAWKTR-KSPSLVPAGT 240

Query: 241 S 241
            
Sbjct: 241 P 241


>gi|124267714|ref|YP_001021718.1| hypothetical protein Mpe_A2528 [Methylibium petroleiphilum PM1]
 gi|124260489|gb|ABM95483.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 281

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 88/257 (34%), Gaps = 22/257 (8%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
           ++L  +  +  G+         + T   DV G   L LG         +    R LA   
Sbjct: 7   IDLPLWLQTPPGRYVLAWEQARIETHVADVFGFHALQLGLPEIDALQANRMPHRWLALSA 66

Query: 66  AGQGATNWPDQ----YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
               A   P+       +         LP A  S+D V++ H LE A DP   L E+ RV
Sbjct: 67  REGAAATVPEDGGAAPRTVALSCDFDALPFASQSLDLVVLPHTLELARDPHHTLREVERV 126

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLL-----------------RE 164
           L   G++++   N   +W   +     + +         L                  R 
Sbjct: 127 LVPEGQVVITGLNPTSLWGLRQAGGRAAQRLGRRSDDERLFLPRAGDFIAYRRLRDWLRL 186

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE 224
            +F +       + P    +  L  ++  E+ G  + P F  +Y+++A K +     I  
Sbjct: 187 LSFEVESGGFGCYRPALRSQAWLDRYAWMERAGERWWPVFGAVYLLKAVKRVRGMRLIGP 246

Query: 225 SKKKHISSPILVPHTVS 241
           + KK    P   P  VS
Sbjct: 247 AWKKT-PKPRAAPAVVS 262


>gi|171058654|ref|YP_001791003.1| hypothetical protein Lcho_1971 [Leptothrix cholodnii SP-6]
 gi|170776099|gb|ACB34238.1| conserved hypothetical protein [Leptothrix cholodnii SP-6]
          Length = 273

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/262 (19%), Positives = 93/262 (35%), Gaps = 26/262 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+ + ++ ++  G+         L     ++ G   + LG+        +    R L   
Sbjct: 7   IIGIDEWLTTPPGRYLVAWEQAQLDRLVSNIFGYHAVQLGWPAVQGLRCNRMRHRWLVND 66

Query: 65  -----------PAG-QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
                      PA   GA  WP      + +     LP   +S+D V++ H LE A D  
Sbjct: 67  GPLNAGLAASAPAPVDGAAIWPPGPLPLSVMSDYETLPFPSASLDLVVLPHTLELAGDAH 126

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREA------- 165
             L E+ RVL   GR++V+  N   +W   + +   +G+       +S   E        
Sbjct: 127 QTLREVERVLMPEGRVVVIGFNPASLWGAYQASADVAGRLGWGSGPVSSGTELIGWRRLR 186

Query: 166 ------NFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG 219
                            + PP   +  L+  + F+  G+ + P     YV+ A K +   
Sbjct: 187 DWLRLLGLEFESGRFGCYRPPFATERWLERCAWFDDAGSRWWPVLGSAYVLVAVKRVRAM 246

Query: 220 LPITESKKKHISSPILVPHTVS 241
             +  + +K  +    VP  V+
Sbjct: 247 RLMGPAWRKK-TQGATVPAAVA 267


>gi|319793186|ref|YP_004154826.1| methyltransferase type 11 [Variovorax paradoxus EPS]
 gi|315595649|gb|ADU36715.1| Methyltransferase type 11 [Variovorax paradoxus EPS]
          Length = 250

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 82/231 (35%), Gaps = 21/231 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           + ++++  G+               DV G   L LG         +    R LA      
Sbjct: 2   QDWFATPPGRYLLAWEQAQFDQAVADVFGYHALQLGAPEVEGLRTNRMPHRWLALSD--- 58

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                P +   +T L     LP A +S+D V+M H LE + DP   L E+ RVL   GR+
Sbjct: 59  -----PMRPAKATLLTDFTALPFAANSLDLVVMPHALELSPDPHATLREVERVLVPEGRV 113

Query: 129 IVVVPNKRGMWARMEHTPFGS-------------GQPYSWYQMISLLREANFTLSITSRS 175
           ++   N   +W   +                   G+   +++M   LR  +F +      
Sbjct: 114 VICGLNPASLWGMRQRRAHLYRKLGVGDLYLPEGGEFIGYWRMRDWLRLLSFEVESGRFG 173

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK 226
           ++ P       L+     +K G  + P F   Y + A K +     ++   
Sbjct: 174 IYRPAVRSDAWLERCRWMDKAGERWWPIFGAAYFLVAVKRVRGMRLLSADW 224


>gi|221067919|ref|ZP_03544024.1| Methyltransferase type 11 [Comamonas testosteroni KF-1]
 gi|220712942|gb|EED68310.1| Methyltransferase type 11 [Comamonas testosteroni KF-1]
          Length = 277

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/261 (19%), Positives = 85/261 (32%), Gaps = 30/261 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT---LAFMP 65
             +  S LG    +   +       D+ G   L LG         +    R        P
Sbjct: 2   HHWTDSALGHYLLEWEQQRFDEAVADIFGYHALQLGLPQLQGLRGNRMPHRWLALEGLDP 61

Query: 66  AGQG-----ATNWPDQYFSSTALVS---------------EGNLPLADSSVDCVLMVHYL 105
                    A     +   +                       LP A++S+D +LM H L
Sbjct: 62  VPDAKAGTVAQAAAVRVSQAQPPAEETQNFAPLMPALRTAPEALPFAEASLDLLLMPHTL 121

Query: 106 EFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYS------WYQMI 159
           E + DP   L E  RVL   GR+++   N   +          +G          ++++ 
Sbjct: 122 EASNDPHAALREAARVLVPEGRLVISGLNPSSLLGLQRRVERSAGYLPDLSLGVGYWRLR 181

Query: 160 SLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG 219
             LR  +F +       + P T  +  L  W   E +G+   P   G+Y + A K +   
Sbjct: 182 DWLRLLSFEIEAVQFGCYRPATQSEKWLSRWQFMEGLGHRCWPVMGGVYCVVAVKRVQGM 241

Query: 220 LPITESKKK-HISSPILVPHT 239
             ++ S +K  +   +  P T
Sbjct: 242 RMMSPSWRKSSVPVGMKAPVT 262


>gi|90420228|ref|ZP_01228136.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335562|gb|EAS49312.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 204

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 91/195 (46%), Positives = 123/195 (63%), Gaps = 2/195 (1%)

Query: 48  PFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEF 107
           P+   F    ER LAFMP  QG   WP    S TAL+   +LPL D+SVD +L+VH LEF
Sbjct: 2   PYIDRFAADAERALAFMPGAQGGQVWPAGAASLTALIGIEDLPLGDASVDRILIVHALEF 61

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANF 167
           AE P  ML E WRVL  GGR+++V P++RG+WAR EHTPFGSG+P+S  Q+  LLR   F
Sbjct: 62  AESPETMLAEAWRVLAPGGRIVIVAPHRRGIWARFEHTPFGSGRPWSRGQLTRLLRATMF 121

Query: 168 TLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE--S 225
           T +  S++L FPP  ++ +L   +  E++G    P FAG  +IEA K LY+G+P+T    
Sbjct: 122 TPTAWSQALLFPPFRRRSMLGFATPLERVGRDLWPVFAGAVIIEATKQLYRGVPVTSMAR 181

Query: 226 KKKHISSPILVPHTV 240
           +++    P+LVP   
Sbjct: 182 ERRRAIKPVLVPAGA 196


>gi|77166268|ref|YP_344793.1| generic methyl-transferase [Nitrosococcus oceani ATCC 19707]
 gi|254435362|ref|ZP_05048869.1| hypothetical protein NOC27_2425 [Nitrosococcus oceani AFC27]
 gi|76884582|gb|ABA59263.1| generic methyl-transferase [Nitrosococcus oceani ATCC 19707]
 gi|207088473|gb|EDZ65745.1| hypothetical protein NOC27_2425 [Nitrosococcus oceani AFC27]
          Length = 256

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 51/235 (21%), Positives = 89/235 (37%), Gaps = 13/235 (5%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +    LG+    A    L     D+ G  L+ LG                   + A   
Sbjct: 17  AWLDESLGRRLLKAEQAELEKILPDLFGYHLVQLGAVRRGTDLLSSSCIWHRIVLEAE-- 74

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                 +  S + L     LP A+++VD +++ H LE+   P  +L E  RVL   G + 
Sbjct: 75  ---VWPEAQSPSLLSRIDALPFANATVDGIILPHVLEYEAAPHQVLREAQRVLVPYGTLA 131

Query: 130 VVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           ++  N    W           +    G+ YS  ++   L    F        LF PP  +
Sbjct: 132 ILGFNPWSFWGLWRFILCRRGSMPWCGRFYSLTRIQDWLALLGFKTVELRYFLFRPPLRQ 191

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILV 236
             +++     E++G  + P FAG Y++ A+K + +  PI    +  + ++ P L 
Sbjct: 192 PRLMRRLRFLEEVGRRWYPFFAGSYLVVAKKQVMRLNPIDPLWREEESLNMPALA 246


>gi|241663327|ref|YP_002981687.1| type 11 methyltransferase [Ralstonia pickettii 12D]
 gi|240865354|gb|ACS63015.1| Methyltransferase type 11 [Ralstonia pickettii 12D]
          Length = 262

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 82/239 (34%), Gaps = 33/239 (13%)

Query: 35  VTGCRLLGLGYAIPFFSCFHGKVERTLAFMP------------------------AGQGA 70
           + G   L LG+        +                                     +  
Sbjct: 1   MFGYHALQLGHPGFGALRENRIPLIARVVDDIDPTAPIESLDPMEGNPAESADPADAEPD 60

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            + P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+++
Sbjct: 61  ASTPQRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLVI 120

Query: 131 VVPNKRGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              N   +W           E       Q  ++ ++   L+   F +       + PP  
Sbjct: 121 TGFNPLSLWGMRQGMRRLGTESFLPAQSQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPNR 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
               L+  +  EK G+ + P F  +Y+++A K +     +  + K    SP LVP    
Sbjct: 181 SDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRVRAMRLVGPAWKTR-KSPSLVPAGTP 238


>gi|292493433|ref|YP_003528872.1| generic methyl-transferase [Nitrosococcus halophilus Nc4]
 gi|291582028|gb|ADE16485.1| generic methyl-transferase [Nitrosococcus halophilus Nc4]
          Length = 268

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 81/225 (36%), Gaps = 11/225 (4%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +    LG+         L      + G  L+ LG                   +  G  
Sbjct: 29  AWLEKPLGRRLLKTERAELERILPGLFGYHLVQLGAVRKGTDLLSSSRIWHQVVLETGTW 88

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
           +   P    S         LP A ++VD +++ H LE+  +P  +L E+ RVL   G ++
Sbjct: 89  SEAQPPSLLSRA-----DTLPFASATVDGMVLPHVLEYEANPHQVLREVQRVLVPYGTLV 143

Query: 130 VVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           V+  N   +W                G+ YS  ++   L    F        LF PP   
Sbjct: 144 VLGFNPWSLWGLWRLFLWRWGQVPWCGRFYSLTRLRDWLALLGFETVELRYFLFRPPLQH 203

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
             +++     E +G  + P  AG Y++ A+K + +  P+    +K
Sbjct: 204 PRLMRRLRFLEGVGQRWWPFLAGGYLVVAKKQVMRLNPVDPLWRK 248


>gi|187929119|ref|YP_001899606.1| type 11 methyltransferase [Ralstonia pickettii 12J]
 gi|187726009|gb|ACD27174.1| Methyltransferase type 11 [Ralstonia pickettii 12J]
          Length = 262

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 50/239 (20%), Positives = 83/239 (34%), Gaps = 33/239 (13%)

Query: 35  VTGCRLLGLGY-AIPFFSCFH----------------GKVERTLAFMPAGQGATNW---- 73
           + G   L LG+                           +    +   PA           
Sbjct: 1   MFGYHALQLGHPGFGALRENRIPLIARVVDDIDPTAPTETLDPMDGDPAESADAADGEPD 60

Query: 74  ---PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
              P +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+I+
Sbjct: 61  TSTPPRQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLII 120

Query: 131 VVPNKRGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
              N   +W           E       Q  ++ ++   L+   F +       + PP  
Sbjct: 121 TGFNPLSLWGMRQGMRRLGTESFLPAQSQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPNR 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
               L+  +  EK G+ + P F  +Y+++A K +     +  + K    SP LVP    
Sbjct: 181 SDKWLQRTAFMEKAGDRWWPIFGAVYMLQAVKRVRSMRLVGPAWKTR-KSPALVPAGTP 238


>gi|119471756|ref|ZP_01614116.1| hypothetical protein ATW7_08896 [Alteromonadales bacterium TW-7]
 gi|119445379|gb|EAW26667.1| hypothetical protein ATW7_08896 [Alteromonadales bacterium TW-7]
          Length = 258

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 77/235 (32%), Gaps = 20/235 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G      I + +      + G  +L LG      +     ++  +        
Sbjct: 15  SWQQFPHGDYLQADIERKMQYWLPRMFGYHMLKLGNLSGELNTSLSTIKHQVCV------ 68

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                +    +  +     LP  + SVD  ++ H LE+  DP  +L E  R L  GG ++
Sbjct: 69  ----AEPGPYTGVVADIDELPFYEHSVDACILSHCLEYHSDPHHILREAHRTLIPGGYVL 124

Query: 130 VVVPNKRGMWARMEHTP------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +    +  P        +G+ ++  ++   L    F +    R ++      
Sbjct: 125 ITGFNPLSLCGLAQMLPFSGQKLPWTGRFFTPARVKDWLNLLGFEIVSDERFIYSSLARG 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
             + +    +      +      +Y++ ARK +    PI        + P  VP 
Sbjct: 185 NRLSRF-EFWRAFAKQYLKPMGSVYMLVARKRVAPLTPIKPKW---HARPQFVPV 235


>gi|83645318|ref|YP_433753.1| SAM-dependent methyltransferase [Hahella chejuensis KCTC 2396]
 gi|83633361|gb|ABC29328.1| SAM-dependent methyltransferase [Hahella chejuensis KCTC 2396]
          Length = 259

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 11/236 (4%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            EL  ++ S LG+       + +  +     G   L L  +          +   +  +P
Sbjct: 17  KELEIWFQSPLGQTMLANQRQTVEQSIGRFFGYHQLELLVSHELPVGQSSLLGHRIISVP 76

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                  W  +    + +     LPL   S+D V++ H L+ A  P   L E  RVL SG
Sbjct: 77  ------RWEKELPEGSLVCHSHELPLESDSIDLVILHHTLDVAARPHQSLREAARVLRSG 130

Query: 126 GRMIVVVPNKRGMWARMEHTP-----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           G M+++  N    W              SG+  +  ++   L   +F L       + PP
Sbjct: 131 GHMVIIGFNPLSAWGLRRAIFRSPKAPWSGRFLTSSRLEDWLSLLDFRLKDVRYRFYAPP 190

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
              +  L   +  +K G  F       Y I A+K +   +P+    +    +   V
Sbjct: 191 VTNQQWLSRLAFLDKFGARFRLPLGAYYTIVAQKRVGCMIPLRPQWRSSRVAGAAV 246


>gi|209545179|ref|YP_002277408.1| hypothetical protein Gdia_3063 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532856|gb|ACI52793.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 261

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 77/245 (31%), Positives = 114/245 (46%), Gaps = 7/245 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M+VDI    +FY+S  G+ T   + + L   W    G R+LGLGY +PF   +       
Sbjct: 1   MQVDIRAAARFYASRPGENTARLLRQRLQAFWPHTGGDRVLGLGYTLPFLPLWSRPDRGL 60

Query: 61  LA---FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
                   A                LV EG LP  +   D V++VH LE    P  ++  
Sbjct: 61  CVSARLDTAVTREAPSERAAGIHDCLVDEGRLPFPELHFDRVVLVHALEVTHRPDDLIRS 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           +W+V+   GR+++VVPN+ G WA  + TPFG G P+S  Q+   L  A         +LF
Sbjct: 121 VWKVMKDDGRLLLVVPNRAGWWAHSDDTPFGQGTPFSPRQITRRLAHAFLRAERHDGALF 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE---SKKKHISSPI 234
            PP     + +L +V E +G++  PG  G++VIEA K +Y G+P         + I  P 
Sbjct: 181 LPPVA-AALRRLGAVTEAVGHMLLPGLGGVFVIEAVKDVYSGVPAAPALIRAPRRIYEPG 239

Query: 235 LVPHT 239
           L   +
Sbjct: 240 LTARS 244


>gi|162149077|ref|YP_001603538.1| hypothetical protein GDI_3307 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161787654|emb|CAP57250.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 261

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 77/245 (31%), Positives = 114/245 (46%), Gaps = 7/245 (2%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M+VDI    +FY+S  G+ T   + + L   W    G R+LGLGY +PF   +       
Sbjct: 1   MQVDIRAAARFYASRPGENTARLLRQRLQAFWPHTGGDRVLGLGYTLPFLPLWSRPDRGL 60

Query: 61  LA---FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
                   A                LV EG LP  +   D V++VH LE    P  ++  
Sbjct: 61  CVSARLDTAVTREAPSERAAGIHDCLVDEGRLPFPELHFDRVVLVHALEVTHRPDDLIRS 120

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           +W+V+   GR+++VVPN+ G WA  + TPFG G P+S  Q+   L  A         +LF
Sbjct: 121 VWKVMKDDGRLLLVVPNRAGWWAHSDDTPFGQGTPFSPRQITRRLAHAFLRAERHDGALF 180

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE---SKKKHISSPI 234
            PP     + +L +V E +G++  PG  G++VIEA K +Y G+P         + I  P 
Sbjct: 181 LPPVA-AALRRLGAVTEAVGHMLLPGLGGVFVIEAVKDVYSGVPAAPALIRAPRRIYEPG 239

Query: 235 LVPHT 239
           L   +
Sbjct: 240 LTARS 244


>gi|239815322|ref|YP_002944232.1| methyltransferase type 11 [Variovorax paradoxus S110]
 gi|239801899|gb|ACS18966.1| Methyltransferase type 11 [Variovorax paradoxus S110]
          Length = 251

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 81/231 (35%), Gaps = 20/231 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           + ++++  G+               DV G   L LG A       +    R LA    GQ
Sbjct: 2   QDWFATPPGRYLLAWEQAQFDEAVADVFGYHALQLGAAGVDGLRTNRMPHRWLALPDPGQ 61

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
            +                  LP A +S+D V++ H LE ++DP   L E+ RVL   GR+
Sbjct: 62  PSGRAA-------LYTDFAALPFAANSLDLVVLPHALELSQDPHAALREVERVLVPEGRV 114

Query: 129 IVVVPNKRGMWARMEHTPFGSGQ-------------PYSWYQMISLLREANFTLSITSRS 175
           ++   N   +W   +       +                +++M   LR  +F +      
Sbjct: 115 VICGLNPASLWGMRQRRAHLYRRLGLGDLFLPEGGEFIGYWRMRDWLRLLSFEVESGRFG 174

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK 226
           ++ P    +  L+     +  G  + P F   Y + A K +     ++   
Sbjct: 175 VYRPAVRSEAWLERCRWMDAAGERWWPIFGAAYFLVAVKRVRGMRLLSADW 225


>gi|17546233|ref|NP_519635.1| hypothetical protein RSc1514 [Ralstonia solanacearum GMI1000]
 gi|17428530|emb|CAD15216.1| hypothetical generic methyltransferase; protein [Ralstonia
           solanacearum GMI1000]
          Length = 257

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 28/234 (11%)

Query: 35  VTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATN-------------------WPD 75
           + G   L LG+        +              GA                      P 
Sbjct: 1   MFGFHALQLGHPGFGALRENRIPLIARVIDDIDPGAPIDTLDPADPDPPGEADAEPVVPQ 60

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+++   N 
Sbjct: 61  RQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLVITGFNP 120

Query: 136 RGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCIL 187
             +W           E       Q  ++ ++   L+   F +       + PP      L
Sbjct: 121 LSLWGMRQGMRRLGTESFLPAQSQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPNRTDKWL 180

Query: 188 KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           +  +  EK G+ + P F  +Y+++A K +     +  + K    SP LVP    
Sbjct: 181 QRTAFMEKAGDRWWPIFGAVYMLQAVKRVRSVRLVGPAWKTR-KSPTLVPAGTP 233


>gi|114327118|ref|YP_744275.1| methyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|114315292|gb|ABI61352.1| methyltransferase [Granulibacter bethesdensis CGDNIH1]
          Length = 269

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 70/225 (31%), Positives = 113/225 (50%), Gaps = 3/225 (1%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
             FY +  G+     +   L   W   +  G  LLGLG+A P+  C+     R +     
Sbjct: 5   AAFYGTLAGEVVASLLRARLRLLWPGEECEGQTLLGLGHAAPYMRCWRSTAYRCVVGSLH 64

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                 WP    + +   +   LP  D S+D +++VH LE  +    +L E+WR+L   G
Sbjct: 65  PSAGQVWPPAGRTLSCDATPSALPFPDLSIDRIVLVHALEMTDHARALLREVWRILKDDG 124

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP-THKKC 185
           R++VV PN+ G+WA ++  PFG GQP+S  Q+  LL  + F +     +L+ PP  H + 
Sbjct: 125 RLMVVAPNRTGLWAHLDTNPFGQGQPFSHGQIERLLAASLFRVERRDAALYMPPVFHSRA 184

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
           +L+   +FE  G    PG AG+ + EA K +Y G+P+  + +K +
Sbjct: 185 LLRAAWLFESTGRHLIPGLAGVTISEAVKDVYAGVPLRPTIRKRL 229


>gi|59712544|ref|YP_205320.1| S-adenosyl-L-methionine-dependent methyltransferase [Vibrio
           fischeri ES114]
 gi|59480645|gb|AAW86432.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio fischeri ES114]
          Length = 247

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 91/243 (37%), Gaps = 22/243 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I +   +     G+   + I   L      + G  +L +G            ++  +   
Sbjct: 11  IEKPHSWEDIPHGEWICELIQSRLDEWCPKLFGYHMLKIGGLSAELDSRFCNIKHQVNLD 70

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                     ++            LP  + S+D  ++ H L+++ DP  +L EI RVL  
Sbjct: 71  ----------NKNSLRNITAELPQLPFLEKSIDACVLAHQLDYSSDPHQLLREIDRVLIG 120

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N              ++    SG+ ++ +++   L   NF +  +      
Sbjct: 121 DGYVILTGFNPMSAIGLASLFPWRKNNLPWSGRMFTPHRIKDWLSVLNFEVVYSDCFALA 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P T  + +   W+ FE +G       +GIY I ARK  Y   PI  + KK    P L P 
Sbjct: 181 PLTRYRTM---WTWFEGLGGDAVKPISGIYFIVARKRTYPLRPIKSAWKK---KPKLAPI 234

Query: 239 TVS 241
           +V+
Sbjct: 235 SVA 237


>gi|315126184|ref|YP_004068187.1| S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas sp. SM9913]
 gi|315014698|gb|ADT68036.1| S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas sp. SM9913]
          Length = 253

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/232 (15%), Positives = 74/232 (31%), Gaps = 18/232 (7%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G      I + LS     + G  +L LG            ++  +        
Sbjct: 15  SWQQFPHGDYLRCDIERKLSPWLPRMFGYHMLKLGNLSGELDTSKSSIKHQVCV------ 68

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                +    +  +     LP  + S+D  +M H LE+  DP  +L E  R L  GG + 
Sbjct: 69  ----AEPGPYTGVVADIDELPFYEHSIDACIMSHCLEYHSDPHHILREAHRTLIPGGYIA 124

Query: 130 VVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N        +           +G+ ++  ++   L    F +    R ++      
Sbjct: 125 ITGFNPFSFCGLAQLLPFSGQKLPWTGRFFTPARVKDWLNLLGFEIVADERFIYSSLARG 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPI 234
             + +    +      +      +Y++ ARK +    PI      +   +PI
Sbjct: 185 NRLSRFA-FWRSFTKQYLKPMGSVYLLVARKRVAPLTPIKPKWHARPQFAPI 235


>gi|197334585|ref|YP_002156766.1| methyltransferase [Vibrio fischeri MJ11]
 gi|197316075|gb|ACH65522.1| methyltransferase [Vibrio fischeri MJ11]
          Length = 247

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 91/243 (37%), Gaps = 22/243 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I +   +     G+   + I   L      + G  +L +G            ++  +   
Sbjct: 11  IEKPHSWEDIPHGEWICELIQSRLDEWCPKLFGYHMLKIGGLSAELDSRFCNIKHQVNLD 70

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                     ++            LP  + S+D  ++ H L+++ DP  +L EI RVL  
Sbjct: 71  ----------NKNSLRNITAELPQLPFLEKSIDACVLAHQLDYSSDPHQLLREIDRVLIG 120

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N              ++    SG+ ++ +++   L   NF +  +      
Sbjct: 121 DGYVILTGFNPMSAIGLASLFPWRKNNLPWSGRMFTPHRIKDWLSVLNFEVVYSDCFALA 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P T  + +   W+ FE +G       +GIY I ARK  Y   PI  + KK    P L P 
Sbjct: 181 PLTRYRTM---WTWFEGLGGDAVKPISGIYFIVARKRTYPLRPIKSAWKK---KPKLAPI 234

Query: 239 TVS 241
           +V+
Sbjct: 235 SVA 237


>gi|300691208|ref|YP_003752203.1| S-adenosyl-L-methionine-dependent methyltransferase [Ralstonia
           solanacearum PSI07]
 gi|299078268|emb|CBJ50916.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Ralstonia solanacearum PSI07]
          Length = 257

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 82/234 (35%), Gaps = 28/234 (11%)

Query: 35  VTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGAT-------------------NWPD 75
           + G   L LG+        +              GA                      P 
Sbjct: 1   MFGFHALQLGHPGFGALRENRIPLIARVIDDIDPGAPIDTLDPADPDPPGEADADPAVPL 60

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+I+   N 
Sbjct: 61  RQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLIITGFNP 120

Query: 136 RGMWARMEHTP--------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCIL 187
             +W   +               Q  ++ ++   L+   F +       + PP      L
Sbjct: 121 LSLWGMRQGMRRLGTASFLPAQSQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPNRTDKWL 180

Query: 188 KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           +  +  EK G+ + P F  IY+++A K +     +  + K    SP LVP    
Sbjct: 181 QRTAFMEKAGDRWWPIFGAIYMLQAVKRVRGTRLVGPAWKTR-KSPALVPAGTP 233


>gi|299066483|emb|CBJ37671.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Ralstonia solanacearum CMR15]
          Length = 257

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 82/234 (35%), Gaps = 28/234 (11%)

Query: 35  VTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATN-------------------WPD 75
           + G   L LG+        +              GA                      P 
Sbjct: 1   MFGFHALQLGHPGFGALRENRIPLIARVIDDIDPGAPIDTLDPADPDPPGEADAEPVVPQ 60

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +  +   +     LP A  S+D V + H LEF +DP  +L E+ RVL   GR+++   N 
Sbjct: 61  RQATPRVICRYDELPFASQSIDLVALPHVLEFTDDPHEVLREVARVLMPEGRLVITGFNP 120

Query: 136 RGMWARM--------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCIL 187
             +W           E       Q  ++ ++   L+   F +       + PP      L
Sbjct: 121 LSLWGMRQGMRRLGTESFLPAQSQMIAFTRLKDWLKLLGFDIVRGRFGCYCPPNRTDKWL 180

Query: 188 KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           +  +  E+ G+ + P F  +Y+++A K +     +  + K    SP LVP    
Sbjct: 181 QRTAFMEQAGDRWWPIFGAVYMLQAVKRVRSVRLVGPAWKTR-KSPTLVPAGTP 233


>gi|71277808|ref|YP_268730.1| hypothetical protein CPS_2000 [Colwellia psychrerythraea 34H]
 gi|71143548|gb|AAZ24021.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 257

 Score =  129 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 17/239 (7%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +   G+    AI + L+  W    G  L+ LG            +   ++       
Sbjct: 15  SWKALPNGEVIKKAIEQELAPWWQKFFGYHLIKLGALSSEIEIPDCTINHQVSISI---- 70

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                 +   +  +    +LPL + SVD  L+ H LEF+ DP  ++ E  RVL   G ++
Sbjct: 71  ------KNGLANVVGDIDDLPLQEHSVDVCLLSHALEFSLDPHHVVREANRVLIPNGYLV 124

Query: 130 VVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +                +   +S  ++   L    F +    R L    T K
Sbjct: 125 LTGFNPLSLVGLNRLLPYRRSKTPWNEHFFSPMRIKDWLHLMGFEILADQRCLHSSLTGK 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI-SSPILVPHTVS 241
                L   + K+   + P    +YVI A+K +    PI    +      P+ VP   +
Sbjct: 185 VSTDSLEHRWHKLAKSYLPALGSVYVIVAKKRVLPLTPIKPKWQIRSGFRPVKVPSLST 243


>gi|209695825|ref|YP_002263755.1| hypothetical protein VSAL_I2400 [Aliivibrio salmonicida LFI1238]
 gi|208009778|emb|CAQ80084.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 247

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 92/243 (37%), Gaps = 22/243 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I +   + S   G    + I   L      + G  +L +G        +   ++  ++  
Sbjct: 11  IEKPHSWSSIPHGNWIRELIQSRLDEWCPKLFGYHMLKVGGLSAELDSYFCNIKHQVSLD 70

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                     ++            LP  + S+D  ++ H L+++ DP  +L E+ RVL  
Sbjct: 71  ----------NKNSLKNICADLPQLPFLEKSIDACVLAHQLDYSSDPHQLLREVDRVLIH 120

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N              ++    SG+ ++ +++   L   NF +  +      
Sbjct: 121 DGYVILTGFNPMSAIGIASLFPWRKNNLPWSGRMFTPHRIKDWLAVLNFEVVYSDCFALA 180

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P T  + I   W+ FE +G       +GIY I ARK  Y    I  + KK    P L P 
Sbjct: 181 PLTRYQTI---WTWFENLGGESVKPVSGIYFIVARKRTYPLKAIKSAWKK---KPKLAPI 234

Query: 239 TVS 241
           +V+
Sbjct: 235 SVA 237


>gi|77360890|ref|YP_340465.1| S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76875801|emb|CAI87022.1| conserved protein of unknown function ; putative
           S-adenosyl-L-methionine-dependent methyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 255

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/228 (14%), Positives = 72/228 (31%), Gaps = 17/228 (7%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G      I + L+     + G  +L LG      +     ++  +        
Sbjct: 15  SWQQFPHGDYLRCEIERKLAPWLPRMFGYHMLKLGSLSGELNTSKCLIKHQVCV------ 68

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                     +  +     LP  + ++D  ++ H LE+  DP  +L E  R L  GG ++
Sbjct: 69  ----AQAGAHTGVIADIDELPFYEHTIDACILSHCLEYHSDPHHILREAHRTLIPGGYIV 124

Query: 130 VVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           V   N   +    +           +G+ ++  ++   L    F +    R ++      
Sbjct: 125 VTGFNPFSLCGLAQLLPFSGQKLPWTGRFFTPARVKDWLNLLGFEIVSDERFIYSSLARG 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
             + +    +      +      +Y++ ARK +    PI         
Sbjct: 185 NRLSRFA-FWRSFTKQYLKPMGSVYMLVARKRVAPLTPIKPKWHARPR 231


>gi|302878567|ref|YP_003847131.1| Methyltransferase type 11 [Gallionella capsiferriformans ES-2]
 gi|302581356|gb|ADL55367.1| Methyltransferase type 11 [Gallionella capsiferriformans ES-2]
          Length = 256

 Score =  128 bits (321), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 85/233 (36%), Gaps = 19/233 (8%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L +++++  G    D        + +D+ G   L LG +   F        R        
Sbjct: 11  LSEWFATTPGGYVLDYEQAWFDRSVNDIFGYNALQLGLSGHDFLRNSRIPLRFSG----- 65

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                  +    +   +    LP+A  S+D VL+ H LEF+  P  +L E+ RVL + G 
Sbjct: 66  -------EDKTGAALRLCADELPIACGSLDLVLLPHLLEFSALPHAILREVERVLRAEGS 118

Query: 128 MIVVVPNKRGMWARMEHT-----PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           +I+   N   +W               G   + +++   L    F ++  S   + PP  
Sbjct: 119 LIISGFNPHSLWGLHRTMVRRQGYPWCGHFIALHRLRDWLSLLGFEVAEISFDAYAPPFQ 178

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
           +   L    + E  G  + P   G+Y + A K +     +  S    +   +L
Sbjct: 179 Q--WLSRTDLIESAGKRWWPASGGVYFVHAIKRVPGMRLLKPSWNAGLVKKLL 229


>gi|304320136|ref|YP_003853779.1| hypothetical protein PB2503_02807 [Parvularcula bermudensis
           HTCC2503]
 gi|303299039|gb|ADM08638.1| hypothetical protein PB2503_02807 [Parvularcula bermudensis
           HTCC2503]
          Length = 257

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 125/247 (50%), Gaps = 14/247 (5%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+ + EL +FY+  LG     +++      W      R+ G GYA P+      K ER 
Sbjct: 1   MRLAVSELERFYAGPLGPAVERSLTAKFYEAWGQGDRLRIAGYGYAQPYL-RLFTKAERL 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            A  PAG G             LV +   PL D+S+D +L+VH LE A D   +L E+WR
Sbjct: 60  AALCPAGSGV---RAGGPVPAVLVDDYAWPLPDASIDRLLIVHGLEEATDTRRLLREVWR 116

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           VLT  G +I  V N+RG W+ +E +PF +G+P+S  Q+   L+ A F  +  + +L FPP
Sbjct: 117 VLTDDGLVIFAVANRRGPWSLVETSPFAAGRPFSRRQLDLALKAAMFAPTAYAAALHFPP 176

Query: 181 THKKCILKLWSVFEKIGN--------IFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
              + +L+L  +++++G+           P  AG+ ++EARK     LPI  ++ + +  
Sbjct: 177 IPNRGLLRLAPLWDRLGDSLDALSIGRLLPNIAGVNLVEARKTTS--LPIGSARAEVLRP 234

Query: 233 PILVPHT 239
            +  P  
Sbjct: 235 GLFAPGG 241


>gi|323498000|ref|ZP_08103009.1| SAM-dependent methyltransferase [Vibrio sinaloensis DSM 21326]
 gi|323317045|gb|EGA70047.1| SAM-dependent methyltransferase [Vibrio sinaloensis DSM 21326]
          Length = 247

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 86/235 (36%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      + F   ++  +       
Sbjct: 14  HSWSQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELTSFACNIQHQVNLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    +LP  + S D V+M H L++  DP  ML E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADGYDLPFLEKSFDVVVMAHQLDYCNDPHRMLREVDRVMIDDGYI 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          ++    SG+ ++  ++   L   N+ +        FP   
Sbjct: 124 IITGFNPVSLTGIARLLPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVECDSYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            + +   W+ FE     +      +Y I ARK  Y   PI    K K   +PI V
Sbjct: 184 YRTM---WTWFENSLGDWASPMGSLYFIVARKRTYPLKPIKPHWKLKRKLTPIGV 235


>gi|260775262|ref|ZP_05884159.1| SAM-dependent methyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608443|gb|EEX34608.1| SAM-dependent methyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 247

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/235 (20%), Positives = 86/235 (36%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   +      + G  +L LG      + F+  ++  +       
Sbjct: 14  HSWSQLKNGQWVSESIQTRVDEWCPKLFGYHMLKLGGLSCELTSFNCNIQHQVNLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    +LP  + S D V+M H L++  DP  ML E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADGYDLPFLEKSFDAVVMAHQLDYCNDPHRMLREVDRVMIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          ++    SG+ ++  ++   L   N+ +        FP   
Sbjct: 124 IITGFNPISLTGLASLMPWRKNNLPWSGRMFTPNRIRDWLSVLNYQVIECDSYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            + +   W+  E     +      +Y I ARK  Y   PI    K K   +PI V
Sbjct: 184 YRTM---WTWLENSLGDWASPMGSLYFIVARKRTYPLKPIKPHWKLKRKLTPIGV 235


>gi|119898347|ref|YP_933560.1| hypothetical protein azo2056 [Azoarcus sp. BH72]
 gi|119670760|emb|CAL94673.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 254

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 80/235 (34%), Gaps = 18/235 (7%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R+ I+ L  +  +  G+   +     L     D+ G   + +G A       +    R  
Sbjct: 10  RMSILSLSDWLDTPQGRYLIEWEQARLDAIVADIFGYNAVQIGLAGLDCLRANRMPFRFA 69

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                         +      +     LP A +S+D V++ H LEFA  P  +L E+ RV
Sbjct: 70  CG------------RTGRVAVVSRSDELPFATASLDLVVLPHVLEFARRPHHVLREVERV 117

Query: 122 LTSGGRMIVVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +W                GQ  S  ++   L    F        
Sbjct: 118 LVPEGSVVITGFNPFSLWGLRRLAARRNGELPWQGQYLSALRVKDWLTLLGFESQGAGFG 177

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
            + P   +   ++ W   ++ G  + P     Y ++  K +     +T + ++  
Sbjct: 178 CYIPAVSRPEWIERWRFMDRAGVRWWPVCGAAYAMQGIKRVQGMRLLTPNWREKK 232


>gi|254508678|ref|ZP_05120793.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus 16]
 gi|219548435|gb|EED25445.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus 16]
          Length = 245

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 83/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   +      + G  +L LG      + F   ++  +       
Sbjct: 14  HSWSQLKNGQWVSESIQTRMDEWCPKLFGYHMLKLGGLSCELTSFACNIQHQVNLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +      +    +LP  + S D V+M H L++  DP  ML E+ RV+   G +
Sbjct: 71  -------KNPLHNVIADGYDLPFFEKSFDAVVMAHQLDYCNDPHRMLREVDRVMIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N               +    SG+ ++  ++   L   N+ +        FP   
Sbjct: 124 IITGFNPISFTGLASLMPWRRNNLPWSGRMFTPNRIKDWLSVLNYQVIECDSYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            + +   W+  E     +      +Y I ARK  Y   PI    K K   +P+ V
Sbjct: 184 YRTM---WTWLENSLGDWAAPMGSLYFIVARKRTYPLKPIKPHWKLKRKLTPVSV 235


>gi|261253704|ref|ZP_05946277.1| SAM-dependent methyltransferase [Vibrio orientalis CIP 102891]
 gi|260937095|gb|EEX93084.1| SAM-dependent methyltransferase [Vibrio orientalis CIP 102891]
          Length = 245

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+   D+I   +      + G  LL LG      + F+  ++  +       
Sbjct: 14  HSWSQLKNGQWVNDSIQTRIDEWCPRLFGYHLLKLGGLSCELTSFNCNIQHQVQLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    +LP  + S D VLM H L++  DP  ML E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADGYDLPFLEKSFDAVLMAHQLDYCNDPHRMLREVDRVMIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +           +    SG+ ++  ++   L   N+ +        FP   
Sbjct: 124 IITGFNPISLTGLGSLMPWRRNNLPWSGRMFTPNRIKDWLGLLNYQVVECDSYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            + +   W+  E     +      +Y + ARK  Y   PI    K K   +P+ V
Sbjct: 184 YRTM---WTWLENSLGDWASPMGSLYFVVARKRTYPLKPIKPHWKLKRKLTPVSV 235


>gi|192360820|ref|YP_001982515.1| generic methyl-transferase [Cellvibrio japonicus Ueda107]
 gi|190686985|gb|ACE84663.1| Generic methyl-transferase [Cellvibrio japonicus Ueda107]
          Length = 301

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 93/242 (38%), Gaps = 14/242 (5%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R  I ++ +++ + LG+       ++++ + + + G  L+ LG +         ++    
Sbjct: 30  RDSIEDMSEWFETPLGQALIQEEKRLVNESLNCLFGYHLMQLGISGRIDMGEGIRISHRF 89

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
              P         D++   + L    +LPLA  S+D V++ H L++ + P  +L E  RV
Sbjct: 90  LLHP-------RRDEHPKLSGLTDFNHLPLASDSIDAVILHHTLDYTQSPHHLLREAARV 142

Query: 122 LTSGGRMIVVVPNKRGMWAR-------MEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           +   G ++++  N   +W                  Q     +++  L   N       +
Sbjct: 143 IIPRGHLVIIGFNPWSLWGLGSWVARLFSSQARWRYQYLRLGRLLDWLSLVNLEPVEIYQ 202

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
             + PP  +   ++     E  G  +   + G Y+I ARK      PI  + +  +    
Sbjct: 203 GYYRPPLAQPNAIQHLQWMESWGKRWRLPWGGFYMIVARKDHLAMTPIKPAWQAPLPLRG 262

Query: 235 LV 236
           L 
Sbjct: 263 LA 264


>gi|34496710|ref|NP_900925.1| hypothetical protein CV_1255 [Chromobacterium violaceum ATCC 12472]
 gi|34102565|gb|AAQ58930.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 254

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 72/220 (32%), Gaps = 17/220 (7%)

Query: 14  SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNW 73
           + LG+   +           D  G   + +G         +    +              
Sbjct: 12  TELGRYLLEREQAYFERAVADAFGYHAVQVGLPEMDCLRGNRIPWQCRVAESGE------ 65

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
                          LP    S+D ++M H L+F   P  +L E  RVL   GR+I+   
Sbjct: 66  ------VDVRCDPAFLPFETRSLDLLVMPHVLDFTTQPHQVLREADRVLMPEGRLILTGF 119

Query: 134 NKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W          +   +G  ++  ++   L      L  ++   + PP  ++  L 
Sbjct: 120 NPLSLWGVRRLIQGKESAPWNGSFFTQLRIKDWLALLELELDDSAFMAYAPPFSRQDWLG 179

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
                E  G  + P   G+Y IEA K       IT + K+
Sbjct: 180 RCGFMEDAGERWWPLAGGVYGIEAVKRQRGMRLITPNWKQ 219


>gi|260772247|ref|ZP_05881163.1| SAM-dependent methyltransferase [Vibrio metschnikovii CIP 69.14]
 gi|260611386|gb|EEX36589.1| SAM-dependent methyltransferase [Vibrio metschnikovii CIP 69.14]
          Length = 244

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 84/237 (35%), Gaps = 20/237 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+   ++I   L      + G  +L LG      S  +  ++  +   
Sbjct: 10  IESPHSWSQLKNGQWVCESIQTRLDEWCPKLFGYHMLKLGGLSCELSSGNCTIQHQVHLD 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                           T +    +LP  + S+D  ++ H L++  DP  +L E+ RVL  
Sbjct: 70  I----------HNPLHTVIADAYDLPFLEKSIDVAIIAHQLDYCNDPHRILREVDRVLID 119

Query: 125 GGRMIVVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N              +H    SG+ ++  ++   L   N+ +    +   F
Sbjct: 120 DGYVIITGFNPISLTGLTSTMPWRKHNLPWSGRMFTSSRIKDWLSVLNYQVLECDQYALF 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPI 234
           P    + +   W+  E     +      +Y I ARK  Y   PI    + K   SP+
Sbjct: 180 PMQKYRPL---WAWLENAMGGWASPLGSLYFIVARKRTYPLKPIKPHWRLKRRFSPV 233


>gi|323495338|ref|ZP_08100416.1| SAM-dependent methyltransferase [Vibrio brasiliensis LMG 20546]
 gi|323310409|gb|EGA63595.1| SAM-dependent methyltransferase [Vibrio brasiliensis LMG 20546]
          Length = 247

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +D+I   +      + G  LL LG      + F+  ++  +       
Sbjct: 14  HSWSQLKNGQWVSDSIQTRIDEWCPKLFGYHLLKLGGLSCELTSFNCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    +LP  + S D VLM H L++  DP  ML E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADGYDLPFLEKSFDAVLMAHQLDYCNDPHRMLREVDRVMIDDGYL 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N               +    SG+ ++  ++   L   N+ +        FP   
Sbjct: 124 IITGFNPISFTGLASLMPWRRNNLPWSGRMFTPNRVKDWLGLLNYQVLECDSYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            + +   W+  E     +      +Y I ARK  Y   PI    K K   +P+ V
Sbjct: 184 YRTM---WTWLENSLGDWASPVGSLYFIVARKRTYPLKPIKPHWKLKRKLTPLGV 235


>gi|24374105|ref|NP_718148.1| hypothetical protein SO_2562 [Shewanella oneidensis MR-1]
 gi|24348592|gb|AAN55592.1|AE015697_14 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 244

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 52/250 (20%), Positives = 92/250 (36%), Gaps = 22/250 (8%)

Query: 1   MRVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M  +  + +  Q+     G     A++  L+  W  V G  LL  G      S     V 
Sbjct: 1   MSYNSTVRKPEQWEDLPNGCALQQAVADKLADWWPRVFGYHLLKFGPLSAEISSMASPVA 60

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
              +   A            +++ +    +LPL +  +D V+M   LEF  DP+ +L EI
Sbjct: 61  HHFSLCSAP-----------NASLMGDFCHLPLQNGVIDAVVMSLLLEFEADPYRILREI 109

Query: 119 WRVLTSGGRMIVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSIT 172
            RVL +GG + +V  N          W + +      G+ +   ++   L    + +   
Sbjct: 110 DRVLIAGGYLFIVGFNPLSPVFLGKLWPKYQDDLPWCGRFFMPSRVRDWLGLLGYQVVSD 169

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            R ++ P   +   L      +     + P    +Y+I ARK+     PI + +K    +
Sbjct: 170 ERLIYHPLIGE---LNSGRFLQHTLASWLPSAGSLYLIVARKLESPLTPIRDKRKVRQPN 226

Query: 233 PILVPHTVST 242
               P    T
Sbjct: 227 WATAPTAGRT 236


>gi|260767801|ref|ZP_05876736.1| SAM-dependent methyltransferase [Vibrio furnissii CIP 102972]
 gi|260617310|gb|EEX42494.1| SAM-dependent methyltransferase [Vibrio furnissii CIP 102972]
 gi|315179368|gb|ADT86282.1| SAM-dependent methyltransferase [Vibrio furnissii NCTC 11218]
          Length = 244

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 87/235 (37%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG         +  ++  +       
Sbjct: 14  HSWSQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELVSCNCNIQHQVQLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    +LP  + S+D V++ H L++  DP  +L E+ RVL   G +
Sbjct: 71  -------QNPLHNVIADAYDLPFLEKSIDAVIVAHQLDYCNDPHSILREVDRVLIDDGYI 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          +H    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 ILTGFNPLSLTGLASLMPWRKHNLPWSGRMFTPNRIKDWLSVLNYQVIECDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            + +   W+  E      G  F  +Y I ARK  Y   PI    + K   SP+ V
Sbjct: 184 YRPL---WTWLENSFGDCGAPFGSLYFIVARKRTYPLKPIKPHWRLKRRLSPVGV 235


>gi|121534279|ref|ZP_01666103.1| Methyltransferase type 11 [Thermosinus carboxydivorans Nor1]
 gi|121307049|gb|EAX47967.1| Methyltransferase type 11 [Thermosinus carboxydivorans Nor1]
          Length = 229

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 79/224 (35%), Gaps = 15/224 (6%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAF 63
             +   ++ +  G+       +++    +      +  +G     ++        R +  
Sbjct: 8   AAKYDAWFQTPHGQYVYRYEREMIFDLAEVQQDMYVADVGCGTGIYTNEFCAAGARVVGI 67

Query: 64  MPAGQGATNWPDQ-----YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
             + +      ++        S        LP  D++ D V+ +  +EF E+P   LHE+
Sbjct: 68  DISPEMLAIAAEKNKTWGNRVSFVTADAAALPFPDNAFDMVVSITAMEFFEEPRRCLHEM 127

Query: 119 WRVLTSGGRMIVVVPNKRGMWARME-------HTPFGSGQPYSWYQMISLLREANFTLSI 171
            R+L  GGRMIV       +W+           T F   + YS   +  LL     T+S 
Sbjct: 128 HRILRPGGRMIVATLGNWSLWSMQRRLKTLFTRTIFSHTRFYSIRDIARLL--NPITISE 185

Query: 172 TSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
               +F PP     +++     E+ G  + P      V+   K 
Sbjct: 186 WRGGIFIPPFAPAALIRHPDKLERWGQKWIPALGTFLVVRVDKK 229


>gi|319944003|ref|ZP_08018283.1| type 11 methyltransferase [Lautropia mirabilis ATCC 51599]
 gi|319742764|gb|EFV95171.1| type 11 methyltransferase [Lautropia mirabilis ATCC 51599]
          Length = 321

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 84/228 (36%), Gaps = 14/228 (6%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
           ++ ++  G+       + L+    +V G   + LG         +    R        QG
Sbjct: 44  EWLATPPGRYLLQWEGRQLACAVGNVFGYYAVQLGMPALDALADNRMPHRIRVL----QG 99

Query: 70  ATNWPDQYFSSTAL-VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                +  +         G LP A  SVD V+M H LE   DP  +L E+ RVL   GR+
Sbjct: 100 TRPVAEGEWQPDLRVADYGELPFASQSVDLVVMPHRLEDCTDPHQLLREVDRVLRPEGRL 159

Query: 129 IVVVPNKRGMWARMEHTPFG--------SGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +V+  N   +W   +  P          +G       +   +R  +F    T    +  P
Sbjct: 160 VVLGINPWSLWGLRQALPGWLGGGFLPHAGALIGAPHVRDWIRLLSFEPDDTVYGGYAWP 219

Query: 181 THKKCIL-KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
             ++  L +     E+ G+ + P    +Y++ A K +     +  + +
Sbjct: 220 FLRQEWLARSQRFLERAGDRWWPVCGAVYLVSAVKRVRGMRLVGPAWR 267


>gi|153873915|ref|ZP_02002331.1| generic methyl-transferase [Beggiatoa sp. PS]
 gi|152069622|gb|EDN67670.1| generic methyl-transferase [Beggiatoa sp. PS]
          Length = 222

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 48/215 (22%), Positives = 81/215 (37%), Gaps = 13/215 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFM 64
            +L Q++ S LGK      + +L      + G  LL +G     +       + R     
Sbjct: 6   AQLNQWFESPLGKRLLLEEANILQQILPHLFGYHLLQIGSVGHGYLLENSRIMHRC---- 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q A      Y   +       LP A  S+D V++ H LEF EDP  +L E+ R+L  
Sbjct: 62  VSSQNANTIIKPYT--SVYGLPDALPFARDSIDVVVLPHILEFEEDPHEILREVERILIP 119

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G ++++  N   +W                G+  S  ++   L    F L       F 
Sbjct: 120 DGYVVILGFNPISLWGIWRLILKRRENAPWCGRFLSSLRIKDWLALLGFDLKQQQTFFFA 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEAR 213
            P +         + EK+G  +   F  +Y++ A+
Sbjct: 180 LPFYNDRFRNYTKLLEKMGVHWAGNFGAVYLLVAK 214


>gi|58038756|ref|YP_190720.1| putative methyltransferase [Gluconobacter oxydans 621H]
 gi|58001170|gb|AAW60064.1| Putative methyltransferase [Gluconobacter oxydans 621H]
          Length = 243

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 72/234 (30%), Positives = 105/234 (44%), Gaps = 4/234 (1%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           +   FY S  G+ T   ++  L +    + G R+LG+GY  P+               P 
Sbjct: 12  DAATFYESRQGQRTALLLNDRLQSIMPPMRGRRILGIGYTAPYLPESAEFAVSGRLQHPQ 71

Query: 67  GQGATNWP-DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
            Q  T         +  +VS G LP  D S++ VL+VH LEF       L  IWR L+  
Sbjct: 72  TQRTTRSQTRNIPWADCIVSSGRLPFDDLSMNAVLVVHGLEFTRFAPDFLRAIWRTLSDD 131

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           G + +VVPN+ G WA  + TPFG G PYS  Q+  LL +A F +   S +L  PP     
Sbjct: 132 GVLTLVVPNRSGYWAHTDATPFGHGIPYSSGQLTRLLDQALFRIEHHSSALMTPPAALSV 191

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILVPH 238
                 + E+ G        G++V+ ARK +Y G P+ + K    +   +  P 
Sbjct: 192 TQ--GRLMERAGRTLRLPCGGVHVVTARKNVYAGTPLIDEKLCVPLPRQVAEPA 243


>gi|320155616|ref|YP_004187995.1| SAM-dependent methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|326423902|ref|NP_760759.2| SAM-dependent methyltransferase [Vibrio vulnificus CMCP6]
 gi|319930928|gb|ADV85792.1| SAM-dependent methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|319999278|gb|AAO10286.2| SAM-dependent methyltransferase [Vibrio vulnificus CMCP6]
          Length = 255

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+   ++I   L      + G  LL LG      +     ++  +   
Sbjct: 10  IQHPYTWEEMNNGQWVRESIQTRLDEWCPKLFGYHLLKLGGLSCELTSAICNIQHQVNLD 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                      Q      +     LP  + S D V++ H L++A DP  +L E+ RV+  
Sbjct: 70  I----------QNPLHNVIADGYELPFLEKSFDAVILAHQLDYASDPHRLLREVDRVMMD 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N              ++    SG+ ++  ++   L   N+ +    R   F
Sbjct: 120 DGYLVITGFNPVSFTGLASLMPWRKNNLPWSGRMFTTNRIKDWLGVLNYQVVHCDRYALF 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           P    + +   W+  E     +      +Y I ARK  Y   PI    + K   SP+ V
Sbjct: 180 PMKKYRTM---WTWLENSLGDWASPAGSLYFIVARKRTYPLKPIKPHWQLKRRLSPLGV 235


>gi|126174221|ref|YP_001050370.1| type 11 methyltransferase [Shewanella baltica OS155]
 gi|153000537|ref|YP_001366218.1| type 11 methyltransferase [Shewanella baltica OS185]
 gi|160875174|ref|YP_001554490.1| type 11 methyltransferase [Shewanella baltica OS195]
 gi|217973497|ref|YP_002358248.1| type 11 methyltransferase [Shewanella baltica OS223]
 gi|125997426|gb|ABN61501.1| Methyltransferase type 11 [Shewanella baltica OS155]
 gi|151365155|gb|ABS08155.1| Methyltransferase type 11 [Shewanella baltica OS185]
 gi|160860696|gb|ABX49230.1| Methyltransferase type 11 [Shewanella baltica OS195]
 gi|217498632|gb|ACK46825.1| Methyltransferase type 11 [Shewanella baltica OS223]
 gi|315267368|gb|ADT94221.1| Methyltransferase type 11 [Shewanella baltica OS678]
          Length = 245

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 92/240 (38%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G+    A++K L   W  V G  LL LG      S     V    +  P+  
Sbjct: 11  EQWSDLPNGEALQQAVAKQLEDWWPRVFGYHLLKLGPLSAELSSMASPVAHHFSLSPS-- 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++      +LPL ++++D V+M   LEF  DP+ +L E  RVL +GG +
Sbjct: 69  ---------KGASIEGDFCHLPLQNAAIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYL 119

Query: 129 IVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N          W + +     +G+ +   ++   L    + +    R ++ P   
Sbjct: 120 FIVGFNPLSPVFLGKLWPKYQDCLPWNGRFFMPSRVRDWLGLLGYQVVGDERLVYHPLMG 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                     F++    + P    +Y+I ARK+     PI + +K   ++    P    +
Sbjct: 180 DF---NQGKFFQQSLASWLPSAGSLYLIVARKLESPLTPIRDKRKVRQTNWTTAPTAGRS 236


>gi|262276482|ref|ZP_06054291.1| SAM-dependent methyltransferase [Grimontia hollisae CIP 101886]
 gi|262220290|gb|EEY71606.1| SAM-dependent methyltransferase [Grimontia hollisae CIP 101886]
          Length = 262

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 79/233 (33%), Gaps = 20/233 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+     I   L      + G  +L LG         H  ++  +       
Sbjct: 34  YTWDQFAHGEWVCTHIQTRLDEWLPRLFGYHMLKLGGLSCELVTGHCNIQHQVCID---- 89

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                              +LP  D + D  ++ + L++ +DP  +L EI RV+   G +
Sbjct: 90  ------KLNPLRNMEADNYDLPFVDKAFDVCVLANQLDYTDDPHRLLREIDRVMIDDGYL 143

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          ++    +G+ ++  ++   L   N+ +  TS     P T 
Sbjct: 144 ILSGVNPSSLMGIGRLIPWRKNKLPWNGRMFTPLRIRDWLSLLNYEIVDTSCFGLLPATR 203

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPI 234
            +        FE   +   P    +Y I ARK  Y   PI    K K   SP+
Sbjct: 204 HRT---CGVWFENACSELLPVIGSLYFIVARKRTYPLKPIKPKWKLKKQLSPV 253


>gi|224824458|ref|ZP_03697565.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
 gi|224602951|gb|EEG09127.1| conserved hypothetical protein [Lutiella nitroferrum 2002]
          Length = 246

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/228 (21%), Positives = 79/228 (34%), Gaps = 17/228 (7%)

Query: 14  SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNW 73
           S LG+            T  D  G R + +G     F   +    +  A           
Sbjct: 12  SELGQYLLTREQAFYDRTVADAFGFRAVQVGLPQLDFLAANRIPWKCRAG---------- 61

Query: 74  PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
             Q   +        LP    S+D V++ H L+F+  P  +L E  RVL   GR+++   
Sbjct: 62  --QEPGADVRCLPEQLPFESRSLDLVVLPHILDFSIHPHQVLREAERVLMPEGRVVLTGF 119

Query: 134 NKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           N   +W              + Q  S  ++   L   +      S   + PP  +   L+
Sbjct: 120 NPVSLWGVRRLIEGRQQVPWNAQFLSLVRIKDWLTLLDLEPEGGSFMGYCPPFARADWLE 179

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
            +   EK G+ + P  AG+Y I+A K       I    K   ++  L 
Sbjct: 180 RFRFMEKAGDRWWPLAAGVYGIQAIKRQRGMRLIMPQWKPAKAAKGLA 227


>gi|37680715|ref|NP_935324.1| SAM-dependent methyltransferase [Vibrio vulnificus YJ016]
 gi|37199464|dbj|BAC95295.1| SAM-dependent methyltransferase [Vibrio vulnificus YJ016]
          Length = 255

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+   ++I   L      + G  LL LG      +     ++  +   
Sbjct: 10  IQHPYTWEEMNNGQWVRESIQTRLDEWCPKLFGYHLLKLGGLSCELTSAICNIQHQVNLD 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                      Q      +     LP  + S D V++ H L++A DP  +L E+ RV+  
Sbjct: 70  I----------QNPLHNVIADGYELPFLEKSFDAVILAHQLDYASDPHRLLREVDRVMMD 119

Query: 125 GGRMIVVVPNK------RGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N         +     +    SG+ ++  ++   L   N+ +    R   F
Sbjct: 120 DGYLVITGFNPVSLTGLASLMPWRRNNLPWSGRMFTTNRIKDWLGVLNYQVVHCDRYALF 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           P    + +   W+  E     +      +Y I ARK  Y   PI    + K   SP+ V
Sbjct: 180 PMKKYRTM---WTWLENSLGDWASPAGSLYFIVARKRTYPLKPIKPHWQLKRRLSPLGV 235


>gi|229519250|ref|ZP_04408693.1| SAM-dependent methyltransferase [Vibrio cholerae RC9]
 gi|229343939|gb|EEO08914.1| SAM-dependent methyltransferase [Vibrio cholerae RC9]
          Length = 245

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 85/235 (36%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK  Y   PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPFGSLYFIVARKRTYPLKPIRSKWRLKRRLSPIGV 235


>gi|90581656|ref|ZP_01237445.1| hypothetical SAM-dependent methyltransferase [Vibrio angustum S14]
 gi|90437140|gb|EAS62342.1| hypothetical SAM-dependent methyltransferase [Vibrio angustum S14]
          Length = 256

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 74/228 (32%), Gaps = 19/228 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + +   G+     +   +      + G  +L LG      +  H  ++  ++      
Sbjct: 14  YSWSNVTNGEWAAQLLQARIDEWCPKLFGYHMLKLGGLSAELTSHHCNIQHQISVD---- 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                               LP  + S D  L++H L+++ DP  +L E+ RV    G +
Sbjct: 70  ------KFSSYRNVEAESFELPFVEKSFDACLLIHQLDYSTDPHRLLREVDRVTVDDGYL 123

Query: 129 IVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +                +G+ Y   ++I  LR  N+ +         P T 
Sbjct: 124 LLSGNNPLSVNGFCGLLPWNRKKAPWNGRMYLSSRVIDWLRLLNYEVIYHETFAVLPSTR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
               L   +  E I +        +Y I ARK  +   PI    K   
Sbjct: 184 H---LTCSAWLENILSEPLSMVGSLYFIVARKRTFPLRPIKPKWKVRR 228


>gi|156975481|ref|YP_001446388.1| hypothetical protein VIBHAR_03212 [Vibrio harveyi ATCC BAA-1116]
 gi|156527075|gb|ABU72161.1| hypothetical protein VIBHAR_03212 [Vibrio harveyi ATCC BAA-1116]
          Length = 251

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 81/227 (35%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +     ++  +              Q
Sbjct: 22  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCSCNIQHQVNVDI----------Q 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 72  NPLHNVIADGYELPFLEKSFDVVVLAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPI 131

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
                        +    SG+ ++  ++   L   N+ +    R   FP T  K +   W
Sbjct: 132 SFTGLASLLPWRRNNLPWSGRMFTANRIKDWLGVLNYQVIHCDRYALFPMTRYKTM---W 188

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 189 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKRKLTPLGV 235


>gi|169831614|ref|YP_001717596.1| type 11 methyltransferase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638458|gb|ACA59964.1| Methyltransferase type 11 [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 265

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/221 (20%), Positives = 76/221 (34%), Gaps = 13/221 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAF 63
             +   +Y + LG+        +         G R L  G      S    +        
Sbjct: 8   AEDYDAWYETPLGRKVDQLEMCLFMRLAAPKPGERALDGGCGTGRLSLALAEKGLVVTGV 67

Query: 64  MPAGQGATNWPDQYFSST----ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
             + +      ++  S            NLP    S D V     LEF  +P   + E+W
Sbjct: 68  DLSPRMLEVARNRTRSHANITLMQADVENLPFPSLSFDLVTAFTVLEFTGNPEAAVRELW 127

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFT-LSI 171
           R++  GGR++V V N    WA           + F   Q +S + M ++L         +
Sbjct: 128 RLVKPGGRLVVGVLNSWSPWAWQRRRRAGTGESVFAHAQFFSPWSMKAVLTANTSQSRLV 187

Query: 172 TSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEA 212
            S  +FFPP      + + +  ++I   F   F  + V+ A
Sbjct: 188 WSTCVFFPPWTGSLSINMAATLDRIARPFLKPFGALIVMRA 228


>gi|269960615|ref|ZP_06174987.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834692|gb|EEZ88779.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 251

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 82/227 (36%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +     ++  +              Q
Sbjct: 22  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCSCNIQHQVNVDI----------Q 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 72  NPLHNVIADGYELPFLEKSFDVVVLAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPI 131

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            +           +    SG+ ++  ++   L   N+ +    R   FP T  K +   W
Sbjct: 132 SLTGLASLLPWRRNNLPWSGRMFTVNRIKDWLGVLNYQVIHCDRYALFPMTRYKTM---W 188

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 189 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKRKLTPLGV 235


>gi|149908876|ref|ZP_01897536.1| methyltransferase [Moritella sp. PE36]
 gi|149808150|gb|EDM68091.1| methyltransferase [Moritella sp. PE36]
          Length = 227

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/232 (20%), Positives = 85/232 (36%), Gaps = 19/232 (8%)

Query: 16  LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPD 75
           +G+     I   L      + G  LL LG      +CF   ++  +              
Sbjct: 1   MGEWLASQIQARLDAWCPTIFGYHLLKLGSLSGELNCFGCSIQHQVT----------ATS 50

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +       +   +LP  ++ +D  ++   L+F+ DP  +L E+ RVLT  G +I+   N 
Sbjct: 51  ELGMGGIFIDPAHLPFQENCIDACILTQSLDFSADPHQVLREVERVLTGDGYLILSGYNP 110

Query: 136 RGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
             +           + P  SG+ ++  ++   L    F +    R  F     KK +   
Sbjct: 111 LSLCGLVKLCGIKRNHPPWSGRMFTPARIKDWLELLGFEIIQDDRFGFTSFLGKKPLTW- 169

Query: 190 WSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
               E IG +  P F+ +Y I ARK      P+    +   +    +P   +
Sbjct: 170 --WSESIGQMHFPSFSSVYFIVARKRRAPISPVKNWWQVSYAKRRFIPTGAT 219


>gi|89075027|ref|ZP_01161472.1| hypothetical SAM-dependent methyltransferase [Photobacterium sp.
           SKA34]
 gi|89049266|gb|EAR54830.1| hypothetical SAM-dependent methyltransferase [Photobacterium sp.
           SKA34]
          Length = 254

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 75/228 (32%), Gaps = 19/228 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + +   G+     +   +      + G  +L LG      +  H  ++  ++      
Sbjct: 14  YSWSNVTNGEWAAQLLQARIDEWCPKLFGYHMLKLGGLSAELTSHHCNIQHQISVD---- 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                               LP  + S D  L++H L+++ DP  +L E+ RV    G +
Sbjct: 70  ------KFSSYRNVEAESFELPFVEKSFDACLLIHQLDYSTDPHRLLREVDRVTVDDGYL 123

Query: 129 IVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +           +    +G+ Y   ++I  LR  N+ +         P T 
Sbjct: 124 LLSGNNPLSVNGFCGLLPWNRNKAPWNGRMYLSSRVIDWLRLLNYEVIYHETFAVLPSTR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
               L   +  E I +        +Y I ARK  +   PI    K   
Sbjct: 184 H---LTCSAWLENILSEPLSVVGSLYFIVARKRTFPLRPIKPKWKVRR 228


>gi|330993946|ref|ZP_08317876.1| ATP synthase subunit [Gluconacetobacter sp. SXCC-1]
 gi|329758892|gb|EGG75406.1| ATP synthase subunit [Gluconacetobacter sp. SXCC-1]
          Length = 250

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 109/243 (44%), Gaps = 11/243 (4%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             FY++  G+     + + ++  W + T  R LGLGYA+PF   +  +     +      
Sbjct: 5   AHFYATHRGRVAARLLGQRMTAFWPEGTQGRTLGLGYALPFLPLWEREDAPCFSARLDTH 64

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             T     +     + S   LP  D   D +L++H LE +ED   +L ++W++L   GR+
Sbjct: 65  -VTRAAPPWQGRDCMASGLQLPFDDLKFDRILLIHALEVSEDKNSLLRQVWKILRDDGRL 123

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           ++VVPN+ G+WA  +++PFG G P+S  Q+   L +A F       +L+ PP    C   
Sbjct: 124 LLVVPNRAGLWAHADNSPFGQGTPFSRRQISRWLADACFRAERHEDALYIPP-AGPCPTA 182

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK---------KKHISSPILVPHT 239
              + E  G    P   G+ +IEA K +Y G+P   +             + S  L    
Sbjct: 183 PVGMVEWTGRNLFPRLGGVCLIEAVKDIYAGVPSRPAVVVPGGLRLGAARVFSRSLTRRP 242

Query: 240 VST 242
             T
Sbjct: 243 PPT 245


>gi|91223498|ref|ZP_01258763.1| putative SAM-dependent methyltransferase [Vibrio alginolyticus
           12G01]
 gi|91191584|gb|EAS77848.1| putative SAM-dependent methyltransferase [Vibrio alginolyticus
           12G01]
          Length = 248

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 83/227 (36%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +  +  ++  +              Q
Sbjct: 22  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCNCNIQHQVNVDI----------Q 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  D S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 72  NPLHNVIADGYELPFLDKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYVIITGFNPL 131

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            +          +H    SG+ ++  ++   L   N+ +    R   FP    + +   W
Sbjct: 132 SLTGLASLLPWRKHNLPWSGRMFTSNRIKDWLGLLNYQVIHCDRYALFPMKRYRTM---W 188

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 189 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKKKLTPLGV 235


>gi|312883831|ref|ZP_07743550.1| SAM-dependent methyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368580|gb|EFP96113.1| SAM-dependent methyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 249

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 84/234 (35%), Gaps = 22/234 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  LL LG      + ++  ++  +       
Sbjct: 14  HSWEQLRNGQWVSESIQIRLDEWCPRLFGYHLLKLGGLSCELTSYNCNIQHQVHLD---- 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q   S  +    +LP  + S D VL+ H L++  DP  ML E+ RV+   G +
Sbjct: 70  ------TQNPLSNVIADGYDLPFLEKSFDAVLVAHQLDYCNDPHRMLREVDRVVIDDGYL 123

Query: 129 IVVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSIT-SRSLFFPPT 181
           I+   N              +     SG+ ++  +M   L   N+ +    S ++F  P 
Sbjct: 124 IITGFNPLSLIGLTRFMPWKKKYLPWSGRMFTPNRMKDWLGLLNYQILECDSYAVFSSPK 183

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPI 234
                       E     +   F  +Y I ARK  Y   PI    K K   SP+
Sbjct: 184 SNLL----SVWLENSLGEWASPFGSLYFIVARKRTYPLKPIKPHWKLKRKLSPL 233


>gi|113970497|ref|YP_734290.1| type 11 methyltransferase [Shewanella sp. MR-4]
 gi|113885181|gb|ABI39233.1| Methyltransferase type 11 [Shewanella sp. MR-4]
          Length = 244

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 51/250 (20%), Positives = 91/250 (36%), Gaps = 22/250 (8%)

Query: 1   MRVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M  +  + +  Q+     G     A++  L+  W  V G  LL LG      S     V 
Sbjct: 1   MSYNSTVRKPEQWEDLPNGPALQQAVADKLADWWPRVFGYHLLKLGPLSAELSSMASPVA 60

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
              +                +++ +    +LPL +  +D VLM   LEF  DP+ +L E 
Sbjct: 61  HHFSLC-----------SEPNASLIGDFCHLPLQNGVIDAVLMSLLLEFEADPYRILRET 109

Query: 119 WRVLTSGGRMIVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSIT 172
            RVL +GG + +V  N          W + +      G+ +   ++   L    + +   
Sbjct: 110 DRVLIAGGYLFIVGFNPLSPVFLGKLWPKYQDNLPWCGRFFMPSRVRDWLGLLGYQVVSD 169

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            R ++ P   +          ++    + P    +Y+I ARK+     PI + +K    +
Sbjct: 170 ERLVYHPLIGEF---NEGRFMQQTLASWLPSAGSLYLIVARKLESPLTPIRDKRKVLQPN 226

Query: 233 PILVPHTVST 242
               P    T
Sbjct: 227 WSTAPSAGRT 236


>gi|90021667|ref|YP_527494.1| generic methyl-transferase [Saccharophagus degradans 2-40]
 gi|89951267|gb|ABD81282.1| Methyltransferase type 11 [Saccharophagus degradans 2-40]
          Length = 294

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 84/243 (34%), Gaps = 14/243 (5%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           +L +++    G    DA  + +        G  L+ L            ++    +  P 
Sbjct: 31  DLHEWFKGPYGVALLDAQKQTIEHELGGYFGYHLMQLSVLPEHKFYDSSRINHRFSLSPL 90

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                   +   ++ A     +LPL D  +D  ++ H L+FA +P  +L E  RV    G
Sbjct: 91  ------ANEHAENAQACADMESLPLPDECIDVCILHHTLDFAANPQQVLKEAARVTVPRG 144

Query: 127 RMIVVVPNKRGMWARME-------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
            +I++  N   +   ++        TP    Q     ++   L   +F+        +  
Sbjct: 145 YIILMGFNPTSVSGCIKPFAHFAGKTPIWKRQSLRVRRLKDWLAFLDFSTLDVKYGAYSV 204

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI-LVPH 238
           P + +  L+   + E+          G Y I ARK      PI  +  K     + +VP 
Sbjct: 205 PINNEKYLRNTRLIERSFAKTNLPLGGTYCIFARKDKVGLTPIKPAWDKTTKGLMDVVPL 264

Query: 239 TVS 241
              
Sbjct: 265 PKR 267


>gi|304408608|ref|ZP_07390229.1| Methyltransferase type 11 [Shewanella baltica OS183]
 gi|307305436|ref|ZP_07585184.1| Methyltransferase type 11 [Shewanella baltica BA175]
 gi|304352429|gb|EFM16826.1| Methyltransferase type 11 [Shewanella baltica OS183]
 gi|306911739|gb|EFN42164.1| Methyltransferase type 11 [Shewanella baltica BA175]
          Length = 245

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 91/240 (37%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G+    A++K L   W  V G  LL LG      S     V    +      
Sbjct: 11  EQWSDLPNGEALQQAVAKQLEDWWPRVFGYHLLKLGPLSAELSSMASPVAHHFSL----- 65

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +   ++      +LPL ++++D V+M   LEF  DP+ +L E  RVL +GG +
Sbjct: 66  ------SRSKGASIEGDFCHLPLQNAAIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYL 119

Query: 129 IVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N          W + +     +G+ +   ++   L    + +    R ++ P   
Sbjct: 120 FIVGFNPLSPVFLGKLWPKYQDCLPWNGRFFMPSRVRDWLGLLGYQVVGDERLVYHPLMG 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                     F++    + P    +Y+I ARK+     PI + +K   ++    P    +
Sbjct: 180 DF---NQGKFFQQSLASWLPSAGSLYLIVARKLESPLTPIRDKRKVRQTNWTTAPTAGRS 236


>gi|28899068|ref|NP_798673.1| putative SAM-dependent methyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260366044|ref|ZP_05778516.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus K5030]
 gi|260876850|ref|ZP_05889205.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260897331|ref|ZP_05905827.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|260899807|ref|ZP_05908202.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|28807292|dbj|BAC60557.1| putative SAM-dependent methyltransferase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308088290|gb|EFO37985.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308091496|gb|EFO41191.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308107379|gb|EFO44919.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|308115292|gb|EFO52832.1| SAM-dependent methyltransferase [Vibrio parahaemolyticus K5030]
 gi|328474395|gb|EGF45200.1| putative SAM-dependent methyltransferase [Vibrio parahaemolyticus
           10329]
          Length = 251

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 83/227 (36%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +  +  ++  +              Q
Sbjct: 22  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCNCNIQHQVNVDI----------Q 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 72  NPLHNVIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGCLIITGFNPI 131

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
                       ++    SG+ ++  ++   L   N+ +    R   FP T  + +   W
Sbjct: 132 SFTGLASLFPWRKNNLPWSGRMFTSSRINDWLGLLNYQVIHCDRYALFPMTRYRTM---W 188

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 189 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKKKLTPLGV 235


>gi|114047732|ref|YP_738282.1| type 11 methyltransferase [Shewanella sp. MR-7]
 gi|113889174|gb|ABI43225.1| Methyltransferase type 11 [Shewanella sp. MR-7]
          Length = 240

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 51/250 (20%), Positives = 91/250 (36%), Gaps = 22/250 (8%)

Query: 1   MRVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M  +  + +  Q+     G     A++  L+  W  V G  LL LG      S     V 
Sbjct: 1   MSYNSTVRKPEQWEDLPNGPALQQAVADKLADWWPRVFGYHLLKLGPLSAELSSMASPVA 60

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
              +                +++ +    +LPL +  +D VLM   LEF  DP+ +L E 
Sbjct: 61  HHFSLC-----------SEPNASLIGDFCHLPLQNGVIDAVLMSLLLEFEADPYRILRET 109

Query: 119 WRVLTSGGRMIVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSIT 172
            RVL +GG + +V  N          W + +      G+ +   ++   L    + +   
Sbjct: 110 DRVLIAGGYLFIVGFNPLSPVFLGKLWPKYQDNLPWCGRFFMPSRVRDWLGLLGYQVVSD 169

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            R ++ P   +          ++    + P    +Y+I ARK+     PI + +K    +
Sbjct: 170 ERLVYHPLIGEF---NEGRFMQQTLASWLPSAGSLYLIVARKLESPLTPIRDKRKVLQPN 226

Query: 233 PILVPHTVST 242
               P    T
Sbjct: 227 WSTAPSAGRT 236


>gi|153825347|ref|ZP_01978014.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|149741031|gb|EDM55100.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
          Length = 245

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISCIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|330445180|ref|ZP_08308832.1| S-adenosyl-L-methionine-dependent methyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489371|dbj|GAA03329.1| S-adenosyl-L-methionine-dependent methyltransferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 249

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 74/228 (32%), Gaps = 19/228 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+     +   +      + G  +L LG      +  H  ++  ++      
Sbjct: 14  YSWSDVTNGEWVAQLLQARIDEWCPKLFGYHMLKLGGLSAELTSGHCNIQHQISVD---- 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                               LP  + S D  L++H L+++ DP  +L EI RV+   G +
Sbjct: 70  ------KFSTYRNVEAESFELPFIEKSFDACLLIHQLDYSSDPHRLLREIDRVMVDDGYL 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +           +    +G+ Y   +++  L   N+ +         P T 
Sbjct: 124 LLSGNNPLSINGICGLLPWNRNKAPWNGRMYLSSRVMDWLGLLNYEVIYHETFAVLPATR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
               L   +  E I +        +Y I ARK  +   PI    K   
Sbjct: 184 H---LACSAWLENILSEPLSAIGSMYFIVARKRTFPLKPIKPKWKVRR 228


>gi|229522182|ref|ZP_04411599.1| SAM-dependent methyltransferase [Vibrio cholerae TM 11079-80]
 gi|229341107|gb|EEO06112.1| SAM-dependent methyltransferase [Vibrio cholerae TM 11079-80]
          Length = 243

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENSLGGSNSPFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|146282601|ref|YP_001172754.1| SAM-dependent methyltransferase [Pseudomonas stutzeri A1501]
 gi|145570806|gb|ABP79912.1| SAM-dependent methyltransferase [Pseudomonas stutzeri A1501]
          Length = 256

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 84/243 (34%), Gaps = 18/243 (7%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG--YAIPFFSCFHGKVERTLA 62
           I +   +++  LG+       ++L+       G  L+  G     P       +  R  A
Sbjct: 17  ISQASDWFAGPLGQQLLAQEKQILTDELARCFGSYLVHNGPFAGEPVQPQNIKRSVRLGA 76

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            +P                    E   PL + + D V++ H L+F+  P  +L E  R +
Sbjct: 77  PLP-------------GVEIHCEEQAWPLGEHAADVVVLQHALDFSLSPHGLLREAARGV 123

Query: 123 TSGGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
             GG +++V  N    W          F   +     ++   L    F L       + P
Sbjct: 124 RPGGHLLIVGINPWSAWGLRHLVSREGFRQARCIRPSRVGDWLNLLGFALEKRRFGCYCP 183

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           P          S  E IG        G Y++ ARK++    P+ + +++ +   + +P  
Sbjct: 184 PLSSSDWQARLSRLESIGQRLQAPTGGFYLLVARKLMIGLRPLRQERRERMGKLLPMPVA 243

Query: 240 VST 242
             +
Sbjct: 244 KIS 246


>gi|90416120|ref|ZP_01224053.1| hypothetical protein GB2207_02767 [marine gamma proteobacterium
           HTCC2207]
 gi|90332494|gb|EAS47691.1| hypothetical protein GB2207_02767 [marine gamma proteobacterium
           HTCC2207]
          Length = 291

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 80/231 (34%), Gaps = 15/231 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           +R++  +  G+       ++L      + G R+L LG +    +          +  P+ 
Sbjct: 29  IRRWLDTDFGRYVLSRERRILREKCSKLPGYRMLRLGLSEDAETLDCFDHIHRFSMHPSE 88

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
               +          +     LPL   ++D +L+ H LEF+  P  +L E  RV   GG 
Sbjct: 89  FSGDHAA--------ISDYMELPLMSETIDVMLLHHALEFSTSPKAVLAEAGRVTMPGGH 140

Query: 128 MIVVVPNKRGMWARME-------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +I+ + N  G    ++                    ++I  L   NF +     S    P
Sbjct: 141 LILCMFNPYGPMGLLKFPMQLFSKHRQYRFHNLRTGRVIDWLSLLNFHVVQIEHSAHNLP 200

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
            +     +  S +E+           +Y+I A K + +G        K  +
Sbjct: 201 LNSPAFNEDESRWERACKKIRFPLGNVYMIHAVKRVPRGTKTASPLWKRAT 251


>gi|15642233|ref|NP_231866.1| hypothetical protein VC2235 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121586231|ref|ZP_01676021.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121726546|ref|ZP_01679795.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147673588|ref|YP_001217751.1| hypothetical protein VC0395_A1827 [Vibrio cholerae O395]
 gi|153817094|ref|ZP_01969761.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153820871|ref|ZP_01973538.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227082359|ref|YP_002810910.1| hypothetical protein VCM66_2158 [Vibrio cholerae M66-2]
 gi|229507690|ref|ZP_04397195.1| SAM-dependent methyltransferase [Vibrio cholerae BX 330286]
 gi|229512115|ref|ZP_04401594.1| SAM-dependent methyltransferase [Vibrio cholerae B33]
 gi|229607194|ref|YP_002877842.1| SAM-dependent methyltransferase [Vibrio cholerae MJ-1236]
 gi|254849366|ref|ZP_05238716.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255747067|ref|ZP_05421012.1| SAM-dependent methyltransferase [Vibrio cholera CIRS 101]
 gi|262161388|ref|ZP_06030498.1| SAM-dependent methyltransferase [Vibrio cholerae INDRE 91/1]
 gi|262167742|ref|ZP_06035444.1| SAM-dependent methyltransferase [Vibrio cholerae RC27]
 gi|297580877|ref|ZP_06942802.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298500390|ref|ZP_07010195.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656794|gb|AAF95379.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549497|gb|EAX59523.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121630999|gb|EAX63378.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|126512362|gb|EAZ74956.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126521663|gb|EAZ78886.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146315471|gb|ABQ20010.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227010247|gb|ACP06459.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014131|gb|ACP10341.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229352080|gb|EEO17021.1| SAM-dependent methyltransferase [Vibrio cholerae B33]
 gi|229355195|gb|EEO20116.1| SAM-dependent methyltransferase [Vibrio cholerae BX 330286]
 gi|229369849|gb|ACQ60272.1| SAM-dependent methyltransferase [Vibrio cholerae MJ-1236]
 gi|254845071|gb|EET23485.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255735469|gb|EET90869.1| SAM-dependent methyltransferase [Vibrio cholera CIRS 101]
 gi|262023807|gb|EEY42506.1| SAM-dependent methyltransferase [Vibrio cholerae RC27]
 gi|262028699|gb|EEY47353.1| SAM-dependent methyltransferase [Vibrio cholerae INDRE 91/1]
 gi|297534703|gb|EFH73539.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297541083|gb|EFH77137.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 245

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|153213815|ref|ZP_01949023.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|229513878|ref|ZP_04403340.1| SAM-dependent methyltransferase [Vibrio cholerae TMA 21]
 gi|229528761|ref|ZP_04418151.1| SAM-dependent methyltransferase [Vibrio cholerae 12129(1)]
 gi|254225774|ref|ZP_04919379.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|262192142|ref|ZP_06050303.1| SAM-dependent methyltransferase [Vibrio cholerae CT 5369-93]
 gi|124115739|gb|EAY34559.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|125621680|gb|EAZ50009.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|229332535|gb|EEN98021.1| SAM-dependent methyltransferase [Vibrio cholerae 12129(1)]
 gi|229349059|gb|EEO14016.1| SAM-dependent methyltransferase [Vibrio cholerae TMA 21]
 gi|262031991|gb|EEY50568.1| SAM-dependent methyltransferase [Vibrio cholerae CT 5369-93]
 gi|327484753|gb|AEA79160.1| SAM-dependent methyltransferase [Vibrio cholerae LMA3894-4]
          Length = 243

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|262393544|ref|YP_003285398.1| SAM-dependent methyltransferase [Vibrio sp. Ex25]
 gi|262337138|gb|ACY50933.1| SAM-dependent methyltransferase [Vibrio sp. Ex25]
          Length = 248

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 83/227 (36%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +  +  ++  +              Q
Sbjct: 22  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCNCNIQHQVNVDI----------Q 71

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 72  NPLHNVIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPL 131

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            +          +H    SG+ ++  ++   L   N+ +    R   FP    + +   W
Sbjct: 132 SLTGLASLLPWRKHNLPWSGRMFTSNRINDWLGLLNYQVIHCDRYALFPMKRYRTM---W 188

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 189 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKKKLTPLGV 235


>gi|153829946|ref|ZP_01982613.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|183179465|ref|ZP_02957676.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|148874581|gb|EDL72716.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|183012876|gb|EDT88176.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYV 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|304311303|ref|YP_003810901.1| hypothetical protein HDN1F_16660 [gamma proteobacterium HdN1]
 gi|301797036|emb|CBL45249.1| Hypothetical protein HDN1F_16660 [gamma proteobacterium HdN1]
          Length = 296

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 84/256 (32%), Gaps = 24/256 (9%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAI-PFFSCFHGKVERTLAFM 64
            ++ Q++ +  G+    A   +      ++ G  ++ LG               +     
Sbjct: 20  EQVAQWFRTPAGQSLLTAEESLCEQVVAEMFGYHIVQLGVGARGNLCKGSSIRHQVHVVE 79

Query: 65  --------PAGQGATNWPDQYFSST---------ALVSEGNLPLADSSVDCVLMVHYLEF 107
                    A Q A N                   + S   L +A+ SVD V++ H L+F
Sbjct: 80  KACASTDLAAAQFAENASSACNPPFGETRPPLSILVSSLEELAIANDSVDVVILHHCLDF 139

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP------FGSGQPYSWYQMISL 161
              P  +L E+ RV+  GG++++V  N   +W                G   S Y++   
Sbjct: 140 TLQPQRILREVSRVVIPGGKIVIVGFNPWSLWGIWRMMRSHLAEVPWCGSFLSPYRVSDW 199

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           L   +  +     + F  P  +   +         G  +       YV+ A K + +  P
Sbjct: 200 LGVLDLHVEGYESTHFGLPVGENRWVGFNRWMGYFGTRWWRHVGASYVMVATKQVSRITP 259

Query: 222 ITESKKKHISSPILVP 237
           +         S + +P
Sbjct: 260 VRPPIPAVKPSLVAIP 275


>gi|269966275|ref|ZP_06180364.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269829190|gb|EEZ83435.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 267

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 83/227 (36%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +  +  ++  +              Q
Sbjct: 41  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCNCNIQHQVNVDI----------Q 90

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 91  NPLHNVIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYVIITGFNPL 150

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            +          +H    SG+ ++  ++   L   N+ +    R   FP    + +   W
Sbjct: 151 SLTGLASLLPWRKHNLPWSGRMFTSNRIKDWLGLLNYQVIHCDRYALFPMKRYRTM---W 207

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 208 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKKKLTPLGV 254


>gi|261211355|ref|ZP_05925643.1| SAM-dependent methyltransferase [Vibrio sp. RC341]
 gi|260839310|gb|EEX65936.1| SAM-dependent methyltransferase [Vibrio sp. RC341]
          Length = 245

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 83/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWSQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDL--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------KNPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYV 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +        FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLGVLNYQVIACDHYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SP+ V
Sbjct: 184 YRP---FWTWLENGLGESSTAFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGV 235


>gi|152995729|ref|YP_001340564.1| SAM-dependent methyltransferase [Marinomonas sp. MWYL1]
 gi|150836653|gb|ABR70629.1| SAM-dependent methyltransferase [Marinomonas sp. MWYL1]
          Length = 246

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 79/241 (32%), Gaps = 16/241 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
            + +Y S LG          +++  D   G  L+      P             + + A 
Sbjct: 10  FQNWYKSNLGDSLLQLELSEIASELDSAVGYYLV---SQSPLRDFALKNHRLRESILIAP 66

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                 P      T +     LP     VD  +  H L+ +  P   L E  R L   G+
Sbjct: 67  VLEFGAPSN----TIVARASELPFEADGVDVHVFHHTLDISATPHDDLREAARTLLPSGK 122

Query: 128 MIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++++  N   +W               G   +  ++   L+ A  TL       + PP  
Sbjct: 123 LVIIGFNPWSLWGCRRLFSKKIKAPWCGHFIAHQRLEDWLKVAGLTLESKRFVFYEPPLQ 182

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILVPHTVS 241
                  ++  +KI       F+G+YV+ A K + + +P+        +  P   P +  
Sbjct: 183 SSKWRSRFAWIDKILRPLKLPFSGVYVMTATKQVRRFIPLKPRWSGARVRVP---PLSKP 239

Query: 242 T 242
           T
Sbjct: 240 T 240


>gi|332529404|ref|ZP_08405365.1| hypothetical protein HGR_05821 [Hylemonella gracilis ATCC 19624]
 gi|332041202|gb|EGI77567.1| hypothetical protein HGR_05821 [Hylemonella gracilis ATCC 19624]
          Length = 289

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/246 (16%), Positives = 73/246 (29%), Gaps = 28/246 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           + +  +  G        +       D+ G   L LG   P                  G 
Sbjct: 2   QSWCETPAGSYLLAWEREQYERAVADIFGYHALQLGL--PALDSLSANRMPHRWLAHCGT 59

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           G+          T       LP ++ S+D V + H L+   DP  +L E+ RVL   G++
Sbjct: 60  GSLTADATPRPITLHTDYAALPFSEGSLDLVTLPHTLDLHPDPHAVLREVARVLAPNGKV 119

Query: 129 IVVVPNKRGMWARMEHTPFGSGQ-----------------------PYSWYQMISLLREA 165
           ++   N   +W   +       +                         S +++   LR  
Sbjct: 120 LISGFNPMSLWGWRQRRETWWARTTREAGWHWLAQRCQPVLPADLEFISPWRLRDWLRLL 179

Query: 166 NFTLSIT---SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           N  +         L+ P       L  W   +  G  + P    +Y + A K +     +
Sbjct: 180 NLEVEAGGGDRYGLWRPLLRSASWLHRWRWLDSAGGRWWPVLGAVYFVVAVKRVQGVRLL 239

Query: 223 TESKKK 228
               ++
Sbjct: 240 EPRWRR 245


>gi|226945029|ref|YP_002800102.1| hypothetical protein Avin_29610 [Azotobacter vinelandii DJ]
 gi|226719956|gb|ACO79127.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 254

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/241 (17%), Positives = 86/241 (35%), Gaps = 15/241 (6%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           + + R+++++ LG+       ++L        G  L+  G    F      +        
Sbjct: 17  VRDAREWFATPLGQQMLQEERRLLKEELARFFGGYLVHYGPPGDFEGTAQIRCC------ 70

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                             +  E   PLA+ + D V++ H L+F+  P  +L E  R +  
Sbjct: 71  ------VRLGAPLPGVQIVCEEQAWPLAEHAADVVVLQHALDFSLSPHALLREAARSVRP 124

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG ++VV  N R +W              +     ++   L    F L       + PP 
Sbjct: 125 GGHLLVVGINPRSLWGLRRLFASDALRQARCIGSSRVGDWLSLLGFALEKRRFGCYRPPL 184

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
             +      +  E  G  +     G Y++  RK++    P+ +++++ I   + +P    
Sbjct: 185 SSRAWQSRTARLESWGESWQMPGGGFYLLVVRKLVVGLRPLPQTRREPIGKLLPLPVVKV 244

Query: 242 T 242
           +
Sbjct: 245 S 245


>gi|163801802|ref|ZP_02195699.1| hypothetical protein 1103602000600_AND4_15180 [Vibrio sp. AND4]
 gi|159174310|gb|EDP59114.1| hypothetical protein AND4_15180 [Vibrio sp. AND4]
          Length = 251

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 84/233 (36%), Gaps = 20/233 (8%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    ++I          + G  +L LG      +  +G ++  +         
Sbjct: 16  WSELNNGPWVLESIQTRFDEWCPRLFGYHMLKLGGLSCELTSCNGNIQHQVNVDI----- 70

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                Q      +     LP  + S D  ++ H L++A DP  +L E+ RV+   G +I+
Sbjct: 71  -----QNPLHNVVADGYELPFLEKSFDVAVLAHQLDYASDPHRLLREVDRVMMDDGYIII 125

Query: 131 VVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +           +    SG+ ++ +++   L   N+ +    R   FP T  K
Sbjct: 126 TGFNPISVTGLASLLPWRRNILPWSGRMFTTHRIKDWLGVLNYQVVHCERYALFPMTRCK 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +L   +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 186 TML---TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRFKRKLTPMGV 235


>gi|254228410|ref|ZP_04921836.1| hypothetical protein VEx25_1492 [Vibrio sp. Ex25]
 gi|151938998|gb|EDN57830.1| hypothetical protein VEx25_1492 [Vibrio sp. Ex25]
          Length = 267

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 83/227 (36%), Gaps = 20/227 (8%)

Query: 17  GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQ 76
           G    ++I   L      + G  +L LG      +  +  ++  +              Q
Sbjct: 41  GPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCNCNIQHQVNVDI----------Q 90

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 +     LP  + S D V++ H L++A DP  +L E+ RV+   G +I+   N  
Sbjct: 91  NPLHNVIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGYLIITGFNPL 150

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            +          +H    SG+ ++  ++   L   N+ +    R   FP    + +   W
Sbjct: 151 SLTGLASLLPWRKHNLPWSGRMFTSNRINDWLGLLNYQVIHCDRYALFPMKRYRTM---W 207

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           +  E     +      +Y I ARK  Y   PI    + K   +P+ V
Sbjct: 208 TWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKKKLTPLGV 254


>gi|241765317|ref|ZP_04763295.1| Methyltransferase type 11 [Acidovorax delafieldii 2AN]
 gi|241364998|gb|EER59909.1| Methyltransferase type 11 [Acidovorax delafieldii 2AN]
          Length = 288

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 87/255 (34%), Gaps = 27/255 (10%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             ++ S  G+               D+ G   L +G  +      +    + LA    G 
Sbjct: 2   HHWFDSPPGRYLLAWEQTRFDEAVVDIFGYHGLQVGIPMLDGLRANRMPHQWLALADDGL 61

Query: 69  GATN--------------WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLM 114
                              P        L     LP AD+S+D +L+ H LE + DP   
Sbjct: 62  ALLRGDGAAPPPASADAEAPAALRRLALLAEPVALPFADNSLDLILLPHTLELSVDPHAA 121

Query: 115 LHEIWRVLTSGGRMIVVVPNKRGMWARMEHT-----PFGSGQPY--------SWYQMISL 161
           L E+ RVL   GR+++   N   +WA  +H        G G+PY         + ++   
Sbjct: 122 LREVERVLVPEGRVVISGLNATSLWALRQHRARLYQRMGRGRPYLPEVNELIGYRRLRDW 181

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP 221
           LR  +F +       + P       L+ ++  +++G  + P     Y + A K ++    
Sbjct: 182 LRLLSFEVESARFGCYRPAVRSSHWLERFAWMDRLGEHWWPILGAAYFLVAVKRVHGMRL 241

Query: 222 ITESKKKHISSPILV 236
           +  + +         
Sbjct: 242 LEPAWRSAPQRAAAS 256


>gi|118594821|ref|ZP_01552168.1| generic methyl-transferase [Methylophilales bacterium HTCC2181]
 gi|118440599|gb|EAV47226.1| generic methyl-transferase [Methylophilales bacterium HTCC2181]
          Length = 226

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 78/223 (34%), Gaps = 20/223 (8%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           ++ +  G+   +A   +LS   +D  G   L              K  R           
Sbjct: 3   WFDTKNGQRLLNAEEAILSDFLEDKFGYFSLQ----THTLGRNLLKQTR---------MN 49

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            +   +      + S  +LP    S+D ++  H+LE   +      E +RV+  GGR+++
Sbjct: 50  HHIMMEGPDRNIVCSSMHLPFEKDSIDLIISQHHLEKIGNIQAHFSEFFRVIIPGGRVVI 109

Query: 131 VVPNKRGMWARM-----EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +  N             ++    + +  S      +L+E  FT+       + P      
Sbjct: 110 LSFNPFSFAGLRNLTCFDNFSPWNQKFISLSAAQKILKEEGFTVEEGRMVDYQPLFSDNA 169

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
                 +FE +G  + P F  +Y I ARK +    P+     K
Sbjct: 170 --SAHKLFEDVGARWLPLFGNVYFIVARKDVVGVTPLRPKWNK 210


>gi|262404571|ref|ZP_06081126.1| SAM-dependent methyltransferase [Vibrio sp. RC586]
 gi|262349603|gb|EEY98741.1| SAM-dependent methyltransferase [Vibrio sp. RC586]
          Length = 245

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 83/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HAWSQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYV 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ Y+  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMYTPNRIKDWLSVLNYQVIECDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E            +Y I ARK      PI    + K   SP+ V
Sbjct: 184 YRP---FWTWLENGIGETSSVLGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGV 235


>gi|86146865|ref|ZP_01065184.1| SAM-dependent methyltransferase [Vibrio sp. MED222]
 gi|85835317|gb|EAQ53456.1| SAM-dependent methyltransferase [Vibrio sp. MED222]
          Length = 261

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 83/241 (34%), Gaps = 20/241 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G    ++I   L      + G  +L LG      S     ++  +       
Sbjct: 14  YTWAQLHNGDWLRESIQTRLDEWCPKLFGYHMLKLGGLSSEISSCTCNIQHQVNLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    NLP  + S D V++ H L+++ DP  +L E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADGYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYI 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          +++   SG+ Y+  ++   L   N+ +        FP + 
Sbjct: 124 IITGFNPFSVTGLASLMPWRKNSLPWSGRMYTPNRIKDWLGVLNYEVIHCDTYALFPMSK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
            + +   W+  E             Y I ARK  Y   PI      K   SP+      +
Sbjct: 184 YQAM---WTWLENSLGSCASFAGSQYFIVARKRTYPLKPIKPHWHLKRRFSPVGASFRTN 240

Query: 242 T 242
           T
Sbjct: 241 T 241


>gi|117920811|ref|YP_870003.1| type 11 methyltransferase [Shewanella sp. ANA-3]
 gi|117613143|gb|ABK48597.1| Methyltransferase type 11 [Shewanella sp. ANA-3]
          Length = 244

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 87/240 (36%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G     A+S  L+  W  V G  LL LG      S     V    +      
Sbjct: 11  EQWDDLPNGPALQQAVSDKLADWWPRVFGYHLLKLGPLSADLSSMASPVAHHFSLC---- 66

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                     +++ +    +LPL +  +D VLM   LEF  DP+ +L E  RVL +GG +
Sbjct: 67  -------SEPNASLIGDFCHLPLQNGVIDAVLMSLLLEFEADPYRILRETDRVLIAGGYL 119

Query: 129 IVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N          W + +      G+ +   ++   L    + +    R ++ P   
Sbjct: 120 FIVGFNPLSPVFLGKLWPKFQDNLPWCGRFFMPSRVRDWLGLLGYQVVSDERLVYHPLIG 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +          ++    + P    +Y+I ARK+     PI + +K    +    P    T
Sbjct: 180 EF---NDGRFMQQTLASWLPSAGSLYLIVARKLESPLTPIRDKRKVLQPNWTTAPSAGRT 236


>gi|114563377|ref|YP_750890.1| methyltransferase type 11 [Shewanella frigidimarina NCIMB 400]
 gi|114334670|gb|ABI72052.1| Methyltransferase type 11 [Shewanella frigidimarina NCIMB 400]
          Length = 259

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/245 (17%), Positives = 83/245 (33%), Gaps = 25/245 (10%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+     I   L+  W  + G   L  G      +  H  + R  +        
Sbjct: 7   WQDLPFGELLQAEIEAKLAPWWPRIFGYHFLKAGALSSQLNSLHCNIARHFSVYDGSD-- 64

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                    +       +LP+  S++D VL    LEF  DP+ +L E  RVL S G + +
Sbjct: 65  ---------ANIQADPHHLPVQQSAIDAVLSCFLLEFESDPYQILREFDRVLISSGYIFI 115

Query: 131 VVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           V  N            + +     +GQ +   ++   L    + +    R ++     ++
Sbjct: 116 VGFNPISPAFIGKILPKYQTKLPWNGQFFMPSRVKDWLGLLGYKVLADERLMYHSLLGQR 175

Query: 185 CIL--------KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
            +         +   +++K    + P    +Y+I ARK+     PI +  K    +    
Sbjct: 176 GVSTPNQPSKPQQAPLWQKSIANWLPSTGSVYLIVARKMTTPLTPIKDKSKVKAPNWSTA 235

Query: 237 PHTVS 241
           P    
Sbjct: 236 PSAGR 240


>gi|327480858|gb|AEA84168.1| SAM-dependent methyltransferase [Pseudomonas stutzeri DSM 4166]
          Length = 256

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 84/243 (34%), Gaps = 18/243 (7%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG--YAIPFFSCFHGKVERTLA 62
           I +   +++  LG+       ++L+       G  L+  G     P       +  R  A
Sbjct: 17  ISQASDWFAGPLGQQLLAQEKQILTDELARCFGSYLVHNGPFAGEPVQPQNIKRSVRLGA 76

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            +P                    E   PL + + D V++ H L+F+  P  +L E  R +
Sbjct: 77  PLP-------------GVEIHCEEQAWPLGEHAADVVVLQHALDFSLSPHGLLREAARGV 123

Query: 123 TSGGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
             GG +++V  N    W          F   +     ++   L    F L       + P
Sbjct: 124 RPGGHLLIVGINPWSAWGLRHLVSREGFRQARCIRPSRVGDWLNLLGFALEKRRFGCYCP 183

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           P          S  E IG        G Y++ ARK++    P+ + +++ +   + +P  
Sbjct: 184 PLSSSDWQARLSRLESIGQQLQAPTGGFYLLVARKLMIGLRPLRQERRERMGKLLPMPVA 243

Query: 240 VST 242
             +
Sbjct: 244 KIS 246


>gi|218710294|ref|YP_002417915.1| SAM-dependent methyltransferase [Vibrio splendidus LGP32]
 gi|218323313|emb|CAV19490.1| SAM-dependent methyltransferase [Vibrio splendidus LGP32]
          Length = 262

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 83/241 (34%), Gaps = 20/241 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G    ++I   L      + G  +L LG      S     ++  +       
Sbjct: 15  YTWAQLHNGDWLRESIQTRLDEWCPKLFGYHMLKLGGLSSEISSCTCNIQHQVNLDI--- 71

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    NLP  + S D V++ H L+++ DP  +L E+ RV+   G +
Sbjct: 72  -------QNPLHNVIADGYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYI 124

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          +++   SG+ Y+  ++   L   N+ +        FP + 
Sbjct: 125 IITGFNPFSVTGLASLMPWRKNSLPWSGRMYTPNRIKDWLGVLNYEVIHCDTYALFPMSK 184

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
            + +   W+  E             Y I ARK  Y   PI      K   SP+      +
Sbjct: 185 YQAM---WTWLENSLGSCASFAGSQYFIVARKRTYPLKPIKPHWHLKRRFSPVGASFRTN 241

Query: 242 T 242
           T
Sbjct: 242 T 242


>gi|237807684|ref|YP_002892124.1| Methyltransferase type 11 [Tolumonas auensis DSM 9187]
 gi|237499945|gb|ACQ92538.1| Methyltransferase type 11 [Tolumonas auensis DSM 9187]
          Length = 251

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 81/236 (34%), Gaps = 19/236 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+    +    +G      I   L      + G  LL LG      SC    +    A  
Sbjct: 10  IITPENWSELPMGDWLAMEIQHKLDEWCPLMFGYHLLKLGTLSSQLSCAASSIRHQCAVA 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P          +  S   +     LP+   S+D  L+ H L+F+ DP  +L E+ RVLT 
Sbjct: 70  P----------EGASLGIIADVDELPIRSGSIDACLLAHLLDFSSDPHQILREVERVLTP 119

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +         +      S + +S  +++  L    F +       + 
Sbjct: 120 DGWIIISGFNPYSLVGLGRLLPNLRRRLPWSARMFSPERVLDWLHLLGFEVVHLEGFAYS 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
             T +    +     EK G   G  FA  Y++ ARK       I E+        +
Sbjct: 180 TVTRRN---RFHFWKEKTGRRCGYRFASTYMLAARKRTIPLTRIREAAWLRRPVMV 232


>gi|294141158|ref|YP_003557136.1| hypothetical protein SVI_2387 [Shewanella violacea DSS12]
 gi|293327627|dbj|BAJ02358.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 246

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 88/240 (36%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R +     G     ++ + L + W  V G  +L LG      +     + R  +      
Sbjct: 11  RSWSQLPNGAQIKASVEQELESWWPKVFGYHMLSLGPLSAELNMPGLPIGRQFSLFD--- 67

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++       LP+ +  +D V+M   LEF  DP+ +L E  RVL SGG +
Sbjct: 68  --------GDGASLRADFNALPIQNGVIDAVVMNMLLEFEHDPYKLLRETDRVLISGGYL 119

Query: 129 IVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N            + +      G+ ++  ++   L    + +    R +      
Sbjct: 120 FIVGFNPLSPAFIGKALPKYQDKLPWCGRFFTPSRVKDWLGLLGYQVVADERIIHHHLLS 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +   ++  S+++     + PG   +Y+I ARK+     PI E +K    +    P    T
Sbjct: 180 E---MRSESIWQNALKAWLPGTGSVYLIVARKLETPLTPIHERQKVRQPNWAQAPTAGRT 236


>gi|117618831|ref|YP_856104.1| methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117560238|gb|ABK37186.1| methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 244

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 81/226 (35%), Gaps = 19/226 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +  +G      I + L +    + G  LL +G      SC    +   +   P+G+ 
Sbjct: 19  SWSALPMGDWVAAEIQERLDSWCPHLFGYHLLKVGALSAELSCGCSSIRHQIGVAPSGRL 78

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                              LP+   SVD  L+ H L+F+ DP  +L E  RVLT  G +I
Sbjct: 79  L----------DLKGDPLALPVRTGSVDACLLAHCLDFSPDPHQVLREAERVLTDDGWLI 128

Query: 130 VVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           V   N             +      S + ++  ++   L+     +    R  +     +
Sbjct: 129 VSGYNPLSLVGIGHCLPFLRQHLPWSARMFTPARVTDWLQLLGCEVMFDERFGYSFMGKQ 188

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH 229
               ++    E +G  +   FA +YVI ARK  +   P+    +  
Sbjct: 189 S---RIGWWRESVGRDYCRPFASVYVIAARKRRFPLTPVRRRWRLP 231


>gi|229524238|ref|ZP_04413643.1| SAM-dependent methyltransferase [Vibrio cholerae bv. albensis
           VL426]
 gi|229337819|gb|EEO02836.1| SAM-dependent methyltransferase [Vibrio cholerae bv. albensis
           VL426]
          Length = 245

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 83/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGQWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYV 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E            +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPCGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|160900328|ref|YP_001565910.1| type 11 methyltransferase [Delftia acidovorans SPH-1]
 gi|160365912|gb|ABX37525.1| Methyltransferase type 11 [Delftia acidovorans SPH-1]
          Length = 245

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 82/220 (37%), Gaps = 10/220 (4%)

Query: 33  DDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNW--PDQYFSSTALVSEGNLP 90
            D+ G   L LG  +      +    R LA       A     P        L     LP
Sbjct: 2   ADIFGYHSLQLGMPMLQGLRANRMPHRWLALDSMQDAAPAEGVPPLEVPVALLADPAALP 61

Query: 91  LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH-----T 145
            +++S+D V+M H LE + DP  +L E  RVL   GR++V   N   +            
Sbjct: 62  FSEASLDLVVMPHTLETSPDPHAVLREAARVLMPEGRIVVCGLNPASLLGVQRRAERGVY 121

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
               G    ++++   LR   F +       + P       L+ W   +++G +  P   
Sbjct: 122 LPDVGWGVGYWRLRDWLRLLAFEIEAVQFGCYRPAVQTDRWLRRWQFMDRVGRLGWPMLG 181

Query: 206 GIYVIEARKILYQGLPITESKKKHIS---SPILVPHTVST 242
           G+Y + A K +     +  + +   +   + + V H++ T
Sbjct: 182 GVYCVVAVKRVPGARMLEPAWRGRAAVSGASVPVAHSMPT 221


>gi|84389768|ref|ZP_00991320.1| SAM-dependent methyltransferase [Vibrio splendidus 12B01]
 gi|84376869|gb|EAP93743.1| SAM-dependent methyltransferase [Vibrio splendidus 12B01]
          Length = 260

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 83/241 (34%), Gaps = 20/241 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G    ++I   L      + G  +L LG      S     ++  +       
Sbjct: 14  YTWAQLHNGDWLRESIQTRLDEWCPKLFGYHMLKLGGLSSEISSCTCNIQHQVNLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    NLP  + S D V++ H L+++ DP  +L E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADVYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYI 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          +++   SG+ Y+  ++   L   N+ +        FP + 
Sbjct: 124 IITGFNPFSITGLASLLPWRKNSLPWSGRMYTPNRIKDWLGVLNYEVIHCDTYALFPMSK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
            + +   W+  E             Y I ARK  Y   PI      K   SP+      +
Sbjct: 184 YQAM---WTWLENSLGGCASFAGSQYFIVARKRTYPLKPIKPHWHLKRRFSPVGASFRTN 240

Query: 242 T 242
           T
Sbjct: 241 T 241


>gi|110834084|ref|YP_692943.1| hypothetical protein ABO_1223 [Alcanivorax borkumensis SK2]
 gi|110647195|emb|CAL16671.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 258

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 85/239 (35%), Gaps = 16/239 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
             ++  S  G+   +    +L+       G R + +  +          +    +     
Sbjct: 22  FDEWLDSEPGQALLNDEKAMLTDWLRSQAGQRAVAVYSSGGRDLMSESPLRWQTSI---- 77

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                 P  +           LP+A +SVD +L+ H ++F+ DP  +L E  R +  GG+
Sbjct: 78  -----APPGFTGVKLYSRLDLLPIAKNSVDVLLLHHTMDFSADPHQVLREAARCMAPGGK 132

Query: 128 MIVVVPNKRGMWARMEHTPFGS-----GQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           + ++  +   +        +       G+ Y   ++   L+   F +   +   +  P  
Sbjct: 133 IAIIGFHPLSIMGLARWLLWWKSPGWMGRYYRPNRLTDWLQVLGFEVDGMASGFYTMPL- 191

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                    + + +G    P     Y++ ARK      P+  S+++ +    +VP  V+
Sbjct: 192 SDRGRSRVRMLDWLGRYLWPRHGNTYLLVARKRAGVVRPL-ASRQRRVPRNAVVPVPVA 249


>gi|127513041|ref|YP_001094238.1| hypothetical protein Shew_2113 [Shewanella loihica PV-4]
 gi|126638336|gb|ABO23979.1| conserved hypothetical protein [Shewanella loihica PV-4]
          Length = 240

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 42/247 (17%), Positives = 89/247 (36%), Gaps = 20/247 (8%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  ++++ + +     G    +AI   L   W  V G  +L +G         +  + R 
Sbjct: 1   MSFNVIKPQAWQELPNGLWLQEAIEDKLMPWWPKVFGYHMLCMGPLSHALEKPNLPIGRE 60

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            +   +                      LP+ +  +D V+    L+F  +P+ +L E  R
Sbjct: 61  FSLCESAL-----------CCLQGEYSQLPIQNGVIDAVVCSMLLDFEANPYSVLRETDR 109

Query: 121 VLTSGGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           VL SGG + ++  N              +     SG+ ++  ++   L    + +    R
Sbjct: 110 VLISGGYLFIIGFNPLSPAFFGKMLPSRQEKLPWSGRFFTPARVKDWLGLLGYQVVGDER 169

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
            ++     +   ++  S+++     + PG   +Y++ ARK+     PI + +K       
Sbjct: 170 LVYHHLLSE---IRGDSIWQHALQAWLPGSGSVYILVARKLDSPMTPILDRQKVRQPKWS 226

Query: 235 LVPHTVS 241
             P    
Sbjct: 227 TAPTAGR 233


>gi|71737504|ref|YP_273948.1| hypothetical protein PSPPH_1711 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558057|gb|AAZ37268.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 253

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G +                  P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYGLSAQAPP-----------VAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W           G  +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGMRHVFARDALGKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMPMAKVS 246


>gi|148979851|ref|ZP_01815729.1| SAM-dependent methyltransferase [Vibrionales bacterium SWAT-3]
 gi|145961543|gb|EDK26844.1| SAM-dependent methyltransferase [Vibrionales bacterium SWAT-3]
          Length = 261

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 47/241 (19%), Positives = 82/241 (34%), Gaps = 20/241 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G    ++I   L      + G  +L LG      S     ++  +       
Sbjct: 14  YTWAQLHNGDWLRESIQTRLDEWCPKLFGYHMLKLGGLSSEISSCTCNIQHQVNLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  Q      +    NLP  + S D V++ H L+++ DP  +L E+ RV+   G +
Sbjct: 71  -------QNPLHNVIADGYNLPFLEKSFDVVVLSHQLDYSNDPHRLLREVDRVMMDDGYI 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +          +++   SG+ Y+  ++   L   N+ +        FP + 
Sbjct: 124 IITGFNPFSVTGLASLMPWRKNSLPWSGRMYTPSRVKDWLGVLNYEVIHCDTYALFPMSK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK-KKHISSPILVPHTVS 241
            + +   W+  E             Y I ARK  Y   PI      K   SP+       
Sbjct: 184 YQAM---WTWLENALGGCASFAGSQYFIVARKRTYPLKPIKPHWHLKRRFSPVGASFRTD 240

Query: 242 T 242
           T
Sbjct: 241 T 241


>gi|119944271|ref|YP_941951.1| methyltransferase type 11 [Psychromonas ingrahamii 37]
 gi|119862875|gb|ABM02352.1| Methyltransferase type 11 [Psychromonas ingrahamii 37]
          Length = 246

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 73/219 (33%), Gaps = 16/219 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           LR +     G+       + +    +   G  LL LG      +  +  +          
Sbjct: 13  LRSWQQLPNGELLHQQTQQRVDDCLEQCFGYNLLKLGQLSCQINTSNSIITHQ------- 65

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
               N      + +       LPL DS++D  ++ H L+F+ DP  +L EI RVL   G 
Sbjct: 66  ---INCASSGDNLSLQADINQLPLQDSTIDLCILTHELDFSSDPHQLLREIDRVLALDGT 122

Query: 128 MIVVVPNKRGMWARMEH---TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +I+   N   +             + + +   ++I  L    F +       F     + 
Sbjct: 123 LIISGYNPISLLGLRTALNPKNPKNARLFLPNRVIDWLHLLGFKIQQKQHFDF---LSRN 179

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT 223
                    E  G  + P F  +Y I A+K      P+ 
Sbjct: 180 LNSTCSLFIEDFGQNYLPYFCSVYFIIAKKSTIPMTPVK 218


>gi|149377450|ref|ZP_01895193.1| SAM-dependent methyltransferase [Marinobacter algicola DG893]
 gi|149358291|gb|EDM46770.1| SAM-dependent methyltransferase [Marinobacter algicola DG893]
          Length = 273

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 41/225 (18%), Positives = 79/225 (35%), Gaps = 11/225 (4%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
              ++ + LG+         +      ++G R L +  +            + +   P  
Sbjct: 16  FESWFQTPLGRSLLADQRACVERHVRALSGARQLQVAVSHRLPLASGTDFAQRVLTTPN- 74

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                W        A+     LP    S+D V++ H  +F+  P   L E  RVL   G 
Sbjct: 75  -----WQSSIPDGVAVCDADELPFPGDSMDLVILHHTADFSPHPHQALREASRVLRGEGV 129

Query: 128 MIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           M+++  N   +W   +     H     G+     +M   LR  +F++  +  S F  P  
Sbjct: 130 MMLIGFNPFSLWGLRKLVSRHHEGPWGGRFLMKGRMEDWLRLLDFSVESSDSSFFQVPLQ 189

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
           +  + +   + E++           Y I A+K +Y  L    + +
Sbjct: 190 RAVLAERRGLMERLCGNRFLPVGAYYCILAKKRVYSRLQRRPAWQ 234


>gi|54310044|ref|YP_131064.1| SAM-dependent methyltransferase [Photobacterium profundum SS9]
 gi|46914483|emb|CAG21262.1| hypothetical SAM-dependent methyltransferase [Photobacterium
           profundum SS9]
          Length = 247

 Score =  117 bits (294), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 78/239 (32%), Gaps = 20/239 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+   + +   L      + G  +L LG      +  H  ++  +   
Sbjct: 10  IEAPYSWSQVANGEWAVELLQSRLDEWSPKLFGYHMLKLGGLSCELASPHCNIQHQICID 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                             +    +LP  + S D  L+ H L++  DP  +L E+ RV   
Sbjct: 70  ----------KHNPLHNVIADSFDLPFIEKSFDACLVSHQLDYCSDPHRLLREVDRVTVD 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +                 G+ +  Y++   L   N+ +         
Sbjct: 120 DGYLLLTGHNPVSILGIKGLLPWNRKKYPWLGRMFMPYRVKDWLSVLNYEVVHHENFAVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           P T     L   +  E + +        +Y I ARK  +   PI  + K +   SP+ V
Sbjct: 180 PATKH---LACSAWAENMLSDSCSMIGSMYFIVARKRTFPLKPIKPTWKLRRQLSPLRV 235


>gi|66045007|ref|YP_234848.1| hypothetical protein Psyr_1762 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255714|gb|AAY36810.1| conserved hypothetical protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|330972574|gb|EGH72640.1| hypothetical protein PSYAR_18985 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 253

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G              ++    P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYG-----------PSAQSPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSTWGIRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E++G        G YV+ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLERLGEGRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKVS 246


>gi|254286456|ref|ZP_04961413.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|150423405|gb|EDN15349.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
          Length = 243

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 83/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G   +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWAQLKNGLWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IITGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLSVLNYQVVACDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SPI V
Sbjct: 184 YRP---FWTWLENGLGGSNSPFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPIGV 235


>gi|90414053|ref|ZP_01222036.1| hypothetical SAM-dependent methyltransferase [Photobacterium
           profundum 3TCK]
 gi|90324848|gb|EAS41376.1| hypothetical SAM-dependent methyltransferase [Photobacterium
           profundum 3TCK]
          Length = 247

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 78/239 (32%), Gaps = 20/239 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+   + +   L      + G  +L LG      +  H  ++  +   
Sbjct: 10  IEAPYSWSQVANGEWAVELLQSRLDEWSPKLFGYHMLKLGGLSCELASPHCNIQHQICID 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                             +    +LP  + S D  L+ H L++  DP  +L E+ RV   
Sbjct: 70  ----------KHNPLHNVIADSFDLPFIEKSFDACLVSHQLDYCSDPHRLLREVDRVTVD 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +                 G+ +  Y++   L   N+ +         
Sbjct: 120 DGYLLLTGHNPVSILGIKGLLPWNRKKYPWLGRMFMPYRIKDWLSVLNYEVVHHENFAVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
           P T     L   +  E + +        +Y I ARK  +   PI  + K +   SP+ V
Sbjct: 180 PATKH---LACSAWAENMLSDSCSMIGSMYFIVARKRTFPLKPIKPTWKLRRQLSPLRV 235


>gi|289679439|ref|ZP_06500329.1| hypothetical protein PsyrpsF_39452 [Pseudomonas syringae pv.
           syringae FF5]
 gi|330897778|gb|EGH29197.1| hypothetical protein PSYJA_09560 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330975087|gb|EGH75153.1| hypothetical protein PSYAP_00220 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 253

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G              ++    P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYG-----------PSAQSPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSTWGIRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E++G        G YV+ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLERLGEGRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKVS 246


>gi|262170794|ref|ZP_06038472.1| SAM-dependent methyltransferase [Vibrio mimicus MB-451]
 gi|261891870|gb|EEY37856.1| SAM-dependent methyltransferase [Vibrio mimicus MB-451]
          Length = 245

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWSQLKNGEWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYV 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           IV   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IVTGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLGVLNYQVVECDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SP+ V
Sbjct: 184 YRP---FWTWLENGIGESSTAFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGV 235


>gi|330829019|ref|YP_004391971.1| methyltransferase [Aeromonas veronii B565]
 gi|328804155|gb|AEB49354.1| Methyltransferase [Aeromonas veronii B565]
          Length = 240

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 79/228 (34%), Gaps = 19/228 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +  +G      I   L     ++ G  LL +G      SC    +   +   P G+ 
Sbjct: 15  SWSALPMGDWVAAEIQDRLDNWCPNLFGYHLLKIGALSAELSCKRSSIRHQVGVAPGGRL 74

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                             +LP+   SVD  L+ H L+F+ DP  +L E  RVLT  G +I
Sbjct: 75  L----------DMYGDPLDLPVRTGSVDACLLAHCLDFSADPHQVLREAERVLTDDGWLI 124

Query: 130 VVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N             +      S + ++  ++   L      +    R  +     +
Sbjct: 125 ISGYNPMSLVGIGHCVPFLRRRMPWSARMFTPGRVTDWLHLLGCEVMFDERFGYSFMGKQ 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     E IG  +   FA +YVI ARK  +  +P+    +   S
Sbjct: 185 SW---HSWWRESIGRDYCRAFASVYVIAARKRRFPLIPVRRRWQLPKS 229


>gi|330952812|gb|EGH53072.1| hypothetical protein PSYCIT7_15869 [Pseudomonas syringae Cit 7]
          Length = 253

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G +                  P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYGPSAESPP-----------VAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFFLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSTWGIRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E++G        G YV+ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLERLGEGRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKVS 246


>gi|258621019|ref|ZP_05716053.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258627373|ref|ZP_05722157.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262166314|ref|ZP_06034051.1| SAM-dependent methyltransferase [Vibrio mimicus VM223]
 gi|258580411|gb|EEW05376.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258586407|gb|EEW11122.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|262026030|gb|EEY44698.1| SAM-dependent methyltransferase [Vibrio mimicus VM223]
          Length = 245

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 84/235 (35%), Gaps = 20/235 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+  +++I   L      + G  +L LG      +     ++  +       
Sbjct: 14  HSWSQLKNGEWVSESIQTRLDEWCPKLFGYHMLKLGGLSCELASCTCNIQHQVHLDI--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +    T +  +  LP  + S+D  ++ H L+++ DP  +L E+ RVL   G +
Sbjct: 71  -------ENPLHTVIADKYELPFLEKSIDVAILAHQLDYSNDPHRLLREVDRVLIDDGYV 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           IV   N              ++    SG+ ++  ++   L   N+ +    +   FP   
Sbjct: 124 IVTGFNPISFIGLASLMPWRKNNLPWSGRMFTPNRIKDWLGVLNYQVVECDQYALFPMQK 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK-KHISSPILV 236
            +     W+  E         F  +Y I ARK      PI    + K   SP+ V
Sbjct: 184 YRP---FWTWLENGIGESSTAFGSLYFIVARKRTCPLKPIRSKWRLKRRLSPVGV 235


>gi|330939728|gb|EGH43017.1| hypothetical protein PSYPI_11704 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 253

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 83/241 (34%), Gaps = 14/241 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I+  R++ S  LG+   +   ++L        G  L+  G              ++    
Sbjct: 17  ILAAREWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYG-----------PSAQSPPVA 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P  Q              +  E   PL++ + D V++ H L+F   P  +L E    +  
Sbjct: 66  PQVQRNVRLGAPLPGVEIVCEEQVWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRP 125

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG ++++  N    W              +  S  ++   L    F L       + PP 
Sbjct: 126 GGHLLIIGINPWSTWGIRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPL 185

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                    +  E++G        G YV+ ARK++    P+ + ++  I   I +P    
Sbjct: 186 ASAAWQSRLAGLERLGEGRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKV 245

Query: 242 T 242
           +
Sbjct: 246 S 246


>gi|88800081|ref|ZP_01115651.1| generic methyl-transferase [Reinekea sp. MED297]
 gi|88777207|gb|EAR08412.1| generic methyl-transferase [Reinekea sp. MED297]
          Length = 264

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 87/241 (36%), Gaps = 15/241 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L Q+Y + +G+    A   ++S       G  ++ L                      AG
Sbjct: 27  LSQWYRTSVGQELLAAEVDLISRAISGRFGSMMVQLDSGAHEPLFEKRLFG-------AG 79

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
              +   ++           NLP    S+D +LM H L+  E+P+ ++ E    L  GG 
Sbjct: 80  TLVSQLENRAPCPVICAKPENLPFEPESIDMLLMHHTLDICENPYQVIREGAIALKPGGV 139

Query: 128 MIVVVPNKRGMWARM-------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +IV+  N   +W          E       +     ++   +   +F L    + LF+PP
Sbjct: 140 LIVLGFNPYSLWGLRALIQGRGEGAGIWHSRFLRSGRVEDWMHLLDFELERHEKHLFYPP 199

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS-SPILVPHT 239
             +   L+  +   ++     P    +Y++   K +   LP  E + K     P++  ++
Sbjct: 200 YRRPSWLQRLNFGGRVQRRLLPFTGAVYLLVGYKQVLGRLPAAEKRVKRGFLEPVVSINS 259

Query: 240 V 240
            
Sbjct: 260 K 260


>gi|254428568|ref|ZP_05042275.1| hypothetical protein ADG881_1798 [Alcanivorax sp. DG881]
 gi|196194737|gb|EDX89696.1| hypothetical protein ADG881_1798 [Alcanivorax sp. DG881]
          Length = 258

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 82/239 (34%), Gaps = 16/239 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
             ++  S  G+        +L+       G R + +             +    +     
Sbjct: 22  FDEWLDSEPGQALLSEEKAMLTEWLRSQAGQRAVAIYAGGGRDFLSESPLRWQTSI---- 77

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                 P  +           LP+A SSVD +L+ H ++FA DP   L E  R +  GG+
Sbjct: 78  -----APPGFTGVKLQSRLDLLPIAKSSVDVLLLHHTMDFAADPHQALREASRCMAPGGK 132

Query: 128 MIVVVPNKRGMWARMEHTPFGS-----GQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           M ++  +   +        +       G+ Y   ++   L+   F +   +   +  P  
Sbjct: 133 MAIIGFHPVSVMGLARWLLWWKSPGWMGRYYRPNRLTDWLQVLGFEVDGMASGFYTMPL- 191

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                    + + +G    P     Y++ ARK      P+  ++++ +    +VP  V+
Sbjct: 192 SDRGRSRVRLLDWLGRFLWPRHGNTYLLVARKRAGVVRPL-ATRQRKVPRNTVVPVPVA 249


>gi|302187969|ref|ZP_07264642.1| hypothetical protein Psyrps6_16548 [Pseudomonas syringae pv.
           syringae 642]
          Length = 253

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL        G  L+  G              +T    P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYG-----------PSAQTPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSTWGIRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G YV+ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYVLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKVS 246


>gi|77458412|ref|YP_347917.1| hypothetical protein Pfl01_2185 [Pseudomonas fluorescens Pf0-1]
 gi|77382415|gb|ABA73928.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 252

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 81/235 (34%), Gaps = 14/235 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   D   ++L        G  L+  G +                  P  Q
Sbjct: 21  REWLSGPLGQFLLDEERRMLEDELGRFFGGYLVHYGPSAETPPSA-----------PQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           ++V  N    W       H      +  S  ++   L    F L       + PP     
Sbjct: 130 LIVGINPWSTWGLRHVFAHDALHQARCISPSRVADWLNLLGFALEKRRFGCYRPPLASPK 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                + +E+    +     G Y++ ARKI+    P+ + +++ +   I +P   
Sbjct: 190 WQARLAGWERKAGDWQLSGGGFYLLVARKIVVGLRPVRQERREPMGKLIPLPMAK 244


>gi|330878788|gb|EGH12937.1| hypothetical protein PSYMP_22829 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 253

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYG-----------PSAQNPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGVRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGKGRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMPMAKVS 246


>gi|296116639|ref|ZP_06835249.1| hypothetical protein GXY_12568 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976851|gb|EFG83619.1| hypothetical protein GXY_12568 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 282

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 106/243 (43%), Gaps = 21/243 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCR-------------LLGLGYAIPFFSCFHGK 56
           QFY+S  G+     + + LS+ W      R             +LG+GYA P+ S +   
Sbjct: 10  QFYASPRGRLAATHLRRHLSSFWPAAPEERMGGQVRGQMVQGQILGVGYAAPYLSLWDND 69

Query: 57  VERTLAFMPAGQGATNWPDQY-FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
               ++           P +       +V+E   P  +   D V+M+H LE  +    +L
Sbjct: 70  TTTCVSARLDTLVTRPAPAEGATGRECVVAEERFPFCELFFDRVVMIHALEVTDARNTLL 129

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
            ++W+V+    R+++VVPN+ GMWA  + +PFG G P+S+ Q+   L  A   +     +
Sbjct: 130 RQVWKVMKDDARLLLVVPNRSGMWAHADTSPFGQGTPFSYRQVTRALATACLRVERHENA 189

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
           L+FPP       +   + E+ G    P   G+ VIEA K  Y  +          ++P  
Sbjct: 190 LYFPPVGPTGGRRWSGMLERAGTRLLPYLGGVCVIEAVKDAYAPVGN-------ATAPAR 242

Query: 236 VPH 238
           VP 
Sbjct: 243 VPT 245


>gi|89094531|ref|ZP_01167470.1| generic methyl-transferase [Oceanospirillum sp. MED92]
 gi|89081267|gb|EAR60500.1| generic methyl-transferase [Oceanospirillum sp. MED92]
          Length = 260

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/244 (19%), Positives = 85/244 (34%), Gaps = 14/244 (5%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           ++R ++ S LG+         +      + G  L                V    + +P 
Sbjct: 15  QIRTWFDSELGQEFLADERDSVDRIVSTLFGMHLAQFSVDSRIQLFESSPVVHNFSVIPT 74

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
            +           +  +     +PLA  SVD V++ H L+F++ P  +L E  R+L  GG
Sbjct: 75  LELGIQ------DNNIVAKHEEIPLAHESVDVVVLHHALDFSDAPHQVLREASRILRPGG 128

Query: 127 RMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +++V  N    W       R ++ P   GQ  S  ++   L+    T           P
Sbjct: 129 HVVIVGFNPMSYWGFYRFLKRKKNLPPWLGQFLSHRRLSDWLKLLELTELKHLSGYHRFP 188

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK--KKHISSPILVPH 238
              +   +   + E I            ++ ARK +    P+      ++ IS P+  P 
Sbjct: 189 FETRKWRRRLRLLESISRRMPGHSGAYSILLARKDIAGMTPLRSGWGLRRLISLPVAEPT 248

Query: 239 TVST 242
              T
Sbjct: 249 ARDT 252


>gi|298486276|ref|ZP_07004339.1| SAM-dependent methyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159283|gb|EFI00341.1| SAM-dependent methyltransferase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 253

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYG-----------PSAQAPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGMRHVFARDGLRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMPMAKVS 246


>gi|91793375|ref|YP_563026.1| methyltransferase type 11 [Shewanella denitrificans OS217]
 gi|91715377|gb|ABE55303.1| Methyltransferase type 11 [Shewanella denitrificans OS217]
          Length = 239

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/247 (21%), Positives = 95/247 (38%), Gaps = 21/247 (8%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           MR+ + + RQ+     G+    A    L+  W  + G  LL LG            + R 
Sbjct: 1   MRL-VTKPRQWQEFPYGEQIKLAAQSHLAAWWPKLFGYHLLKLGALSAGLDSQACSISRQ 59

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            +             +   +  +    +LPL ++++D VLM   +EF  +P+ +L E+ R
Sbjct: 60  FSV-----------FEDTGADIIADPHHLPLQNTTIDTVLMSFLMEFETNPYRLLREVDR 108

Query: 121 VLTSGGRMIVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           VL  GG +++V  N           +  +      GQ +   ++   L    + +   SR
Sbjct: 109 VLICGGYVVIVGFNPISPLFMGKVLSGYQEKLPWCGQFFMPSRVKDWLGLLGYQVLEDSR 168

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
           SL+ P              E+  + + PG   +Y I ARK+     PI + K+   +S  
Sbjct: 169 SLYHPLIKTFA---FGQYLEQSLHKWLPGTGSVYFIVARKLDAPLTPIRDKKRPLQTSWS 225

Query: 235 LVPHTVS 241
             P    
Sbjct: 226 PAPSAGR 232


>gi|213968847|ref|ZP_03396988.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301384107|ref|ZP_07232525.1| hypothetical protein PsyrptM_15790 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302059181|ref|ZP_07250722.1| hypothetical protein PsyrptK_04267 [Pseudomonas syringae pv. tomato
           K40]
 gi|302135019|ref|ZP_07261009.1| hypothetical protein PsyrptN_26756 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213926450|gb|EEB60004.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 253

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYG-----------PSAQNPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGVRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMPMAKVS 246


>gi|257483798|ref|ZP_05637839.1| hypothetical protein PsyrptA_11114 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289627517|ref|ZP_06460471.1| hypothetical protein PsyrpaN_20686 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649932|ref|ZP_06481275.1| hypothetical protein Psyrpa2_19609 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868361|gb|EGH03070.1| hypothetical protein PSYAE_14164 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330889982|gb|EGH22643.1| hypothetical protein PSYMO_14541 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330985654|gb|EGH83757.1| hypothetical protein PLA107_11588 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012692|gb|EGH92748.1| hypothetical protein PSYTB_24077 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 253

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYG-----------PSAQAPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGMRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMPMAKVS 246


>gi|326796077|ref|YP_004313897.1| SAM-dependent methyltransferase [Marinomonas mediterranea MMB-1]
 gi|326546841|gb|ADZ92061.1| SAM-dependent methyltransferase [Marinomonas mediterranea MMB-1]
          Length = 246

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/240 (20%), Positives = 81/240 (33%), Gaps = 14/240 (5%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
            +Q+Y + LG+       + ++   D   G     L    P  +          AF  A 
Sbjct: 10  FQQWYQTSLGEQLLKREIQAINEEMDHGVGYY---LSIQTPLKALDITNHRMREAFHIAP 66

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                 PD    S+ +     LPL    VD  ++ H L+ + +P   L E  R L   G+
Sbjct: 67  TLELGAPD----SSIIARSSELPLEGDGVDLHVLHHTLDVSLEPHDDLREAARTLLPSGK 122

Query: 128 MIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           +I+V  N   MW               G+  S  ++   L+ A  TL       + PP  
Sbjct: 123 LIIVGFNPWSMWGIRRVFSKRKKAPWCGRFISHARLEDWLKVAGLTLEKRQFISYAPPVQ 182

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                  +    +        F G+Y++   K   + +PI    +       + P T  T
Sbjct: 183 SDKWRSRFHWLGQYFKFLKLPFGGVYILTVTKETKRFIPIKPRWRGARVR--VTPLTKPT 240


>gi|331019243|gb|EGH99299.1| hypothetical protein PLA106_24648 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 253

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYG-----------PSAQNPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGVRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKVS 246


>gi|145299714|ref|YP_001142555.1| methyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852486|gb|ABO90807.1| methyltransferase [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 240

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 83/238 (34%), Gaps = 21/238 (8%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +  +G      I + L +    + G  LL +G      SC    +   +    +G+ 
Sbjct: 15  SWSALPMGDWVAAEIQERLDSWCPHLFGYHLLKVGALSAELSCGCSSIRHQIGVATSGRL 74

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                              LP+   SVD  L+ H L+F+ DP  +L E  RVLT  G +I
Sbjct: 75  L----------DIKGDPLALPVRTGSVDACLLAHCLDFSPDPHQVLREAERVLTDDGWLI 124

Query: 130 VVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           V   N             +      S + ++  ++   L+     +    R  +     +
Sbjct: 125 VSGYNPLSLVGIGHCLPFLRQRLPWSARMFTPARVTDWLQLLGCEVMFDERFGYSFMGKQ 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
               ++    E +G  +   FA +YVI ARK  +  +P+       +   I  P    
Sbjct: 185 S---RIGWWRESVGRDYCRPFASVYVIAARKRRFPLIPVRRRW--RLPESIAAPGMAR 237


>gi|28870868|ref|NP_793487.1| hypothetical protein PSPTO_3713 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28854117|gb|AAO57182.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 253

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYG-----------PSAQNPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGVRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPLRQVRRDPIGKLIPMPMAKVS 246


>gi|229590111|ref|YP_002872230.1| hypothetical protein PFLU2644 [Pseudomonas fluorescens SBW25]
 gi|229361977|emb|CAY48877.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 260

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 83/239 (34%), Gaps = 14/239 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I   R++ S  +G+   D   ++L        G  L+  G +     C            
Sbjct: 21  ISAAREWLSGPIGQFLLDEERRMLEDELGRFFGGYLVHYGPSAETPPCA----------- 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P  Q              +  E   PL++ + D V++ H L+F   P  +L E    +  
Sbjct: 70  PQVQRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRP 129

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG +++V  N    W       H      +  S  ++   L    F L       + PP 
Sbjct: 130 GGHLLIVGINPWSSWGLRHAFAHDGLRQARCISPQRVGDWLNLLGFALEKRRFGCYRPPL 189

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                    + +E+    +     G Y++ ARKI+    P+ + +++ +   + +P   
Sbjct: 190 ASTKWQGRLAGWERRAGAWQLAGGGFYLLVARKIVVGLRPVQQVRREPMGKLVPMPMAK 248


>gi|330719520|gb|EGG98127.1| SAM-dependent methyltransferase [gamma proteobacterium IMCC2047]
          Length = 259

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 55/244 (22%), Positives = 97/244 (39%), Gaps = 15/244 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGL---GYAIPFFSCFHGKVERTLA 62
           V+ + +    LG+   +    +L+   +   G +LL L   G   P FS      +    
Sbjct: 17  VDWQLWQQQPLGQSLIEHERTLLTPLLERKLGVQLLQLSIAGC-EPLFSRCSIPHQTFAQ 75

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
              +          + +   L+    LP+A++S+D +++ H LE++ +P  +L E  R L
Sbjct: 76  ITSSDSNV----SPHSNCNLLLEPCYLPIANNSMDAIVLHHILEYSRNPHQILREAHRAL 131

Query: 123 TSGGRMIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            SGG++ V+  N   +    +          +G   SW ++   L    F +  T    F
Sbjct: 132 NSGGQLFVMAFNPWSLMGVRKLVSPLKRAPWTGSYRSWMKLNDWLNLLGFKVEHTHYGFF 191

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI--SSPIL 235
             P +        S  E++G  +   F   Y I ARK      P+ E+K K    + P+ 
Sbjct: 192 RAPLNTTKGDGNNSKLEQLGRKYNCFFGSTYAIVARKQTVGMTPLHETKLKRRVLTFPLT 251

Query: 236 VPHT 239
            P T
Sbjct: 252 EPTT 255


>gi|237803580|ref|ZP_04591165.1| hypothetical protein POR16_28141 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025562|gb|EGI05618.1| hypothetical protein POR16_28141 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 252

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 82/239 (34%), Gaps = 18/239 (7%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYA--IPFFSCFHGKVERTLAFMPA 66
           R++ S  LG+   +   +VL        G  L+  G +   P  +    +  R  A +P 
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYGPSAETPPVAPQVRRNVRLGAPLP- 79

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                           +  E   PL++ + D V++ H L+F   P  +L E    +  GG
Sbjct: 80  ------------GVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGG 127

Query: 127 RMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
            ++++  N    W              +  S  ++   L    F L       + PP   
Sbjct: 128 HLLIIGINPWSTWGVRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLAS 187

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                     E +G        G Y++ ARK++    P+   ++  I   I +P    +
Sbjct: 188 AGWQSRLIGLESLGEGRQSPGGGFYLLVARKLVVGLRPVRPVRRDPIGKLIPLPMAKVS 246


>gi|94502171|ref|ZP_01308669.1| SAM-dependent methyltransferase [Oceanobacter sp. RED65]
 gi|94425696|gb|EAT10706.1| SAM-dependent methyltransferase [Oceanobacter sp. RED65]
          Length = 238

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 90/238 (37%), Gaps = 16/238 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            +L ++      K   +  ++ L      + G  LL                    A   
Sbjct: 3   QDLYKWRERPQIKRLLNVETRYLRQHLPQLHGHYLLQY------------SGVDYKAMPT 50

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           +    + +  +  S   ++   ++PL ++S+DCVLM H L+F + P   L E  R+    
Sbjct: 51  SSLTYSYYASKGGSGDLIMDFEDIPLRENSIDCVLMHHVLDFEDKPHQCLREAARITVPN 110

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           G +++V  N   +W    + P      + Q  +  +++  L   +F +         PP 
Sbjct: 111 GYVVIVGFNPVSLWGLARYLPKTATPPAAQFLAKGRVLDWLSLLDFRVEQVQTFQAMPPW 170

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
             K   K+    +++ ++ G  F   YVI ARK++    PI    +      + +P  
Sbjct: 171 GLKYFRKIGMRLDRLLSLIGNPFGNCYVIVARKLVAGRTPIRPQWRALSGGRLPMPTP 228


>gi|152985540|ref|YP_001348841.1| hypothetical protein PSPA7_3482 [Pseudomonas aeruginosa PA7]
 gi|150960698|gb|ABR82723.1| hypothetical protein PSPA7_3482 [Pseudomonas aeruginosa PA7]
          Length = 253

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R ++   LG        ++L        G  L+  G   P         +          
Sbjct: 22  RDWFQGPLGSLMLAEERRLLCDELTRYFGGYLVHYG---PHAELPPSTGQIQRGVRLGPP 78

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                            EG  PL++ + D VL+ H L+F   P  +L E  R +  GG +
Sbjct: 79  M--------PGVDIACEEGAWPLSEHAADVVLLQHGLDFCLSPHRLLREAARTVRPGGHL 130

Query: 129 IVVVPNKRGMWARMEHTPF---GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           ++V  N   +W    H         +     +    L    F L       + PP     
Sbjct: 131 LLVGINPWSLWGVRHHFAGDALRQARCIPPSRACDWLNLLGFALEKRRFGCYRPPLASAA 190

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E+ G+ +    AG Y++ ARK++    P+ +SK++     + +P    +
Sbjct: 191 WQSRLARLERWGDAWQSSGAGFYLLVARKLVVGLRPLRQSKREPRGQLVPMPVAKVS 247


>gi|269101977|ref|ZP_06154674.1| hypothetical SAM-dependent methyltransferase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161875|gb|EEZ40371.1| hypothetical SAM-dependent methyltransferase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 263

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 71/238 (29%), Gaps = 22/238 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G    + +   L      + G  +L LG      S  H  ++  +       
Sbjct: 14  HSWSDVTNGTWVAELLQTRLDEWSPKLFGYHMLKLGGLSGEVSSQHCSIQHQVCID---- 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                       T +     LP  + S D  +++H L++  DP  +L EI RV+   G +
Sbjct: 70  ------KCSDYRTLVADYFQLPFIEKSFDACILLHQLDYCTDPHRLLREIDRVMVDDGYL 123

Query: 129 IVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +                 G+ +   ++   L   N+ +         P   
Sbjct: 124 ILSGSNPLSLLGFQGLLPWNRKKNPWLGRMFLPARVQDWLALLNYEVIYHDDFAILPSAR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                   +  E +       F   Y + ARK      PI  + K       L P  V
Sbjct: 184 HSA---CAAWLENMIAEPLNAFGSFYFMVARKRTCPLKPIKPTWKLRRH---LAPIGV 235


>gi|320325374|gb|EFW81441.1| hypothetical protein PsgB076_08157 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320327641|gb|EFW83649.1| hypothetical protein PsgRace4_22635 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 253

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   ++L        G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRILDEELGRYFGGYLVHYG-----------PSAQAPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W           G  +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGMRHVFARDALGKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ +  +  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPVRQVCRDPIGKLIPMPMAKVS 246


>gi|330959400|gb|EGH59660.1| hypothetical protein PMA4326_12694 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 256

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL        G  L+  G +                  P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELGRYFGGYLVHYGPSAETPP-----------VAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSTWGVRHVFARDALRKARCISPSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G+       G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGDGRQSPSGGFYLLVARKLVVGLRPVRQVRRDPIGKLIPMPMAKVS 246


>gi|330963307|gb|EGH63567.1| hypothetical protein PSYAC_01415 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 253

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  LG+   +   +VL    +   G  L+  G              +     P  Q
Sbjct: 21  REWLSGPLGQLLLEEERRVLDEELERYFGGYLVHYG-----------PSAQNPPVAPQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N    W              +  S  ++   L    F L       + PP     
Sbjct: 130 LIIGINPWSAWGVRHVFARDALRKARCISSSRVADWLNLLGFALEKRRFGCYRPPLASAA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E +G        G Y++ ARK++    P+ + ++  I   I +P    +
Sbjct: 190 WQSRLAGLESLGEGRQSPGGGFYLLVARKLVVGLRPVHQVRRDPIGKLIPMPMAKVS 246


>gi|90407279|ref|ZP_01215465.1| methyltransferase [Psychromonas sp. CNPT3]
 gi|90311562|gb|EAS39661.1| methyltransferase [Psychromonas sp. CNPT3]
          Length = 246

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 75/239 (31%), Gaps = 16/239 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            +L  ++    G+       + +        G  LL LG            +   +   P
Sbjct: 11  TQLESWHQLPHGEALLKQTQQRIDAYLPLSFGYNLLKLGNLSCQLDTKRSAIPTQIHCAP 70

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
            G G                   LPL DS +D  ++ H L+F+ DP  +L EI RVLT  
Sbjct: 71  QGDGI----------GLYAELDQLPLQDSCIDLCILSHELDFSNDPHQLLREIDRVLTID 120

Query: 126 GRMIVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           G +IV   N    +              + ++  ++I  L    + +       F     
Sbjct: 121 GVLIVSGYNPLSGFGLRLLCTPKKVQTARLFAPSRVIDWLHLLGYEIKEQQHFNFLSYAG 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           K          E+    + P     Y I A+K      PI  + K      +  P T  
Sbjct: 181 KYAFFMH---LERFAQRYLPLLCSTYFIVAKKRSSPITPIKSTFKFRQKIILRQPLTTR 236


>gi|120599052|ref|YP_963626.1| type 11 methyltransferase [Shewanella sp. W3-18-1]
 gi|120559145|gb|ABM25072.1| Methyltransferase type 11 [Shewanella sp. W3-18-1]
          Length = 244

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 88/240 (36%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G     A+++ L+  W  V G  LL LG      S     V    +   +  
Sbjct: 11  EQWEDLPNGAALQFAVAEKLAHWWPRVFGYHLLKLGPLSAALSSMESPVAHHFSLSSSQD 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++ +    +LPL +  +D V+M   LEF  DP+ +L E  RVL +GG +
Sbjct: 71  -----------ASIIGDFCHLPLQNGVIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYL 119

Query: 129 IVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N          W + +     +G+ +   ++   L    + +    R ++ P   
Sbjct: 120 FIVGFNPLSPVFLGKLWPKYQDCLPWNGRFFMPSRVRDWLGLLGYQVVSDERLVYHPLIG 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +          ++    + P    +Y+I ARK+     PI + +K    +         +
Sbjct: 180 EF---NEGRFLQQTLASWLPSTGSLYLIVARKLESPLTPIRDKRKVLQPNWSTASSAGRS 236


>gi|154706774|ref|YP_001425096.1| methyltransferase [Coxiella burnetii Dugway 5J108-111]
 gi|154356060|gb|ABS77522.1| methyltransferase [Coxiella burnetii Dugway 5J108-111]
          Length = 243

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 95/240 (39%), Gaps = 14/240 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           +++Y    G        +  +    ++ G  L+ +G            +   +  M    
Sbjct: 9   QEWYQQPPGSWVLTLECEEAARVLSNIKGRYLVQMGGTADLAHSAMSPILYQIRLMSQPD 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +       S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+
Sbjct: 69  NLS-------SLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRL 121

Query: 129 IVVVPNKRGMWAR-----MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           ++   N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  K
Sbjct: 122 LIFGFNPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKK 181

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH--ISSPILVPHTVS 241
           K   +L    E  G +  P   GIY++ A+K +Y  L      K    ++  I+ P    
Sbjct: 182 KPGRRLQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPLLHKIVWKGRNIMAGGIVKPTPSP 241


>gi|331007396|ref|ZP_08330582.1| SAM-dependent methyltransferase [gamma proteobacterium IMCC1989]
 gi|330418804|gb|EGG93284.1| SAM-dependent methyltransferase [gamma proteobacterium IMCC1989]
          Length = 286

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 79/240 (32%), Gaps = 15/240 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            +L Q++SS +G+       + +     ++ G  L+ L                     P
Sbjct: 31  TQLSQWFSSVVGQRVLTEEQQCIDELLPEMFGYHLMQLSVLPSSRMFSASSTGHQFIVEP 90

Query: 66  AGQGATNWPDQYFSST----ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
           +G    +  D     T     +     LP+    +D  L+ H L+++  P  +L E  RV
Sbjct: 91  SGHIGDHCCDDESVKTPASSVIAQFEQLPIDADVIDVALLHHALDYSTHPHQLLRETTRV 150

Query: 122 LTSGGRMIVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           L   G +++V  N   +          +  +     Q     ++       +  L  + R
Sbjct: 151 LIPNGHIVLVGFNPFSLLGLGHSVARLLSKSYAYRRQHLPVSRLKDWFEVLDLELVYSRR 210

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
             +  P ++    ++         +  P   G YV+  RK +     I    KK    P 
Sbjct: 211 GYYGLPFNRYYSPRVNRFL----AMLLPVIGGFYVLVLRKNITPMTKIQTKWKKRSVLPA 266


>gi|29653666|ref|NP_819358.1| putative methyltransferase [Coxiella burnetii RSA 493]
 gi|165920932|ref|ZP_02219602.1| putative methyltransferase [Coxiella burnetii RSA 334]
 gi|29540928|gb|AAO89872.1| methyltransferase [Coxiella burnetii RSA 493]
 gi|165916780|gb|EDR35384.1| putative methyltransferase [Coxiella burnetii RSA 334]
          Length = 243

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 95/240 (39%), Gaps = 14/240 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           +++Y    G        +  +    ++ G  L+ +G            +   +  M    
Sbjct: 9   QEWYQQPPGSWLLTLECEEAARVLSNIKGRYLVQMGGTADLAHSAMSPILYQIRLMSQPD 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +       S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+
Sbjct: 69  NLS-------SLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRL 121

Query: 129 IVVVPNKRGMWAR-----MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           ++   N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  K
Sbjct: 122 LIFGFNPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKK 181

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH--ISSPILVPHTVS 241
           K   +L    E  G +  P   GIY++ A+K +Y  L      K    ++  I+ P    
Sbjct: 182 KPGRRLQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPLLHKIVWKGRNIMAGGIVKPTPSP 241


>gi|157962226|ref|YP_001502260.1| type 11 methyltransferase [Shewanella pealeana ATCC 700345]
 gi|157847226|gb|ABV87725.1| Methyltransferase type 11 [Shewanella pealeana ATCC 700345]
          Length = 246

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G     ++ + LS  W  + G  +L LG      +     + R  +     Q
Sbjct: 11  YHWSELPNGPVIRQSVEQALSPWWPRIFGYFMLNLGPLSHKMAKTGVGISRQYSLFDEAQ 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      +        LP+ ++S+D V+M   LEF  DP+ +L E+ RVL SGG +
Sbjct: 71  -----------ANIEGDYCQLPIQNTSIDAVVMNFLLEFEADPYRLLREVDRVLISGGHL 119

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N              +      G+ +   ++   L    + +    R L      
Sbjct: 120 VITGFNPLSPMFMGKILPSHQQDIPWCGRFFMPSRVKDWLGLLGYQVVADERLLHHHLLK 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           +   +K  +++      + P    +YV+ A+K+     PI   +K    S    P    
Sbjct: 180 E---MKTDNIWSHALKSWLPSTGSVYVLVAKKLESPLTPIQLKRKVKRPSWSTAPSASR 235


>gi|161830615|ref|YP_001596266.1| putative methyltransferase [Coxiella burnetii RSA 331]
 gi|161762482|gb|ABX78124.1| putative methyltransferase [Coxiella burnetii RSA 331]
          Length = 243

 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 95/240 (39%), Gaps = 14/240 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           +++Y    G        +  +    ++ G  L+ +G            +   +  M    
Sbjct: 9   QEWYQQPPGSWLLTLECEEAARVLSNIKGRYLVQMGGTADLAHSAMSPILYQIRLMSQPD 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +       S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+
Sbjct: 69  NLS-------SLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRL 121

Query: 129 IVVVPNKRGMWAR-----MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           ++   N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  K
Sbjct: 122 LIFGFNPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKK 181

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH--ISSPILVPHTVS 241
           K   +L    E  G +  P   GIY++ A+K +Y  L      K    ++  I+ P    
Sbjct: 182 KPGRRLQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPLLHKIVWKGRNIMAGGIIKPTPSP 241


>gi|153208780|ref|ZP_01947012.1| putative methyltransferase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218150|ref|YP_002304937.1| methyltransferase [Coxiella burnetii CbuK_Q154]
 gi|120575742|gb|EAX32366.1| putative methyltransferase [Coxiella burnetii 'MSU Goat Q177']
 gi|212012412|gb|ACJ19792.1| methyltransferase [Coxiella burnetii CbuK_Q154]
          Length = 234

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 90/226 (39%), Gaps = 12/226 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           +++Y    G        +  +    ++ G  L+ +G            +   +  M    
Sbjct: 9   QEWYQQPPGSWLLTLECEEAARVLSNIKGRYLVQMGGTADLAHSAMSPILYQIRLMSQPD 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +       S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+
Sbjct: 69  NLS-------SLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRL 121

Query: 129 IVVVPNKRGMWAR-----MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           ++   N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  K
Sbjct: 122 LIFGFNPWSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKK 181

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH 229
           K   +L    E  G +  P   GIY++ A+K +Y  L      K  
Sbjct: 182 KPGRRLQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPLLHKIVWKGR 227


>gi|15597011|ref|NP_250505.1| hypothetical protein PA1814 [Pseudomonas aeruginosa PAO1]
 gi|107101246|ref|ZP_01365164.1| hypothetical protein PaerPA_01002279 [Pseudomonas aeruginosa PACS2]
 gi|116049764|ref|YP_791429.1| hypothetical protein PA14_41070 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218892232|ref|YP_002441099.1| hypothetical protein PLES_35131 [Pseudomonas aeruginosa LESB58]
 gi|254240207|ref|ZP_04933529.1| hypothetical protein PA2G_00849 [Pseudomonas aeruginosa 2192]
 gi|296389795|ref|ZP_06879270.1| hypothetical protein PaerPAb_16666 [Pseudomonas aeruginosa PAb1]
 gi|313110512|ref|ZP_07796397.1| hypothetical protein PA39016_002410099 [Pseudomonas aeruginosa
           39016]
 gi|9947799|gb|AAG05203.1|AE004608_2 hypothetical protein PA1814 [Pseudomonas aeruginosa PAO1]
 gi|115584985|gb|ABJ11000.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126193585|gb|EAZ57648.1| hypothetical protein PA2G_00849 [Pseudomonas aeruginosa 2192]
 gi|218772458|emb|CAW28240.1| hypothetical protein PLES_35131 [Pseudomonas aeruginosa LESB58]
 gi|310882899|gb|EFQ41493.1| hypothetical protein PA39016_002410099 [Pseudomonas aeruginosa
           39016]
          Length = 253

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R ++   LG        ++L        G  L+  G   P         +          
Sbjct: 22  RDWFQGPLGSLMLAEERRLLCDELTRYFGGYLVHYG---PHAELPPSTGQIQRGV----- 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                            EG  PL++ + D VL+ H L+F   P  +L E  R +  GG +
Sbjct: 74  ---RLGPPLPGVDIACEEGAWPLSEHAADVVLLQHGLDFCLSPHRLLREAARTVRPGGHL 130

Query: 129 IVVVPNKRGMWARMEHTPF---GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N   +W    +         +     +    L    F L       + PP     
Sbjct: 131 LLIGINPWSLWGIRHYFAGDALRQARCIPPSRACDWLNLLGFALEKRRFGCYRPPLASAA 190

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E+ G+ +    AG Y++ ARK++    P+ +SK++     + +P    +
Sbjct: 191 WQSRLARLERWGDAWQSSGAGFYLLVARKLVVGLRPLRQSKREPRGQLVPMPVAKVS 247


>gi|146292877|ref|YP_001183301.1| type 11 methyltransferase [Shewanella putrefaciens CN-32]
 gi|145564567|gb|ABP75502.1| Methyltransferase type 11 [Shewanella putrefaciens CN-32]
          Length = 244

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 88/240 (36%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G     A+++ L+  W  V G  LL LG      S     V    +   +  
Sbjct: 11  EQWEDLPNGAALEFAVAEKLAHWWPRVFGYHLLKLGPLSAALSSMESPVAHHFSLSSSQD 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++ +    +LPL +  +D V+M   LEF  DP+ +L E  RVL +GG +
Sbjct: 71  -----------ASIIGDFCHLPLQNGVIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYL 119

Query: 129 IVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N          W + +     +G+ +   ++   L    + +    R ++ P   
Sbjct: 120 FIVGFNPLSPVFLGKLWPKYQDCLPWNGRFFMPSRVRDWLGLLGYQVVSDERLVYHPLIG 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +          ++    + P    +Y+I ARK+     PI + +K    +         +
Sbjct: 180 EF---NEGRFLQQTLASWLPSTGSLYLIVARKLESPLTPIRDKRKVLQPNWSTASSAGRS 236


>gi|212213175|ref|YP_002304111.1| methyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212011585|gb|ACJ18966.1| methyltransferase [Coxiella burnetii CbuG_Q212]
          Length = 243

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 95/240 (39%), Gaps = 14/240 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           +++Y    G        +  +    ++ G  L+ +G            +   +  M    
Sbjct: 9   QEWYQQPPGSWLLTLECEEAARVLSNIKGRYLVQMGGTADLAHSAMSPILYQIRLMSQPD 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +       S T      +LPL  +SVD V++VH LEF + P  +L EI++ L   GR+
Sbjct: 69  NLS-------SLTIQTEYQDLPLLPNSVDVVVIVHLLEFIDYPVKLLQEIFQALKPDGRL 121

Query: 129 IVVVPNKRGMWAR-----MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           ++   N   +W       ++     +G+ +S  Q+   L   N+++  +    +  P  K
Sbjct: 122 LIFGFNPLSLWGMNKFFNLKKDIPWNGKFWSRAQVKRWLINFNYSILFSKTFCYGYPRKK 181

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH--ISSPILVPHTVS 241
           K   +L    E  G +  P   GIY++ A+K +Y  L      K    ++  I+ P    
Sbjct: 182 KPGRRLQLFSEVAGQLSLPTAGGIYLLVAKKSVYAPLLHKIVWKGRNIMAGGIVKPTPSP 241


>gi|89900256|ref|YP_522727.1| hypothetical protein Rfer_1463 [Rhodoferax ferrireducens T118]
 gi|89344993|gb|ABD69196.1| conserved hypothetical protein [Rhodoferax ferrireducens T118]
          Length = 233

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 80/226 (35%), Gaps = 26/226 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPL 91
             D+ G   L LG         +    R                    +        LP 
Sbjct: 3   VADIFGFHALQLGLPELDALGANRMPHRW----------LATQTPMPGAAFATDFSALPF 52

Query: 92  ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP----- 146
             +S+D V++ H LE A DP   L E+ RVL   GR+++   N   +W   +        
Sbjct: 53  QANSLDLVVLPHSLELASDPHTTLREVERVLVPEGRVVICGLNPTSLWGFRQRRGRSPHR 112

Query: 147 --------FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
                     +G+   ++++   LR   F + +     + P    +  L+ +   ++ G 
Sbjct: 113 VGSQKLFLPEAGEFIGYWRLRDWLRLLGFEVEVGRFGCYRPAFSSEKWLQRFEWMDRAGA 172

Query: 199 IFGPGFAGIYVIEARKILYQGLPITESKKKHIS---SPILVPHTVS 241
            + P    +Y + A K +     ++ + K   +   +P+ V ++ +
Sbjct: 173 RWWPILGSVYFLVAVKRVRGMTLLSPAWKASRALANAPVSVANSST 218


>gi|121607586|ref|YP_995393.1| type 11 methyltransferase [Verminephrobacter eiseniae EF01-2]
 gi|121552226|gb|ABM56375.1| Methyltransferase type 11 [Verminephrobacter eiseniae EF01-2]
          Length = 274

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 82/236 (34%), Gaps = 28/236 (11%)

Query: 34  DVTGCRLLGLGYAIPFFSCFHGKVERTLAF-------------MPAGQGATNWPDQYFSS 80
           D+ G   L LG  +      +    R LA               PA +GA     Q   +
Sbjct: 3   DIFGYHSLQLGVPLLDGLRANRMPYRWLALGQEVAGGASAAAQTPA-EGAAAPQRQRQQA 61

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
             L     LP A +S+D +++ H LE + DP   L E+ RVL   GR+++   N   +W 
Sbjct: 62  ALLAEPVALPFAAASLDLIVLPHTLELSIDPHAALREVERVLMPEGRVVISGLNPTSLWG 121

Query: 141 RMEHTPFGSGQP-------------YSWYQMISLLREANFTLSITSRSLFFPPTHKKCIL 187
             +                        ++++   LR   F +  T    + P       L
Sbjct: 122 LRQRRARWYRHLGHGTPYLPEVGELIGYWRLRDWLRLLGFEVESTRFGCYRPAVRNAQWL 181

Query: 188 KLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI-LVPHTVST 242
           + +   + +G  + P     Y + A K ++    +  + +         VP   ST
Sbjct: 182 ERFGWMDALGEKWWPILGAAYFLVAVKRVHGMRLLNPAWRSSRQRAATTVPLANST 237


>gi|170726956|ref|YP_001760982.1| hypothetical protein Swoo_2610 [Shewanella woodyi ATCC 51908]
 gi|169812303|gb|ACA86887.1| conserved hypothetical protein [Shewanella woodyi ATCC 51908]
          Length = 248

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 85/238 (35%), Gaps = 20/238 (8%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G      I  +L+  W  V G  +L LG            + R  +        
Sbjct: 13  WSQLPSGDQIKSLIEHILTPWWPKVFGYHMLNLGALSAELDMPDLPIGRRFSLFD----- 67

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                    ++       LP+ +S +D V+M   LEF  DP+ +L E  RVL SGG + +
Sbjct: 68  ------GKGASIRAEFTALPIQNSVIDAVVMNMLLEFEPDPYKLLRETDRVLISGGYLFI 121

Query: 131 VVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +  N            + +     +G+ +   ++   L    + +    R L+       
Sbjct: 122 IGFNPLSPAFIGKLLPKYQQQQPWNGRFFMPSRVKDWLGLLGYQVISDERFLYHHLLSD- 180

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
             +K  S+++     + P    +Y+I ARK+     PI E +K   +     P    +
Sbjct: 181 --IKSESIWQDALQAWLPSSGSLYLIVARKLESPLTPIHEKRKVRQTQWTTAPTAGRS 236


>gi|254786147|ref|YP_003073576.1| SAM-dependent methyltransferase [Teredinibacter turnerae T7901]
 gi|237683590|gb|ACR10854.1| SAM-dependent methyltransferase [Teredinibacter turnerae T7901]
          Length = 285

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/249 (18%), Positives = 78/249 (31%), Gaps = 10/249 (4%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R  +  L  +Y S LG+        +L      + G  L+ L          H ++    
Sbjct: 20  RQSLAALAAWYESPLGQAALQEQQHILRDELSCLFGYHLMELSIVPYERLSEHSRINHRF 79

Query: 62  AFMPAGQGATNWPDQYFSSTAL-VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +  P         D              LPLAD S+D  ++ H LEF+ +P  +L E  R
Sbjct: 80  SLSPVHVPPPPCDDASLRDVQGLSELDALPLADESIDVTILHHVLEFSPNPHQVLKEAAR 139

Query: 121 VLTSGGRMIVVVPNKRGMWAR-------MEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           V    G +I+   N   +              P    +     ++   L   +F+     
Sbjct: 140 VTVPRGHVIIFAFNPFSLAGLMQMGAQFYSKRPIWQRRALRAGRIRDWLEFLDFSCLSLR 199

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
                 P +    L      ++I +   P    +Y I ARK      PI  +        
Sbjct: 200 YLGRNLPINHSRYLNSSRFVDRIFSRSIP-LGSMYYIVARKDKAGLQPIKPAWDNSRFLG 258

Query: 234 ILVPHTVST 242
           +  P    +
Sbjct: 259 V-APIPKRS 266


>gi|319426195|gb|ADV54269.1| Methyltransferase type 11 [Shewanella putrefaciens 200]
          Length = 244

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 88/240 (36%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G     A+++ L+  W  V G  LL LG      S     V    +   +  
Sbjct: 11  EQWEDLPNGAALEFAVAEKLAHWWPRVFGYHLLKLGPLSAALSSMESPVAHHFSLSSSQD 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++ +    +LPL +  +D V+M   LEF  DP+ +L E  RVL +GG +
Sbjct: 71  -----------ASIIGDFCHLPLQNGVIDAVVMSLLLEFEPDPYRILRETDRVLIAGGYL 119

Query: 129 IVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N          W + +     +G+ +   ++   L    + +    R ++ P   
Sbjct: 120 FIVGFNPLSPVFLGKLWPKYQDCLPWNGRFFMPSRVRDWLGLLGYQVVSDERLVYHPLIG 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +          ++    + P    +Y+I ARK+     PI + +K    +         +
Sbjct: 180 EF---NEGRFLQQTLASWLPSTGSLYLIVARKLESPLTPIRDKRKVLQPNWSTASSAGRS 236


>gi|120554455|ref|YP_958806.1| methyltransferase type 11 [Marinobacter aquaeolei VT8]
 gi|120324304|gb|ABM18619.1| Methyltransferase type 11 [Marinobacter aquaeolei VT8]
          Length = 269

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 77/241 (31%), Gaps = 12/241 (4%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
             ++  + LG+    +   VL      +TG R L +G +            + +   PA 
Sbjct: 16  FERWVQTPLGRSLLASQRAVLDKELQGLTGARQLQVGLSHRLPLASGTDFAQKIITCPA- 74

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                W        A+     LP    S+D V++ H  +F+ DP  +L E  RVL   GR
Sbjct: 75  -----WHAHMPEGVAVCDADELPFPGDSMDLVILHHTADFSPDPHQVLRESARVLRGEGR 129

Query: 128 MIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLS-ITSRSLFFPPT 181
           + +V  N   +W               G+     +M   LR   F L    +     P  
Sbjct: 130 IALVGFNPLSLWGARRLVSRHRFGPWGGRFLMRSRMEDWLRLLGFELENSGTYFCTLPLQ 189

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
            K                        Y I ARK  Y  +    S +K     +     VS
Sbjct: 190 RKHGASGRRQRLAASSRPHLLPTGAYYCILARKREYARIRTRASWRKSKVISLPGTVGVS 249

Query: 242 T 242
           +
Sbjct: 250 S 250


>gi|254234908|ref|ZP_04928231.1| hypothetical protein PACG_00783 [Pseudomonas aeruginosa C3719]
 gi|126166839|gb|EAZ52350.1| hypothetical protein PACG_00783 [Pseudomonas aeruginosa C3719]
          Length = 253

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R ++   LG        ++L        G  L+  G   P         +          
Sbjct: 22  RDWFQGPLGSLMLAEERRLLCDELTRYFGGYLVHYG---PHAELPPSTGQIQRGV----- 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                            EG  PL++ + D VL+ H L+F   P  +L E  R +  GG +
Sbjct: 74  ---RLGPPLPGVDIACEEGAWPLSEHAADVVLLQHGLDFCLSPHRLLREAARTVRPGGHL 130

Query: 129 IVVVPNKRGMWARMEHTPF---GSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +++  N   +W    +         +     +    L    F L       + PP     
Sbjct: 131 LLIGINPWSLWGIRHYFAGDALRQARCIPPSRACDWLNLLGFALEKRRFGCYRPPLASAA 190

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
                +  E+ G+ +    AG Y++ ARK++    P+ +SK++     + +P    +
Sbjct: 191 WQSRLARLERWGDAWQSSGAGFYLLVARKLIVGLRPLRQSKREPRGQLVPMPVAKVS 247


>gi|119476001|ref|ZP_01616353.1| generic methyl-transferase [marine gamma proteobacterium HTCC2143]
 gi|119450628|gb|EAW31862.1| generic methyl-transferase [marine gamma proteobacterium HTCC2143]
          Length = 268

 Score =  112 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 71/227 (31%), Gaps = 21/227 (9%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L Q++ S  G         ++        G  LL L            +V+      P+ 
Sbjct: 18  LEQWFDSDRGVRILRQQQVLIDELLGSCFGYHLLQLSIDSRPRLFRDCRVQYKYRAHPSA 77

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                      S+  L     LP A+ S+D V++ H  EF ++P  +L EI RV+   GR
Sbjct: 78  ----------ISADVLSDFEQLPFANESLDIVIVHHVQEFIDNPHQLLREINRVVVPHGR 127

Query: 128 MIVVVPNKRGMWARMEHTPF------GSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           +IVV  N                            +M   L    F  SI       P  
Sbjct: 128 VIVVGFNPWSPLGVFSRVGHWLPGSIWHNHLIGVGRMQDWLALLGFGASIKYYGHHSPSL 187

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
             K          ++   +   F   YVI A K      PI    ++
Sbjct: 188 LAKI---NKPWLARLLKHW--PFGSFYVISAIKEELTMTPIRPRWRQ 229


>gi|163752242|ref|ZP_02159443.1| hypothetical protein KT99_11388 [Shewanella benthica KT99]
 gi|161327872|gb|EDP99051.1| hypothetical protein KT99_11388 [Shewanella benthica KT99]
          Length = 239

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 88/240 (36%), Gaps = 20/240 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R +     G+    ++ + L++ W  V G  +L LG            + R  +      
Sbjct: 7   RTWSQLPNGENIKASVEQELASWWPRVFGYHMLSLGPLSAELKMPGLPIGRQFSLFD--- 63

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      +T       LP+ +  +D V+M   LEF  DP+ +L E  RVL SGG +
Sbjct: 64  --------GDGATLRAEFNALPIQNGVIDAVVMNMLLEFEYDPYKLLRETDRVLISGGYL 115

Query: 129 IVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N            + +      G+ ++  ++   L    + +    R +      
Sbjct: 116 FIVGFNPLSPAFIGKVLPKYQDKLPWCGRFFTPSRVKDWLGLLGYQVVADERIIHHHLLS 175

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +   ++  S+++     + PG   +Y+I ARK+      I E +K    +    P    T
Sbjct: 176 E---IRQQSIWQNALKAWLPGTGSVYLIVARKLETPLTRIHERQKVRQPNWTAAPSAGRT 232


>gi|312960547|ref|ZP_07775053.1| hypothetical protein PFWH6_2453 [Pseudomonas fluorescens WH6]
 gi|311285073|gb|EFQ63648.1| hypothetical protein PFWH6_2453 [Pseudomonas fluorescens WH6]
          Length = 252

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 79/235 (33%), Gaps = 14/235 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++ S  +G+   +    +L        G  L+  G +                  P  Q
Sbjct: 21  REWLSGPIGQFLLEEERHMLEDELGRFFGGYLVHYGPSAQTPPPA-----------PQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRPGGHL 129

Query: 129 IVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           ++V  N    W       H      +  +  ++   L    F L       + PP     
Sbjct: 130 LIVGINPWSTWGLRHVFAHDGLRQARCIAPSRVADWLNLLGFALEKRRFGCYRPPLASIT 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                + +E+    +     G Y++ ARKI+    P+ +  ++ +   + +P   
Sbjct: 190 WQGRLAGWERRAGAWQLSGGGFYLLVARKIVVGLRPVRQVARQPMGKLVPMPMAK 244


>gi|157375127|ref|YP_001473727.1| hypothetical protein Ssed_1990 [Shewanella sediminis HAW-EB3]
 gi|157317501|gb|ABV36599.1| conserved hypothetical protein [Shewanella sediminis HAW-EB3]
          Length = 244

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 20/239 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            Q+     G      I K L+  W  V G  +L LG            + R  +      
Sbjct: 11  EQWSQLPNGDTIKRHIEKELAPWWPKVFGYHMLSLGALSAELDMPGLPIGRRFSLFDGEG 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
            A                  LP+ +  +D V+M   LEF  DP+ +L E  RVL SGG +
Sbjct: 71  AALRA-----------DFSELPIQNGVIDAVVMNMLLEFEPDPYKLLRETDRVLISGGYL 119

Query: 129 IVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            ++  N            + +      G+ +   ++   L    + +    R L+     
Sbjct: 120 FIIGFNPLSPAFIGKILPKQQEALPWCGRFFMPSRVKDWLGLLGYRVVGDERLLYHHMLS 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
               +   S+++     + PG   +Y+I ARK+     PI E +K         P    
Sbjct: 180 D---INQDSIWQHALKAWLPGSGSLYLIVARKLESPLTPIHEKRKIRQPKWSTAPSAGR 235


>gi|88813347|ref|ZP_01128585.1| methyl-transferase [Nitrococcus mobilis Nb-231]
 gi|88789405|gb|EAR20534.1| methyl-transferase [Nitrococcus mobilis Nb-231]
          Length = 244

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 88/232 (37%), Gaps = 16/232 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           + +++ + LG    +A  ++LS     +   R+L +G              R        
Sbjct: 4   IHEWFCTPLGYSVVEAECRLLSQRLACLHARRVLQVGGFGGGQRPALFCGARQWVLE--- 60

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                            S   LP  + ++D V+++H LEF++ P  +L E  RVL+  G 
Sbjct: 61  ------NWLGGPVDIAASPVELPFQNETMDVVVLIHQLEFSDKPHQILREAERVLSPEGH 114

Query: 128 MIVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           ++V+  N   +W        R    P  +G+  S  ++   +R     +    R  F PP
Sbjct: 115 LLVLGFNPFSLWGLRYLFTRRRCCGPPWTGRYRSQARIEDWMRLLGLKIECRERLYFRPP 174

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            + + +L      E+ G  +     GI++    K +   +P    ++  ++ 
Sbjct: 175 LNNRTMLGRLRQLEEFGPRYLHWLGGIHLTVGHKRVAGMIPAQPLRQPRLTV 226


>gi|119775018|ref|YP_927758.1| hypothetical protein Sama_1883 [Shewanella amazonensis SB2B]
 gi|119767518|gb|ABM00089.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 240

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 79/237 (33%), Gaps = 20/237 (8%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           + +         A+   L+  W  V G  LL +G            +   ++   A  G 
Sbjct: 8   WQALPAHPQLQAAVENTLNAWWPKVFGYHLLKMGAFSSAIDTHRCSISHQISLDCAPGG- 66

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                             LP  ++ +D  LM   LEF EDP+ +L E  RVL SGG + +
Sbjct: 67  ----------GVQADFHQLPFQNACIDAALMSLLLEFEEDPYRILRETDRVLISGGYLFI 116

Query: 131 VVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           V  N             +       G+ +   ++   L    + +    R  + P     
Sbjct: 117 VGFNPLSSLFFGKLLPSLRQRAPWHGRFFLPSRVRDWLSVLGYQVISDERFFYHPLIGDP 176

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                ++ ++ + + + PG   +Y++ ARK+     P+ +  K              
Sbjct: 177 ---NRFAFWQDVLHAWLPGAGSLYLLVARKVDIPLTPLADKWKVAQPKWTTAATAGR 230


>gi|212223926|ref|YP_002307162.1| UbiE/COQ5 methyltransferase [Thermococcus onnurineus NA1]
 gi|212008883|gb|ACJ16265.1| UbiE/COQ5 methyltransferase [Thermococcus onnurineus NA1]
          Length = 223

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 78/214 (36%), Gaps = 10/214 (4%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
              +Y +  G+        ++ +     +G + L LG     ++    +    +  + A 
Sbjct: 12  YDDWYRTKTGQYVDRTEKWLVFSMLQTKSG-KALDLGCGTGNYTLELKRRGFDVIGLDAS 70

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           +G          +       +LP  D S D VL V   EF  +P  ++ EI RVL  GG 
Sbjct: 71  EGMLEIAMAKGLNCIKGDAYSLPFPDESFDLVLSVTMFEFIHEPEKVIAEIHRVLKPGGE 130

Query: 128 MIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +++   N R  W   +        T +   + Y+  ++  LL+   FT   ++  +FFP 
Sbjct: 131 VLIGTMNGRSPWFFFKRLKSLFVETAYRYARFYTPRELELLLKNGGFTEVESAGVIFFPS 190

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                 L +    +K  +      A    +   K
Sbjct: 191 FW--PFLDVAERIDKKCHRKCRNLAAFIAVRGVK 222


>gi|315230427|ref|YP_004070863.1| methyltransferase [Thermococcus barophilus MP]
 gi|315183455|gb|ADT83640.1| methyltransferase [Thermococcus barophilus MP]
          Length = 225

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 82/225 (36%), Gaps = 14/225 (6%)

Query: 2   RVDIVELR--QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIP-FFSCFHGKVE 58
             D +  R   +Y + +G+       +++ +      G R L LG     +    + +  
Sbjct: 4   YFDKIAYRYDAWYQTKVGQYVDRTEKRLIFSMIKTKRG-RALDLGCGTGNYTLELYRRGF 62

Query: 59  RTLAFMPAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
             +    + +       +         +  NLP    + D VL V   EF  +P  +L+E
Sbjct: 63  DVIGVDLSQEMLKIAKAKIPDVLFIRANAYNLPFKKEAFDLVLSVTMFEFIHEPEKVLNE 122

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFTLS 170
           I+R+L  GG +++   N + +W   +        T +   + Y+  ++ SLL  A F+  
Sbjct: 123 IYRILKLGGEVVIGTMNGKSLWFLFKRVKSLFVETAYRYARFYTSKELESLLANAGFSDV 182

Query: 171 ITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
            +   +FFP       + +    ++  N           +   K 
Sbjct: 183 ESKSVIFFPSF--FPFVGIAEKVDRKVNKKLKNLGAFIAVRGVKK 225


>gi|330810142|ref|YP_004354604.1| hypothetical protein PSEBR_a3285 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378250|gb|AEA69600.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 252

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 81/239 (33%), Gaps = 14/239 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I   R++ S  +G+   +    +L        G  L+  G +                  
Sbjct: 17  ISAAREWLSGPVGQFLLEEERHMLEDELGRFFGGYLVHYGPSAQTPPSA----------- 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P  Q              +  E   PL++ + D V+M H L+F   P  +L E    +  
Sbjct: 66  PQVQRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVMQHGLDFCLSPHGLLREAASSVRP 125

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG ++++  N    W       H      +  S  ++   L    F L       + PP 
Sbjct: 126 GGHLLIIGINPWSAWGLRHVFAHDALRQARCISASRVGDWLNLLGFALEKRRFGCYRPPL 185

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                    + +E+    +     G Y++ ARKI     P+ +++++ +   I +P   
Sbjct: 186 ASPKWQARLAGWERKAGDWQLSGGGFYLLVARKIAVGLRPVRQARREPMGKLIPLPMAK 244


>gi|120611320|ref|YP_970998.1| type 11 methyltransferase [Acidovorax citrulli AAC00-1]
 gi|120589784|gb|ABM33224.1| Methyltransferase type 11 [Acidovorax citrulli AAC00-1]
          Length = 251

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 76/236 (32%), Gaps = 25/236 (10%)

Query: 31  TWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM-------PAGQGATNWPDQYFSST-A 82
              DV G   L LG         +    R LA         P        P         
Sbjct: 1   MVADVFGFHALQLGMPGLQGLRANRMPHRWLALGAAEALLWPPPAQVEPGPADGPVRAAL 60

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM 142
           L     LP  ++S+D VL+ H LE + DP   L E+ RVL   GR++V   N   +W   
Sbjct: 61  LADPVALPFPENSLDLVLLPHALELSVDPHAALREVHRVLVPEGRLVVSGLNPVSLWGLR 120

Query: 143 EHTPFGSGQ--------------PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           +       +                  +++   LR  NF +   S   + P       L 
Sbjct: 121 QRRVRLYQRLGAGGRLYLPDVGEFIGHWRLRDWLRLLNFEIETISFGAYRPAVRSARWLD 180

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK---KHISSPILVPHTVS 241
            +   + +G  + P     Y++ A K ++    +  S +      +    VP    
Sbjct: 181 RYEWLDAVGARWWPILGAAYMVVAVKRVHGMRLLEPSWRTGQAPQARAATVPVAQR 236


>gi|311694695|gb|ADP97568.1| generic methyl-transferase [marine bacterium HP15]
          Length = 264

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/228 (16%), Positives = 74/228 (32%), Gaps = 11/228 (4%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
             +++ + LG+       + +      +TG R L +G +            + +   P  
Sbjct: 16  FERWFQTPLGRALLADQRRFVDAELQRLTGARQLQVGISHRLPLATGTDFSQKIMTAP-- 73

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                W        A+     L     S+D V++ H  +F+  P  ++ E  RVL   G 
Sbjct: 74  ----RWYPHIPDGVAICDADELAFPGDSMDLVVLHHTADFSPYPHQVIREAARVLRGEGT 129

Query: 128 MIVVVPNKRGMWARME-----HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           M +   N   +W   +           G+     +M   L    F +  +    F PP  
Sbjct: 130 MALFGFNPLSLWGARKLISRSSEGPWGGRFLLRGRMEDWLHLLGFNVEASITRFFRPPLQ 189

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
           +        +  ++           Y I A+K ++  LP     ++  
Sbjct: 190 RSGRKPTSRIDNRLSGNRLLPVGAYYCILAKKRVHARLPRRPVWRQSK 237


>gi|85058568|ref|YP_454270.1| hypothetical protein SG0590 [Sodalis glossinidius str. 'morsitans']
 gi|84779088|dbj|BAE73865.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 242

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 76/239 (31%), Gaps = 26/239 (10%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G     A+ + L   W  + G  LL +G            +            
Sbjct: 15  SWDDIPCGAYYRQALEQGLKAWWPKLFGFHLLKIGALSADLDTSDCAISHQ--------- 65

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N   +      +     LP A+ S D  L+ H L +  DP  +L E+ RVL   G ++
Sbjct: 66  -VNVGLEGECLQVIADPYQLPFANKSADVCLLAHTLSYTGDPHRLLREVDRVLIDDGWLV 124

Query: 130 VVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   M    +             + Y+  +++  L   NF +   +     P    
Sbjct: 125 ITTFNPVSMLGLGKICPVLFRRQPYRSRMYTQMRLLDWLGVLNFEVLHRTHLQVLP---- 180

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
               +      ++ +   P    + VI ARK  +    +T  K    S  +  P   +T
Sbjct: 181 --WRRQGG---RLLSTHFPAIGCLSVIVARKRTFPLS-LTPLKNSTPSRGLSRPVNATT 233


>gi|78485272|ref|YP_391197.1| hypothetical protein Tcr_0927 [Thiomicrospira crunogena XCL-2]
 gi|78363558|gb|ABB41523.1| hypothetical protein Tcr_0927 [Thiomicrospira crunogena XCL-2]
          Length = 261

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 83/229 (36%), Gaps = 18/229 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L +F+ S  G         ++      V G  L+ LG         + +    +      
Sbjct: 10  LYRFFQSPKGHSLLQQEKALIDQALAQVFGLYLVQLGIVSSDDLLANSRANCKVMID--- 66

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
               +W     +     +   LPL   S+D V++ H LE   DP+ +L ++  VL + G 
Sbjct: 67  ---NHWQRFQGARFVAANVDYLPLKSDSIDVVVLPHTLEAVTDPYHILRQVDDVLIAEGN 123

Query: 128 MIVVVPNKRGMWARMEHTPFGSGQPYSWY-------QMISLLREANFTLSITSRSLFFPP 180
           +++   N  G   R+    FG  +PY          ++I  L    + + + S +     
Sbjct: 124 VLITGFNPAGC--RIMRNLFGEHRPYFKKANLIRAHRIIDWLNVLGYDIEMVSYTSPSCL 181

Query: 181 THKKCILKLWSV---FEKIGNIFGPGFAGIYVIEARKILYQGLPITESK 226
                  K W+    FE++    G  F   Y I A+K +    P+  + 
Sbjct: 182 MKSDSSEKRWAWVESFERLLEKMGLNFGNTYCILAKKRVSSPTPVGLNW 230


>gi|167623802|ref|YP_001674096.1| type 11 methyltransferase [Shewanella halifaxensis HAW-EB4]
 gi|167353824|gb|ABZ76437.1| Methyltransferase type 11 [Shewanella halifaxensis HAW-EB4]
          Length = 246

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 86/239 (35%), Gaps = 20/239 (8%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G     ++ + LS  W  + G  +L LG            + +  +     Q
Sbjct: 11  YHWSELPNGPVIRQSVEQALSPWWPRIFGYYMLNLGPLSHKIDKIGVGISKQYSLFDQPQ 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ++      +LP+ + S+D V+M   LEF  DP+ +L E+ RVL SGG +
Sbjct: 71  -----------ASIEGDYSHLPIQNISIDAVVMNFILEFEADPYRLLREVDRVLISGGHL 119

Query: 129 IVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N            + +     +G+ +   ++   L    + +    R L      
Sbjct: 120 VITGFNPLSPMFVGKMLPKHQQEIPWNGRFFMPSRVKDWLGLLGYQVVADERLLHHHLLT 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           +    K+ +++      + P    IYV+ A+K+     PI   +K    +    P    
Sbjct: 180 EA---KINNIWSHALKSWLPSIGSIYVLVAKKLETPLTPIQARRKVKQRNWSTAPSAGR 235


>gi|300715434|ref|YP_003740237.1| methyltransferase type 11 [Erwinia billingiae Eb661]
 gi|299061270|emb|CAX58379.1| Methyltransferase type 11 [Erwinia billingiae Eb661]
          Length = 246

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 84/240 (35%), Gaps = 26/240 (10%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+   DA++K L      + G  LL +G+           +   +    +G+
Sbjct: 14  DSWAEIPWGEFYRDALNKHLQPCLAKLYGFHLLKVGHLSAEIDTESCAISHQVNVGLSGE 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           G                  +LP    SVD  L+ H L ++ DP  +L E+ RVL   G +
Sbjct: 74  GLQ----------VKADPMSLPFESKSVDACLLAHCLAWSSDPHRILREVDRVLIDDGWI 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +      + + ++  +++  L   N+ +   +R    P   
Sbjct: 124 IISGFNPFSVLGIGKLIPGIHKRVPWNSRMFTQMRLMDWLSLLNYEVVQRTRFQVVPWNR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +           K+ +   P    + +I ARK  +  + +  +K+      I      ++
Sbjct: 184 QGG---------KVISTHFPALGCLSIIVARKRTFPLI-MNPAKRAAAKRRITSAVGATS 233


>gi|157369155|ref|YP_001477144.1| type 11 methyltransferase [Serratia proteamaculans 568]
 gi|157320919|gb|ABV40016.1| Methyltransferase type 11 [Serratia proteamaculans 568]
          Length = 239

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 77/230 (33%), Gaps = 25/230 (10%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           + +     G+   +A+ + L   W  + G  LL LG      +     +   +     GQ
Sbjct: 14  QSWAELPWGEYYREALERQLQPWWSKLFGFHLLKLGNLSASLATDKCAISHQVNVALEGQ 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +     LP A  SVD  L+ H L +A+DP  ML E+ RVL   G +
Sbjct: 74  NLQ----------VIADAYQLPFAAKSVDACLLAHTLSYADDPHRMLREVDRVLIDDGWL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +         + H    + + ++  +++  L   N+ +   SR    P   
Sbjct: 124 VISSFNPFSLLGLGKLVPGLRHRQPYASRMFTQMRLLDWLSLLNYEVLHQSRFHVLPWQR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           K           K      P    + VI ARK      P          +
Sbjct: 184 KGG---------KFLCTHLPALGCMSVIVARKRTLPLTPTPMKFGARKPA 224


>gi|240102995|ref|YP_002959304.1| SAM-dependent methyltransferase [Thermococcus gammatolerans EJ3]
 gi|239910549|gb|ACS33440.1| SAM-dependent methyltransferase [Thermococcus gammatolerans EJ3]
          Length = 223

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 84/222 (37%), Gaps = 12/222 (5%)

Query: 2   RVD-IVE-LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
             D I +    +Y +  G+        ++ +     +G   L LG     ++    +   
Sbjct: 4   YFDRIADRYDDWYRTRTGRYVDRIEKWLVFSMLRTKSGE-ALDLGCGTGNYTLELKRRGF 62

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  + A +G          +    +  +LP  D S D VL V   EF  +P  +L EI+
Sbjct: 63  DVIGLDASEGMLRIARSKGLNCIKGNAYSLPFPDESFDLVLSVTMFEFIHEPEKVLAEIY 122

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFTLSIT 172
           RVL  GG +++   N R +W   +        T +   + Y+  ++ +LLR A F    +
Sbjct: 123 RVLKPGGEVLIGTMNGRSLWFLFKRLKSLFMETAYRYARFYTPRELEALLRGAGFKNVES 182

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           +  +FFP       L L    +K       G A    +   K
Sbjct: 183 AGVIFFPSFW--PFLDLAEKVDKKCYKKCKGIAAFIAVRGEK 222


>gi|254514369|ref|ZP_05126430.1| SAM-dependent methyltransferase [gamma proteobacterium NOR5-3]
 gi|219676612|gb|EED32977.1| SAM-dependent methyltransferase [gamma proteobacterium NOR5-3]
          Length = 267

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 80/247 (32%), Gaps = 21/247 (8%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L  +Y++  G+   + I   L    D   G  +L  G   P  +             P  
Sbjct: 17  LESWYATEPGEELCEVIRARLEPVLDLSFGYHILQSG---PLPTRSLITQ------SPIN 67

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                      S++       LPL   SVD V+  H LEF E P   L E+ RVL   G 
Sbjct: 68  HQIFACSAVDRSASMFCHGDELPLESDSVDTVVAFHALEFDEHPHGSLREMQRVLRPHGH 127

Query: 128 MIVVVPNKRGMWARMEH---------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           +I+V  N   +    ++               +P S +++   LR  +  L         
Sbjct: 128 LIIVGFNPLSLLGASQYLRGLKKNSLWNRQRHRPVSLHRLTDWLRLLDCELESAQHLFPI 187

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS---PIL 235
           P   K    +     ++  +       GIY+  A K +         + +  +S     +
Sbjct: 188 PLVGKGRFRRAVGRVDEWASDHSLPGGGIYIAHAIKQIAGIRRPRSLRARARASFRGLSV 247

Query: 236 VPHTVST 242
            P    T
Sbjct: 248 APSPAPT 254


>gi|332306245|ref|YP_004434096.1| hypothetical protein Glaag_1882 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173574|gb|AEE22828.1| hypothetical protein Glaag_1882 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 249

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 80/239 (33%), Gaps = 22/239 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R + +   G      +   L        G  L+ +G      S     ++  +       
Sbjct: 14  RSWSALPNGAERKAMVENELEHITQQFFGYHLVKVGNLSSEVSLTKCSIKHCV------N 67

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                 D     +       + L +SSVD  ++VH L+FA+DP  +L E+ R +   G +
Sbjct: 68  MVAKAHDAAGMRSL---SREMALKESSVDGFVLVHELDFAQDPHQILREVDRAIMPDGDL 124

Query: 129 IVVVPNKRGMWARMEHTPFGS------GQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
            +V  N   +    +   F         + +S  ++   L+   F ++         P  
Sbjct: 125 AIVGFNPLSLTGLRKLMWFNRQSILHEARYFSVPRIKDWLQLLGFEVTQVKY----MPYS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           K    +  ++  +    F P  A +Y+I A+K      PI    K     P       S
Sbjct: 181 KFFTNRPNNIVTRWCQRFLPQLASVYIIVAKKRTVPLSPIKPKWK---LKPKFSAVGAS 236


>gi|126667362|ref|ZP_01738334.1| SAM-dependent methyltransferase [Marinobacter sp. ELB17]
 gi|126628118|gb|EAZ98743.1| SAM-dependent methyltransferase [Marinobacter sp. ELB17]
          Length = 260

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/236 (17%), Positives = 72/236 (30%), Gaps = 20/236 (8%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
              ++ + LG+       + L       TG R L +G +            + +  +P  
Sbjct: 16  FEHWFQTPLGRALLADQRQYLDHKLASHTGARQLQVGVSHRLPLATGTDFLQRIITVP-- 73

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                W        A+     LP    S+D V++ H  +F+  P  +L E  RVL   G 
Sbjct: 74  ----QWHSDIPGGVAVCDADELPFPGDSMDLVILPHTADFSRYPHQVLRESARVLRGEGC 129

Query: 128 MIVVVPNKRGMWARME---------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           + +   N   +W                   G+     +M   LR   F +  +    + 
Sbjct: 130 IAITGFNPFSVWGLRRLLSGRFGRPSGGPWGGRFMPAGRMEDWLRLLGFQIEHSVTRFYG 189

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
            P  +    +    ++  G          Y I ARK      P   +  K     +
Sbjct: 190 LPLQRCA--RNPVKWQPSG---FMPGGAYYCILARKRELARTPGRRAWSKRKVIRL 240


>gi|194432811|ref|ZP_03065096.1| putative methyltransferase [Shigella dysenteriae 1012]
 gi|293413468|ref|ZP_06656117.1| yafS protein [Escherichia coli B185]
 gi|194419073|gb|EDX35157.1| putative methyltransferase [Shigella dysenteriae 1012]
 gi|291433526|gb|EFF06499.1| yafS protein [Escherichia coli B185]
 gi|320179850|gb|EFW54796.1| hypothetical protein SGB_02965 [Shigella boydii ATCC 9905]
 gi|320638233|gb|EFX07961.1| hypothetical protein ECO5101_15255 [Escherichia coli O157:H7 str.
           G5101]
 gi|320643617|gb|EFX12761.1| hypothetical protein ECO9389_15429 [Escherichia coli O157:H- str.
           493-89]
 gi|320650353|gb|EFX18830.1| hypothetical protein ECO2687_14976 [Escherichia coli O157:H- str. H
           2687]
 gi|320654628|gb|EFX22629.1| hypothetical protein ECO7815_10227 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660196|gb|EFX27706.1| hypothetical protein ECO5905_08743 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665447|gb|EFX32509.1| hypothetical protein ECOSU61_12455 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323938756|gb|EGB35002.1| methyltransferase domain-containing protein [Escherichia coli
           E1520]
 gi|332097567|gb|EGJ02546.1| methyltransferase domain protein [Shigella dysenteriae 155-74]
          Length = 240

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|329114358|ref|ZP_08243120.1| Methyltransferase Type [Acetobacter pomorum DM001]
 gi|326696434|gb|EGE48113.1| Methyltransferase Type [Acetobacter pomorum DM001]
          Length = 257

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 93/230 (40%), Gaps = 2/230 (0%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCR-LLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            FY++  G+C    + + L   W D+     +LGLG+    +         T A + A  
Sbjct: 10  SFYTTARGQCFLALVGERLHWFWPDLGQQHAVLGLGH-TAAYLEKLENGRATPACLVAAN 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                     S + +V   +LP      D VLMVH L+  +    +L    +V+   GR+
Sbjct: 69  APLWGATSTPSLSCVVDLHSLPFQPKQFDRVLMVHALDDRQHSVSVLRAAGQVMKPDGRL 128

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           +++VP++ G  AR+  TPF     +S   +   L  A         +LF P    + +  
Sbjct: 129 LLIVPSRFGGRARLRGTPFRHDAAFSRRCLKQTLASAMLKPEQWDEALFLPTGAMRWMRH 188

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
                +  G +  PG   + ++EA +  Y  L +    ++   +  L+P 
Sbjct: 189 NGRKMDIAGKMLCPGAGSLILVEAVRDEYSALSLPVKARQRWLARSLLPV 238


>gi|291281030|ref|YP_003497848.1| hypothetical protein G2583_0217 [Escherichia coli O55:H7 str.
           CB9615]
 gi|331651118|ref|ZP_08352143.1| methyltransferase domain protein [Escherichia coli M718]
 gi|209745494|gb|ACI71054.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|209745500|gb|ACI71057.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|290760903|gb|ADD54864.1| hypothetical protein G2583_0217 [Escherichia coli O55:H7 str.
           CB9615]
 gi|331050859|gb|EGI22911.1| methyltransferase domain protein [Escherichia coli M718]
          Length = 246

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 16  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 68  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 125

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 126 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 185

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 235


>gi|104782588|ref|YP_609086.1| hypothetical protein PSEEN3560 [Pseudomonas entomophila L48]
 gi|95111575|emb|CAK16295.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 259

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 85/236 (36%), Gaps = 16/236 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPAG 67
           R ++   LG+       K+L        G  L+  G  A P  S             P  
Sbjct: 21  RDWFEGPLGQLMLKEEEKLLEEELRRFFGGYLVHYGPCAEPPPSA------------PQV 68

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q              +  E   PL++ + D V++ H L+F+  P  +L E    +  GG 
Sbjct: 69  QRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFSLSPHGLLREAASAVRPGGH 128

Query: 128 MIVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +++V  N    W        G+    +  S  ++   L    F L       + PP    
Sbjct: 129 LLIVGINPWSSWGIRHLFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASP 188

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              +  + +E++   +     G+Y++ ARK++    P+   +++ +   + +P   
Sbjct: 189 AWQQRLAGWERVAGGWQSAGGGVYLLVARKMVVGLRPLRLERREPMGKLLPLPLAK 244


>gi|89107088|ref|AP_000868.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|90111099|ref|NP_414749.2| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|170079844|ref|YP_001729164.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           coli str. K-12 substr. DH10B]
 gi|238899606|ref|YP_002925402.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BW2952]
 gi|256024148|ref|ZP_05438013.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia sp. 4_1_40B]
 gi|300949355|ref|ZP_07163367.1| methyltransferase domain protein [Escherichia coli MS 116-1]
 gi|300958302|ref|ZP_07170445.1| methyltransferase domain protein [Escherichia coli MS 175-1]
 gi|301029640|ref|ZP_07192702.1| methyltransferase domain protein [Escherichia coli MS 196-1]
 gi|301645472|ref|ZP_07245409.1| methyltransferase domain protein [Escherichia coli MS 146-1]
 gi|307136808|ref|ZP_07496164.1| putative methyltransferase [Escherichia coli H736]
 gi|6226919|sp|P75672|YAFS_ECOLI RecName: Full=Uncharacterized protein yafS
 gi|1552783|gb|AAB08635.1| hypothetical protein [Escherichia coli]
 gi|4902950|dbj|BAA77884.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K12 substr. W3110]
 gi|87081700|gb|AAC73318.2| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|169887679|gb|ACB01386.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|238863088|gb|ACR65086.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BW2952]
 gi|260450590|gb|ACX41012.1| Methyltransferase type 11 [Escherichia coli DH1]
 gi|299877467|gb|EFI85678.1| methyltransferase domain protein [Escherichia coli MS 196-1]
 gi|300315008|gb|EFJ64792.1| methyltransferase domain protein [Escherichia coli MS 175-1]
 gi|300451238|gb|EFK14858.1| methyltransferase domain protein [Escherichia coli MS 116-1]
 gi|301076261|gb|EFK91067.1| methyltransferase domain protein [Escherichia coli MS 146-1]
 gi|315134898|dbj|BAJ42057.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli DH1]
 gi|315616889|gb|EFU97506.1| methyltransferase domain protein [Escherichia coli 3431]
 gi|323943404|gb|EGB39556.1| methyltransferase domain-containing protein [Escherichia coli E482]
          Length = 240

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 77/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     GK    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGKLYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N                T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISFMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|311280822|ref|YP_003943053.1| Methyltransferase type 11 [Enterobacter cloacae SCF1]
 gi|308750017|gb|ADO49769.1| Methyltransferase type 11 [Enterobacter cloacae SCF1]
          Length = 240

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 77/234 (32%), Gaps = 27/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+   +A+ + L      + G  LL +G      +     +   +        
Sbjct: 15  HWAEMPWGEYYREALEQQLKPWLTKLYGFHLLKIGNLSAEINTEACAISHQVNVSL---- 70

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                        +     LP AD SVD  L+ H L + +DP  +L E  RVL   G +I
Sbjct: 71  ------GGEPRQVIADPLYLPFADKSVDACLLAHTLPWCQDPHRLLREADRVLIDDGWLI 124

Query: 130 VVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +            +   + + ++  + +  L   NF +    R    P   +
Sbjct: 125 MTGFNPVSLMGLRKLAPVLRGSMPYNSRMFTMMRQLDWLSLLNFEVLHHGRFQVLPWNRQ 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                      ++ +   P    + +I ARK        P+ +SK +    P +
Sbjct: 185 GG---------RLLSTHLPALGCLQLIVARKRTIPLTLNPMKQSKSRTQLRPAV 229


>gi|212635107|ref|YP_002311632.1| S-adenosyl-L-methionine-dependent methyltransferase [Shewanella
           piezotolerans WP3]
 gi|212556591|gb|ACJ29045.1| S-adenosyl-L-methionine-dependent methyltransferase, putative
           [Shewanella piezotolerans WP3]
          Length = 224

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 85/230 (36%), Gaps = 20/230 (8%)

Query: 19  CTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYF 78
              ++I +V+ + W  V G  +L LG            V    +     +          
Sbjct: 1   MIRESIEEVMFSWWPRVFGYYMLSLGPLSAKVDKTGVGVSCHYSLFDEPE---------- 50

Query: 79  SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            +  L     LP+ ++SVD V+M   LEF  DP+ +L E+ RVL SGG +I+   N    
Sbjct: 51  -ADILADYSQLPIQNASVDAVVMNFLLEFETDPYRLLREVDRVLISGGHLIIAGFNPLSP 109

Query: 139 W------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
                   + +     +G+ +   ++   L    + +    R L          LK  S+
Sbjct: 110 MFIGKMLPKYQQEIPWNGRFFMPSRVKDWLGLLGYQVVADERLLHHHLLKD---LKTDSI 166

Query: 193 FEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +      + P    +YV+ ARK+     P+   +K    +    P    T
Sbjct: 167 WSHALKSWLPSSGSVYVLVARKLETPLTPVRAKRKVKQPNWSTAPTAGRT 216


>gi|331640663|ref|ZP_08341810.1| methyltransferase domain protein [Escherichia coli H736]
 gi|331040037|gb|EGI12245.1| methyltransferase domain protein [Escherichia coli H736]
 gi|332341541|gb|AEE54875.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 246

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 77/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     GK    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 22  WGDLPWGKLYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 71

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 72  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 131

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N                T   + + ++  + +  L   NF +   SR    P     
Sbjct: 132 SGFNPISFMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 191

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 192 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 235


>gi|300936084|ref|ZP_07151026.1| methyltransferase domain protein [Escherichia coli MS 21-1]
 gi|300458759|gb|EFK22252.1| methyltransferase domain protein [Escherichia coli MS 21-1]
          Length = 240

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGLPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|218682274|ref|ZP_03529875.1| putative methyltransferase protein [Rhizobium etli CIAT 894]
          Length = 120

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 83/116 (71%)

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
           R+++VVPN+RG+WARMEHTPFGSG+PYS  Q+  LLRE NFT   T+ +LFFPP+  + I
Sbjct: 1   RLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTHLLRETNFTPGATAEALFFPPSKLRTI 60

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           L+L   FE+IG    P F+G+ ++EA+K LYQGLP+     + +  P+L PH V T
Sbjct: 61  LRLRRAFERIGRTLWPAFSGVIIVEAQKRLYQGLPVAARASRRVFVPVLAPHGVPT 116


>gi|317047019|ref|YP_004114667.1| type 11 methyltransferase [Pantoea sp. At-9b]
 gi|316948636|gb|ADU68111.1| Methyltransferase type 11 [Pantoea sp. At-9b]
          Length = 244

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 79/225 (35%), Gaps = 25/225 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R +     G    DA+++ L      + G  +L +G      +  H  +           
Sbjct: 14  RSWRDMPWGDYFRDALTQQLQPYLGKLYGFHMLKIGSLSAEINTSHCPISHQ-------- 65

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N  ++      +     LP    S+D  L+ H L +++DP  +L E+ RVL   G M
Sbjct: 66  --VNVGEEGDELQVIARATQLPFESKSIDACLLAHTLSWSQDPHRVLREVDRVLIDDGWM 123

Query: 129 IVVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +    +           SG+ +S  +++  L   N+ +   +R    P   
Sbjct: 124 IISGFNPFSLLGISKGIPGLHGRAPWSGRMFSQMRLLDWLHLLNYEVVYRTRFQVVPWHR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
           +           K+ +   P    + V+ ARK  +   P    K 
Sbjct: 184 QGG---------KVISAHLPALGCLNVVVARKRTFPLTPTKVKKS 219


>gi|309787112|ref|ZP_07681724.1| methyltransferase domain protein [Shigella dysenteriae 1617]
 gi|308924690|gb|EFP70185.1| methyltransferase domain protein [Shigella dysenteriae 1617]
          Length = 240

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 80/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +      NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWFSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|308049179|ref|YP_003912745.1| methyltransferase type 11 [Ferrimonas balearica DSM 9799]
 gi|307631369|gb|ADN75671.1| methyltransferase type 11 [Ferrimonas balearica DSM 9799]
          Length = 257

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 77/228 (33%), Gaps = 21/228 (9%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +   G    + +   L   W  + G  LL LG            V       P    
Sbjct: 16  SWQALPYGDWLKEQVESGLDEWWPRIFGYHLLKLGPLADTLPTRLCPVPHQFGLAPQRG- 74

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                      +       LPL ++S+D  L+   LEF +DP  +L E+ RVL SGG ++
Sbjct: 75  -----------SVRAELTRLPLQNASIDAALVPFCLEFQQDPHALLRELDRVLISGGHLV 123

Query: 130 VVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +V  +          W +  H    SG+ ++  ++   L    + +              
Sbjct: 124 LVGFSVLSPLAFGYLWPKHHHQFPWSGRLFTPGRVHDWLSLLGYRVLSHESLAHHTMLWS 183

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
               + +   ++      PGF  +Y+I ARK+     P  +       
Sbjct: 184 P---EKFPTAQRWLADLAPGFGSVYLIVARKMEAPLTPARQRWHLRRP 228


>gi|258541870|ref|YP_003187303.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256632948|dbj|BAH98923.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636005|dbj|BAI01974.1| methyltransferase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639060|dbj|BAI05022.1| methyltransferase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642114|dbj|BAI08069.1| methyltransferase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645169|dbj|BAI11117.1| methyltransferase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648224|dbj|BAI14165.1| methyltransferase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651277|dbj|BAI17211.1| methyltransferase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654268|dbj|BAI20195.1| methyltransferase [Acetobacter pasteurianus IFO 3283-12]
          Length = 257

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 96/230 (41%), Gaps = 2/230 (0%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCR-LLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            FY++  G+C    + + L   W D+     +LGLG+A  +        + T A + AG 
Sbjct: 10  SFYTTARGQCFLALVGERLRWFWPDLGQQHAVLGLGHAAAYL-EKLESGKNTPACLVAGN 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                       + +V   +LP      D VLMVH L+  +    +L    +V+   GR+
Sbjct: 69  APQWGAAPPLGRSCVVDMHSLPFQPEQFDRVLMVHALDDRKQSVSVLRAAGQVMKPDGRL 128

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           +++VP++ G  AR+  TPF     +S   +  +L  A         +LF P    + +  
Sbjct: 129 LLIVPSRFGGRARLRGTPFRHDAAFSRRCLRQMLAAAMLKPEQWDEALFLPTGAMRWMRH 188

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
                +  G +  PG   + ++EA +  Y  L +    ++   S  L+P 
Sbjct: 189 NGRKMDIAGKVLCPGAGSLILVEAVRDEYSALFLPVRLRQRWLSRSLLPV 238


>gi|82775599|ref|YP_401946.1| hypothetical protein SDY_0232 [Shigella dysenteriae Sd197]
 gi|81239747|gb|ABB60457.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 246

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 80/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 16  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 68  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 125

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +      NF +   SR    
Sbjct: 126 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWFSLLNFEVLHASRFHVL 185

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 235


>gi|170021439|ref|YP_001726393.1| methyltransferase type 11 [Escherichia coli ATCC 8739]
 gi|187730232|ref|YP_001879010.1| putative methyltransferase [Shigella boydii CDC 3083-94]
 gi|191167055|ref|ZP_03028877.1| putative methyltransferase [Escherichia coli B7A]
 gi|194438242|ref|ZP_03070334.1| putative methyltransferase [Escherichia coli 101-1]
 gi|209917400|ref|YP_002291484.1| hypothetical protein ECSE_0209 [Escherichia coli SE11]
 gi|253774765|ref|YP_003037596.1| methyltransferase type 11 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254160327|ref|YP_003043435.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli B str. REL606]
 gi|297518676|ref|ZP_06937062.1| putative methyltransferase [Escherichia coli OP50]
 gi|300823398|ref|ZP_07103528.1| methyltransferase domain protein [Escherichia coli MS 119-7]
 gi|300927905|ref|ZP_07143465.1| methyltransferase domain protein [Escherichia coli MS 187-1]
 gi|309797928|ref|ZP_07692308.1| methyltransferase domain protein [Escherichia coli MS 145-7]
 gi|331666454|ref|ZP_08367334.1| methyltransferase domain protein [Escherichia coli TA271]
 gi|169756367|gb|ACA79066.1| Methyltransferase type 11 [Escherichia coli ATCC 8739]
 gi|187427224|gb|ACD06498.1| putative methyltransferase [Shigella boydii CDC 3083-94]
 gi|190902948|gb|EDV62675.1| putative methyltransferase [Escherichia coli B7A]
 gi|194422906|gb|EDX38901.1| putative methyltransferase [Escherichia coli 101-1]
 gi|209910659|dbj|BAG75733.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|242376043|emb|CAQ30728.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BL21(DE3)]
 gi|253325809|gb|ACT30411.1| Methyltransferase type 11 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253972228|gb|ACT37899.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli B str. REL606]
 gi|253976437|gb|ACT42107.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli BL21(DE3)]
 gi|300464060|gb|EFK27553.1| methyltransferase domain protein [Escherichia coli MS 187-1]
 gi|300524016|gb|EFK45085.1| methyltransferase domain protein [Escherichia coli MS 119-7]
 gi|308118468|gb|EFO55730.1| methyltransferase domain protein [Escherichia coli MS 145-7]
 gi|320173693|gb|EFW48882.1| hypothetical protein SDB_03795 [Shigella dysenteriae CDC 74-1112]
 gi|320186399|gb|EFW61131.1| hypothetical protein SGF_01403 [Shigella flexneri CDC 796-83]
 gi|323963576|gb|EGB59133.1| methyltransferase domain-containing protein [Escherichia coli H489]
 gi|323972505|gb|EGB67711.1| methyltransferase domain-containing protein [Escherichia coli
           TA007]
 gi|324020675|gb|EGB89894.1| methyltransferase domain protein [Escherichia coli MS 117-3]
 gi|324115457|gb|EGC09399.1| methyltransferase domain-containing protein [Escherichia coli
           E1167]
 gi|331066299|gb|EGI38177.1| methyltransferase domain protein [Escherichia coli TA271]
 gi|332093745|gb|EGI98800.1| methyltransferase domain protein [Shigella boydii 3594-74]
          Length = 240

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|74310828|ref|YP_309247.1| hypothetical protein SSON_0227 [Shigella sonnei Ss046]
 gi|331675871|ref|ZP_08376588.1| methyltransferase domain protein [Escherichia coli H591]
 gi|73854305|gb|AAZ87012.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|331076431|gb|EGI47708.1| methyltransferase domain protein [Escherichia coli H591]
          Length = 246

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 16  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 68  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLID 125

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 126 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 185

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 235


>gi|304395365|ref|ZP_07377248.1| Methyltransferase type 11 [Pantoea sp. aB]
 gi|304356659|gb|EFM21023.1| Methyltransferase type 11 [Pantoea sp. aB]
          Length = 245

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 79/224 (35%), Gaps = 25/224 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+   DA+++ L      + G  +L LG      +  +  +            
Sbjct: 15  SWRDMPWGEYFRDALTQQLQPYLGKLYGFHMLKLGNLSAEINTENCAISHQ--------- 65

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N   +      L     LP    SVD  LM H L +++DP  +L E+ RVL   G MI
Sbjct: 66  -VNVGSKGEQLQVLADPMQLPFESKSVDACLMAHTLAWSQDPHRVLREVDRVLIDDGWMI 124

Query: 130 VVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +    +           SG+ +S  +++  L   N+ +   +R    P   +
Sbjct: 125 ISGFNPFSLLGVSKMVPGLTRKAPWSGRMFSQMRLLDWLGLLNYEVVYRTRFQVLPWHRQ 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
                      K+ +   P    + ++ ARK  +  LP    K 
Sbjct: 185 GG---------KLISAHLPALGCLNIVVARKRTFPLLPTRAKKS 219


>gi|254468296|ref|ZP_05081702.1| generic methyl-transferase [beta proteobacterium KB13]
 gi|207087106|gb|EDZ64389.1| generic methyl-transferase [beta proteobacterium KB13]
          Length = 216

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 79/227 (34%), Gaps = 29/227 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           ++ +  G        K+L   +D + G  ++ +G                 + +      
Sbjct: 3   WFETKRGSDLLLLEQKILDQLFDHLFGYNIVQIG--------------NHRSLIENS--- 45

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
             + ++Y           LP    ++DC+++ H  +  ED   ML E++R L   G  I 
Sbjct: 46  -RFKNKYTCKQIQFDAEQLPFESDAIDCIVLPH--QNTED-ERMLSEVYRSLMPHGHAIF 101

Query: 131 VVPNKRGMWARM-----EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           +  N                   +    S+    + L + +F +       + P      
Sbjct: 102 INFNPWSPIGLRTFFSMSSEEPWNHNLESFTSFQNKLLKQDFEIVNGKFFGYHPRFKSA- 160

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                S ++KIG+ + P FA IY+I  RK ++   PI  S    I  
Sbjct: 161 --SNKSRWDKIGDRWFPLFANIYLIVVRKKIFTMTPIKPSWNGKIQR 205


>gi|260853418|ref|YP_003227309.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260866356|ref|YP_003232758.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|300926567|ref|ZP_07142353.1| methyltransferase domain protein [Escherichia coli MS 182-1]
 gi|257752067|dbj|BAI23569.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|257762712|dbj|BAI34207.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|300417425|gb|EFK00736.1| methyltransferase domain protein [Escherichia coli MS 182-1]
 gi|323157952|gb|EFZ44054.1| methyltransferase domain protein [Escherichia coli EPECa14]
          Length = 240

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|168750161|ref|ZP_02775183.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4113]
 gi|168757206|ref|ZP_02782213.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4401]
 gi|168763421|ref|ZP_02788428.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4501]
 gi|168769976|ref|ZP_02794983.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4486]
 gi|168776183|ref|ZP_02801190.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4196]
 gi|168782938|ref|ZP_02807945.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4076]
 gi|168789656|ref|ZP_02814663.1| putative methyltransferase [Escherichia coli O157:H7 str. EC869]
 gi|168800385|ref|ZP_02825392.1| putative methyltransferase [Escherichia coli O157:H7 str. EC508]
 gi|195938585|ref|ZP_03083967.1| hypothetical protein EscherichcoliO157_19512 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807621|ref|ZP_03249958.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4206]
 gi|208813101|ref|ZP_03254430.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4045]
 gi|208820247|ref|ZP_03260567.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4042]
 gi|209400502|ref|YP_002268816.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4115]
 gi|217325276|ref|ZP_03441360.1| putative methyltransferase [Escherichia coli O157:H7 str. TW14588]
 gi|254791340|ref|YP_003076177.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|261223756|ref|ZP_05938037.1| hypothetical protein EscherichiacoliO157_04001 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255834|ref|ZP_05948367.1| hypothetical protein EscherichiacoliO157EcO_08383 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|187768438|gb|EDU32282.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4196]
 gi|188015547|gb|EDU53669.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4113]
 gi|188999591|gb|EDU68577.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4076]
 gi|189355698|gb|EDU74117.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4401]
 gi|189361092|gb|EDU79511.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4486]
 gi|189366413|gb|EDU84829.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4501]
 gi|189370727|gb|EDU89143.1| putative methyltransferase [Escherichia coli O157:H7 str. EC869]
 gi|189377314|gb|EDU95730.1| putative methyltransferase [Escherichia coli O157:H7 str. EC508]
 gi|208727422|gb|EDZ77023.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4206]
 gi|208734378|gb|EDZ83065.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4045]
 gi|208740370|gb|EDZ88052.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4042]
 gi|209161902|gb|ACI39335.1| putative methyltransferase [Escherichia coli O157:H7 str. EC4115]
 gi|217321497|gb|EEC29921.1| putative methyltransferase [Escherichia coli O157:H7 str. TW14588]
 gi|254590740|gb|ACT70101.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|320190266|gb|EFW64916.1| hypothetical protein ECoD_01678 [Escherichia coli O157:H7 str.
           EC1212]
 gi|326338811|gb|EGD62630.1| putative methyltransferase [Escherichia coli O157:H7 str. 1044]
          Length = 240

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFYLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|15799889|ref|NP_285901.1| hypothetical protein Z0237 [Escherichia coli O157:H7 EDL933]
 gi|15829463|ref|NP_308236.1| hypothetical protein ECs0209 [Escherichia coli O157:H7 str. Sakai]
 gi|12512941|gb|AAG54509.1|AE005196_7 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13359665|dbj|BAB33632.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|209745496|gb|ACI71055.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|209745498|gb|ACI71056.1| hypothetical protein ECs0209 [Escherichia coli]
 gi|209745502|gb|ACI71058.1| hypothetical protein ECs0209 [Escherichia coli]
          Length = 246

 Score =  105 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 16  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFYLLKIG--------NLSAEINCEACA 67

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 68  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 125

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 126 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 185

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 235


>gi|254172255|ref|ZP_04878931.1| methionine biosynthesis protein MetW [Thermococcus sp. AM4]
 gi|214034151|gb|EEB74977.1| methionine biosynthesis protein MetW [Thermococcus sp. AM4]
          Length = 222

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/222 (20%), Positives = 80/222 (36%), Gaps = 12/222 (5%)

Query: 2   RVD-IVE-LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER 59
             D I +    +Y +  G+        ++ +     +G + L LG     ++    +   
Sbjct: 3   YFDRIADRYDAWYRTRTGRYVDRIEKWLVFSMLRTRSG-KALDLGCGTGNYTLELRRRGF 61

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +  + A +G          +       +LP  D S D VL V   EF  +P  +L EI+
Sbjct: 62  DVIGLDASEGMLRIARSKGLNCIRGDAYSLPFPDESFDLVLSVTMFEFIHEPEKVLEEIY 121

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFTLSIT 172
           RVL  GG  ++   N R  W   +        T +   + Y+  ++ +LL  A F    +
Sbjct: 122 RVLRPGGEALIGTMNGRSAWFLFKRLKSLFVETAYRYARFYTPGELEALLTNAGFKNIES 181

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           +  +FFP       L L    +K       G      +   +
Sbjct: 182 AGVIFFPSFW--PFLDLAERVDKKCYKKCKGLGAFIAVRGVR 221


>gi|270263403|ref|ZP_06191672.1| methyltransferase type 11 [Serratia odorifera 4Rx13]
 gi|270042287|gb|EFA15382.1| methyltransferase type 11 [Serratia odorifera 4Rx13]
          Length = 239

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 76/230 (33%), Gaps = 25/230 (10%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           + +     G+   +A+ + L   W  + G  LL LG      +     +   +       
Sbjct: 14  QSWAEMPWGEYYREALERQLQPWWSKLFGFHLLKLGNLSASLATDKCAISHQVNVSL--- 70

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +  +   L     LP A  SVD  L+ H L +A+DP  ML E+ RVL   G +
Sbjct: 71  -------KGENLQVLADAYQLPFAAKSVDACLLAHTLSYADDPHRMLREVDRVLIDDGWL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +         + H      + ++  +++  L   N+ +   +R    P   
Sbjct: 124 VISSFNPFSLLGLGKLVPGLRHRQPYVSRMFTQMRLLDWLSLLNYEVLHQARFHVLPWQR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           K              +   P    + VI ARK      P          +
Sbjct: 184 KGG---------SFLSTHLPALGCMSVIVARKRTLPLTPTPMKVGARKPA 224


>gi|188495421|ref|ZP_03002691.1| putative methyltransferase [Escherichia coli 53638]
 gi|188490620|gb|EDU65723.1| putative methyltransferase [Escherichia coli 53638]
          Length = 240

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLLWCTDPHRLLRETDRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|170767902|ref|ZP_02902355.1| putative methyltransferase [Escherichia albertii TW07627]
 gi|170123390|gb|EDS92321.1| putative methyltransferase [Escherichia albertii TW07627]
          Length = 240

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGIPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ +   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLSTHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|170680838|ref|YP_001742336.1| putative methyltransferase [Escherichia coli SMS-3-5]
 gi|215485369|ref|YP_002327800.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218557149|ref|YP_002390062.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           coli S88]
 gi|218688083|ref|YP_002396295.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli ED1a]
 gi|218698840|ref|YP_002406469.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI39]
 gi|227884792|ref|ZP_04002597.1| methyltransferase [Escherichia coli 83972]
 gi|256020179|ref|ZP_05434044.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Shigella sp. D9]
 gi|293418307|ref|ZP_06660742.1| yafS protein [Escherichia coli B088]
 gi|300819827|ref|ZP_07100013.1| methyltransferase domain protein [Escherichia coli MS 107-1]
 gi|300905644|ref|ZP_07123390.1| methyltransferase domain protein [Escherichia coli MS 84-1]
 gi|300919147|ref|ZP_07135680.1| methyltransferase domain protein [Escherichia coli MS 115-1]
 gi|300988191|ref|ZP_07178592.1| methyltransferase domain protein [Escherichia coli MS 45-1]
 gi|301050548|ref|ZP_07197421.1| methyltransferase domain protein [Escherichia coli MS 185-1]
 gi|301305770|ref|ZP_07211856.1| methyltransferase domain protein [Escherichia coli MS 124-1]
 gi|306813367|ref|ZP_07447560.1| putative methyltransferase [Escherichia coli NC101]
 gi|312964725|ref|ZP_07778976.1| methyltransferase domain protein [Escherichia coli 2362-75]
 gi|331656203|ref|ZP_08357165.1| methyltransferase domain protein [Escherichia coli TA206]
 gi|331661584|ref|ZP_08362507.1| methyltransferase domain protein [Escherichia coli TA143]
 gi|331681594|ref|ZP_08382230.1| methyltransferase domain protein [Escherichia coli H299]
 gi|170518556|gb|ACB16734.1| putative methyltransferase [Escherichia coli SMS-3-5]
 gi|215263441|emb|CAS07761.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218363918|emb|CAR01583.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli S88]
 gi|218368826|emb|CAR16574.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI39]
 gi|218425647|emb|CAR06434.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli ED1a]
 gi|222032038|emb|CAP74777.1| Uncharacterized protein yafS [Escherichia coli LF82]
 gi|227838233|gb|EEJ48699.1| methyltransferase [Escherichia coli 83972]
 gi|281177433|dbj|BAI53763.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|291324835|gb|EFE64250.1| yafS protein [Escherichia coli B088]
 gi|294492696|gb|ADE91452.1| putative methyltransferase [Escherichia coli IHE3034]
 gi|300297756|gb|EFJ54141.1| methyltransferase domain protein [Escherichia coli MS 185-1]
 gi|300402536|gb|EFJ86074.1| methyltransferase domain protein [Escherichia coli MS 84-1]
 gi|300407505|gb|EFJ91043.1| methyltransferase domain protein [Escherichia coli MS 45-1]
 gi|300413745|gb|EFJ97055.1| methyltransferase domain protein [Escherichia coli MS 115-1]
 gi|300527585|gb|EFK48647.1| methyltransferase domain protein [Escherichia coli MS 107-1]
 gi|300838945|gb|EFK66705.1| methyltransferase domain protein [Escherichia coli MS 124-1]
 gi|305854130|gb|EFM54569.1| putative methyltransferase [Escherichia coli NC101]
 gi|307552060|gb|ADN44835.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli ABU 83972]
 gi|307628305|gb|ADN72609.1| putative methyltransferase [Escherichia coli UM146]
 gi|312290746|gb|EFR18624.1| methyltransferase domain protein [Escherichia coli 2362-75]
 gi|312944816|gb|ADR25643.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|315253527|gb|EFU33495.1| methyltransferase domain protein [Escherichia coli MS 85-1]
 gi|315289703|gb|EFU49096.1| methyltransferase domain protein [Escherichia coli MS 110-3]
 gi|315300180|gb|EFU59417.1| methyltransferase domain protein [Escherichia coli MS 16-3]
 gi|320197300|gb|EFW71916.1| hypothetical protein EcoM_00496 [Escherichia coli WV_060327]
 gi|323945581|gb|EGB41631.1| methyltransferase domain-containing protein [Escherichia coli H120]
 gi|323948753|gb|EGB44653.1| methyltransferase domain-containing protein [Escherichia coli H252]
 gi|323958797|gb|EGB54496.1| methyltransferase domain-containing protein [Escherichia coli H263]
 gi|323963756|gb|EGB59258.1| methyltransferase domain-containing protein [Escherichia coli M863]
 gi|324009119|gb|EGB78338.1| methyltransferase domain protein [Escherichia coli MS 57-2]
 gi|327254932|gb|EGE66542.1| methyltransferase domain protein [Escherichia coli STEC_7v]
 gi|330910059|gb|EGH38569.1| SAM-dependent methyltransferase [Escherichia coli AA86]
 gi|331054451|gb|EGI26460.1| methyltransferase domain protein [Escherichia coli TA206]
 gi|331060006|gb|EGI31970.1| methyltransferase domain protein [Escherichia coli TA143]
 gi|331081168|gb|EGI52330.1| methyltransferase domain protein [Escherichia coli H299]
          Length = 240

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|109898215|ref|YP_661470.1| hypothetical protein Patl_1896 [Pseudoalteromonas atlantica T6c]
 gi|109700496|gb|ABG40416.1| conserved hypothetical protein [Pseudoalteromonas atlantica T6c]
          Length = 249

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 82/239 (34%), Gaps = 22/239 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R + +   G      +   L        G  L+ +G      +     ++  +       
Sbjct: 14  RSWSTLPNGAERKAIVESELDIITQQFFGYHLVKVGNLSSELTLSKCSIKHCV------N 67

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                 +     +      ++ L +SSVD  ++ H L+FA+DP  +L E+ R +   G +
Sbjct: 68  MVAKEHETAGMRSL---SRDMALKESSVDGFVLAHELDFAQDPHQILREVDRAIMPDGDL 124

Query: 129 IVVVPNKRGMWARMEHTPFGS------GQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++V  N   +    +   F         + +S  ++   L    F ++  +      P  
Sbjct: 125 VIVGFNPLSLTGLRKLVWFNRQSILQEARFFSVPRIKDWLHLLGFEVTQVTY----RPYS 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
           K  I K  ++  +    F P  A +YVI A+K      PI    +     P       S
Sbjct: 181 KFFITKPNNIITRWCKRFLPQLASMYVIVAKKRTVPLSPIKPKWQ---LKPKFSAVGAS 236


>gi|26246157|ref|NP_752196.1| hypothetical protein c0250 [Escherichia coli CFT073]
 gi|91209281|ref|YP_539267.1| hypothetical protein UTI89_C0232 [Escherichia coli UTI89]
 gi|117622495|ref|YP_851408.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli APEC O1]
 gi|237707793|ref|ZP_04538274.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|331645382|ref|ZP_08346486.1| methyltransferase domain protein [Escherichia coli M605]
 gi|331671742|ref|ZP_08372538.1| methyltransferase domain protein [Escherichia coli TA280]
 gi|332281342|ref|ZP_08393755.1| conserved hypothetical protein [Shigella sp. D9]
 gi|26106554|gb|AAN78740.1|AE016755_240 Hypothetical protein yafS [Escherichia coli CFT073]
 gi|91070855|gb|ABE05736.1| hypothetical protein YafS [Escherichia coli UTI89]
 gi|115511619|gb|ABI99693.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli APEC O1]
 gi|226899003|gb|EEH85262.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|331045544|gb|EGI17670.1| methyltransferase domain protein [Escherichia coli M605]
 gi|331070731|gb|EGI42090.1| methyltransferase domain protein [Escherichia coli TA280]
 gi|332103694|gb|EGJ07040.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 246

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 22  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 71

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 72  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 131

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 132 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 191

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 192 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 235


>gi|157159674|ref|YP_001456992.1| putative methyltransferase [Escherichia coli HS]
 gi|193063286|ref|ZP_03044377.1| putative methyltransferase [Escherichia coli E22]
 gi|194427550|ref|ZP_03060098.1| putative methyltransferase [Escherichia coli B171]
 gi|218693675|ref|YP_002401342.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli 55989]
 gi|307314697|ref|ZP_07594295.1| Methyltransferase type 11 [Escherichia coli W]
 gi|157065354|gb|ABV04609.1| putative methyltransferase [Escherichia coli HS]
 gi|192931194|gb|EDV83797.1| putative methyltransferase [Escherichia coli E22]
 gi|194414320|gb|EDX30594.1| putative methyltransferase [Escherichia coli B171]
 gi|218350407|emb|CAU96092.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli 55989]
 gi|306905816|gb|EFN36341.1| Methyltransferase type 11 [Escherichia coli W]
 gi|315059426|gb|ADT73753.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli W]
 gi|320201192|gb|EFW75775.1| hypothetical protein ECoL_01618 [Escherichia coli EC4100B]
 gi|323380015|gb|ADX52283.1| Methyltransferase type 11 [Escherichia coli KO11]
          Length = 240

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|157155536|ref|YP_001461378.1| putative methyltransferase [Escherichia coli E24377A]
 gi|157077566|gb|ABV17274.1| putative methyltransferase [Escherichia coli E24377A]
          Length = 240

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKFVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|110804260|ref|YP_687780.1| hypothetical protein SFV_0197 [Shigella flexneri 5 str. 8401]
 gi|110613808|gb|ABF02475.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|332754124|gb|EGJ84494.1| methyltransferase domain protein [Shigella flexneri 2747-71]
 gi|333008986|gb|EGK28445.1| methyltransferase domain protein [Shigella flexneri K-218]
 gi|333009686|gb|EGK29136.1| methyltransferase domain protein [Shigella flexneri VA-6]
 gi|333022180|gb|EGK41420.1| methyltransferase domain protein [Shigella flexneri K-304]
          Length = 240

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|333010753|gb|EGK30179.1| methyltransferase domain protein [Shigella flexneri K-272]
 gi|333021252|gb|EGK40505.1| methyltransferase domain protein [Shigella flexneri K-227]
          Length = 240

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKSKPRIRQAV 229


>gi|110640428|ref|YP_668156.1| hypothetical protein ECP_0219 [Escherichia coli 536]
 gi|110342020|gb|ABG68257.1| hypothetical protein YafS [Escherichia coli 536]
 gi|284919983|emb|CBG33038.1| conserved hypothetical protein [Escherichia coli 042]
          Length = 241

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 17  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 66

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 67  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 126

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 127 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 186

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 187 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 230


>gi|315292139|gb|EFU51491.1| methyltransferase domain protein [Escherichia coli MS 153-1]
          Length = 240

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 77/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP +D SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFSDKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N                T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISFMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|332095031|gb|EGJ00066.1| methyltransferase domain protein [Shigella boydii 5216-82]
          Length = 240

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  L+ +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLIKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|323191552|gb|EFZ76812.1| methyltransferase domain protein [Escherichia coli RN587/1]
          Length = 230

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 6   WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 55

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 56  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 115

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 116 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 175

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 176 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 219


>gi|218552788|ref|YP_002385701.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI1]
 gi|218359556|emb|CAQ97096.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli IAI1]
          Length = 240

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIGS--------LSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|24111644|ref|NP_706154.1| hypothetical protein SF0199 [Shigella flexneri 2a str. 301]
 gi|30061765|ref|NP_835936.1| hypothetical protein S0207 [Shigella flexneri 2a str. 2457T]
 gi|82542806|ref|YP_406753.1| hypothetical protein SBO_0202 [Shigella boydii Sb227]
 gi|24050417|gb|AAN41861.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30040007|gb|AAP15741.1| hypothetical protein S0207 [Shigella flexneri 2a str. 2457T]
 gi|81244217|gb|ABB64925.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|281599564|gb|ADA72548.1| hypothetical protein SFxv_0211 [Shigella flexneri 2002017]
          Length = 241

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 17  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 66

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 67  VNVSAQGMPVQVQADPLHLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 126

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 127 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 186

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 187 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 230


>gi|191171467|ref|ZP_03033016.1| putative methyltransferase [Escherichia coli F11]
 gi|300990974|ref|ZP_07179424.1| methyltransferase domain protein [Escherichia coli MS 200-1]
 gi|190908401|gb|EDV67991.1| putative methyltransferase [Escherichia coli F11]
 gi|300305640|gb|EFJ60160.1| methyltransferase domain protein [Escherichia coli MS 200-1]
 gi|324011828|gb|EGB81047.1| methyltransferase domain protein [Escherichia coli MS 60-1]
          Length = 240

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVLVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|319942612|ref|ZP_08016920.1| hypothetical protein HMPREF9464_02139 [Sutterella wadsworthensis
           3_1_45B]
 gi|319803791|gb|EFW00723.1| hypothetical protein HMPREF9464_02139 [Sutterella wadsworthensis
           3_1_45B]
          Length = 292

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 84/241 (34%), Gaps = 10/241 (4%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
               F  +  G+   +  ++       DV G   L +G         +    + L  + +
Sbjct: 24  TFDGFLRTSPGRLLLEWEAEAYDELTVDVFGSCALQIGMPELNTLAENRMQSKWLIELQS 83

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
               +           + +   LP+AD S+D V + H LE + +P   LHE  RVL   G
Sbjct: 84  TVSVSADVLSGDLGCIVAAPELLPIADESMDLVTLPHVLELSPNPQQALHEAVRVLEPEG 143

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPY--------SWYQMISLLREANFTLSITSRSLFF 178
           R+I+   N  G W   + T     +PY           ++          +      L+ 
Sbjct: 144 RLILTAFNGAGFWWMRQQTVRLGAKPYLPTDMAPIPLRRLKDWFALLGLEIDRGRFGLYR 203

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P       L  W   +K G+ + P  + I ++ A K       +  S  +  + P  VP 
Sbjct: 204 PGFRSARRLHAWEWLDKAGDRWLPQCSNILLLSAVKRRPGARIVNCS--EFANIPAKVPT 261

Query: 239 T 239
           +
Sbjct: 262 S 262


>gi|329296920|ref|ZP_08254256.1| type 11 methyltransferase [Plautia stali symbiont]
          Length = 244

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 81/235 (34%), Gaps = 27/235 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R +     G    DA+++ L      + G  +L +G      +     +   +     G 
Sbjct: 14  RSWQDMPWGDYFRDALTQQLQPYLGKLYGFHMLKIGSLSAEINTRQCAISHQVNVGDEGD 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
           G             + S   LP    S+D  L+ H L +++DP  +L E+ RVL   G M
Sbjct: 74  GL----------HVIASATQLPFEAKSIDACLLAHTLAWSQDPHRVLREVDRVLIDDGWM 123

Query: 129 IVVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +    +           SG+ +S  +++  L   N+ L   +     P   
Sbjct: 124 IISGFNPFSLLGISKGLPGLQRRAPWSGRMFSQVRLLDWLSLLNYELVYRTHFQVVPWHR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP--ITESKKKHISSPIL 235
           +           K+ +   P    + ++ ARK  +   P  +     K    P +
Sbjct: 184 QGG---------KMISTHLPALGCLNIVVARKRTFPLTPGKVKMMPGKTQLRPAV 229


>gi|170722632|ref|YP_001750320.1| hypothetical protein PputW619_3468 [Pseudomonas putida W619]
 gi|169760635|gb|ACA73951.1| conserved hypothetical protein [Pseudomonas putida W619]
          Length = 257

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 82/235 (34%), Gaps = 14/235 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R ++   LG+       K+L        G  L+  G                    P  Q
Sbjct: 21  RDWFHGPLGQLMLKEEEKLLEEELGRFFGGYLVHYGPCAEAPPSA-----------PQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGHL 129

Query: 129 IVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           ++V  N    W        G+    +  S  ++   L    F L       + PP     
Sbjct: 130 LIVGINPWSSWGIRHFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASPA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +  + +E++   +     G+Y++ ARK++    P+ + +++ +   + +P   
Sbjct: 190 WQQRLAGWERVAGGWQSSGGGVYLLVARKMVVGLRPLRQERREPMGKLLPLPLAK 244


>gi|260842439|ref|YP_003220217.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|257757586|dbj|BAI29083.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli O103:H2 str. 12009]
          Length = 240

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERKLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|312970311|ref|ZP_07784492.1| methyltransferase domain protein [Escherichia coli 1827-70]
 gi|310336960|gb|EFQ02098.1| methyltransferase domain protein [Escherichia coli 1827-70]
 gi|323165912|gb|EFZ51694.1| methyltransferase domain protein [Shigella sonnei 53G]
 gi|323181625|gb|EFZ67040.1| methyltransferase domain protein [Escherichia coli 1357]
          Length = 230

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 79/235 (33%), Gaps = 27/235 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            ++     G+    A+ + L+  +  + G  LL +G                 A   + Q
Sbjct: 4   DRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ 55

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +
Sbjct: 56  --VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWL 113

Query: 129 IVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +            T   + + ++  + +  L   NF +   SR    P   
Sbjct: 114 VISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNK 173

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                       K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 174 HGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 219


>gi|313646730|gb|EFS11189.1| methyltransferase domain protein [Shigella flexneri 2a str. 2457T]
 gi|332761996|gb|EGJ92268.1| methyltransferase domain protein [Shigella flexneri 4343-70]
 gi|332764637|gb|EGJ94867.1| methyltransferase domain protein [Shigella flexneri K-671]
          Length = 230

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 6   WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 55

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 56  VNVSAQGMPVQVQADPLHLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 115

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 116 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 175

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 176 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 219


>gi|323160258|gb|EFZ46215.1| methyltransferase domain protein [Escherichia coli E128010]
          Length = 230

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 6   WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 55

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 56  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 115

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 116 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 175

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 176 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 219


>gi|218703462|ref|YP_002410981.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli UMN026]
 gi|293403292|ref|ZP_06647383.1| yafS protein [Escherichia coli FVEC1412]
 gi|293408302|ref|ZP_06652141.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298378906|ref|ZP_06988787.1| yafS protein [Escherichia coli FVEC1302]
 gi|300900031|ref|ZP_07118228.1| methyltransferase domain protein [Escherichia coli MS 198-1]
 gi|301021447|ref|ZP_07185471.1| methyltransferase domain protein [Escherichia coli MS 69-1]
 gi|218430559|emb|CAR11425.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia coli UMN026]
 gi|291429145|gb|EFF02165.1| yafS protein [Escherichia coli FVEC1412]
 gi|291471480|gb|EFF13963.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298280019|gb|EFI21523.1| yafS protein [Escherichia coli FVEC1302]
 gi|300356436|gb|EFJ72306.1| methyltransferase domain protein [Escherichia coli MS 198-1]
 gi|300398083|gb|EFJ81621.1| methyltransferase domain protein [Escherichia coli MS 69-1]
          Length = 240

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGLPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|323176525|gb|EFZ62117.1| methyltransferase domain protein [Escherichia coli 1180]
          Length = 230

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 79/235 (33%), Gaps = 27/235 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
            ++     G+    A+ + L+  +  + G  LL +G                 A   + Q
Sbjct: 4   DRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ 55

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +
Sbjct: 56  --VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWL 113

Query: 129 IVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +            T   + + ++  + +  L   NF +   SR    P   
Sbjct: 114 VISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNK 173

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                       K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 174 HGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 219


>gi|317490806|ref|ZP_07949242.1| methyltransferase domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920353|gb|EFV41676.1| methyltransferase domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 240

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 80/230 (34%), Gaps = 25/230 (10%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    A+ + L+  W  + G  LL +G      S     +   ++       
Sbjct: 15  SWSEIPWGEYYRAALEQQLTPWWPKLFGYHLLKIGPLSSQISTEKCGISHQVSI------ 68

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                ++  +   +     LP +  SVD  L+ H L FA DP  ML E+ RVL   G +I
Sbjct: 69  ----GEKGDNMQVIADPYRLPFSAKSVDACLLSHTLSFASDPHRMLREVDRVLIDDGWLI 124

Query: 130 VVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +         +      S + +S  +M+  L+  N+ +    R    P   +
Sbjct: 125 LTGFNPTSLVGLGKLVPGLRKRLPYSSRMFSMMRMLDWLQLLNYEVLYEHRCQILPWNRR 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
             +               P    + +I ARK      P +  ++   +S 
Sbjct: 185 GGL---------FIGKHLPVLGCLSIIVARKRTIPLTPTSLRERSQRASW 225


>gi|193067603|ref|ZP_03048570.1| putative methyltransferase [Escherichia coli E110019]
 gi|192959015|gb|EDV89451.1| putative methyltransferase [Escherichia coli E110019]
          Length = 240

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 81/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQEQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|289522449|ref|ZP_06439303.1| UbiE/COQ5 methyltransferase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289504285|gb|EFD25449.1| UbiE/COQ5 methyltransferase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 233

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 67/221 (30%), Gaps = 11/221 (4%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAF 63
                 +Y +  G         V+       +G  +L +G      S    K   R    
Sbjct: 10  ADTYDDWYKTPKGMLVDKIEKAVIYEFLKPESGMEILDIGCGTGNLSLELAKLGARVTGI 69

Query: 64  MPAGQGATNWPDQY-----FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
             +        ++        +       +LP  D + D  + +  LEF+ D    L EI
Sbjct: 70  DISEAMLVKAREKAARENLCINFCCADANDLPFEDETFDAAVSLSALEFSSDLKKTLSEI 129

Query: 119 WRVLTSGGRMIVVVPNKRGMWARM-----EHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           +RVL  GGRM++ +      W+R      +  P    +   +  +  L+           
Sbjct: 130 YRVLKPGGRMVIGLIGGGSAWSRYYEKKAKKDPESVFRHAHFRTLDELIAAMPGENVQGK 189

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             LF PP       +     E+     G    G     + K
Sbjct: 190 AVLFVPPDFNFEDREKALELEREAQRQGRKDGGFICALSYK 230


>gi|323171000|gb|EFZ56649.1| methyltransferase domain protein [Escherichia coli LT-68]
          Length = 240

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|332768612|gb|EGJ98793.1| methyltransferase domain protein [Shigella flexneri 2930-71]
          Length = 222

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 77/229 (33%), Gaps = 27/229 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G+    A+ + L+  +  + G  LL +G                 A   + Q   N  
Sbjct: 2   PWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ--VNVS 51

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N
Sbjct: 52  AQGMPVQVQADPLHLPFADKSVDICLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFN 111

Query: 135 KRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              +            T   + + ++  + +  L   NF +   SR    P         
Sbjct: 112 PISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHGG--- 168

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                 K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 169 ------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 211


>gi|238790135|ref|ZP_04633912.1| hypothetical protein yfred0001_34910 [Yersinia frederiksenii ATCC
           33641]
 gi|238721804|gb|EEQ13467.1| hypothetical protein yfred0001_34910 [Yersinia frederiksenii ATCC
           33641]
          Length = 239

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 81/242 (33%), Gaps = 27/242 (11%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I     +     G+    AI + L   W    G  LL +G+     +     +    
Sbjct: 7   HQKIDAPASWAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ- 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                     N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RV
Sbjct: 66  ---------VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYASDPHRILREVDRV 116

Query: 122 LTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +         +        + ++  +++  L   N+ +   SR 
Sbjct: 117 LIDDGWLVISNFNPLSLLGAGKLVPLLRQRQPYVSRMFTQMRLLDWLSLLNYEVLYLSRF 176

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSP 233
              P   +           +  +   P    + +I ARK        P+    +K   S 
Sbjct: 177 HVLPWHKEGG---------RFISTHLPALGCVSLIVARKRTIPLTFNPMKFGARKPWFSR 227

Query: 234 IL 235
            +
Sbjct: 228 AV 229


>gi|308185774|ref|YP_003929905.1| hypothetical protein Pvag_0241 [Pantoea vagans C9-1]
 gi|308056284|gb|ADO08456.1| Uncharacterized protein yafS [Pantoea vagans C9-1]
          Length = 245

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 78/224 (34%), Gaps = 25/224 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +   G    DA+++ L      + G  +L LG      +  +  +            
Sbjct: 15  SWRNMPWGDYFRDALTQQLQPYLGKLYGFHMLKLGNLSAEINTENCAISHQ--------- 65

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N   +            LP    S+D  L+ H L +++DP  +L E+ RVL   G MI
Sbjct: 66  -VNVGSEGELLQVRADPMQLPFESKSIDACLLAHTLAWSQDPHRVLREVDRVLIDDGWMI 124

Query: 130 VVVPNKRGMWARME------HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +    +           SG+ +S  +++  L   N+ +   +R    P   +
Sbjct: 125 ISGFNPFSLLGVSKMVPGLTRKAPWSGRMFSQMRLLDWLGLLNYEVVYRTRFQVLPWHRQ 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK 227
                      K+ +   P    + ++ ARK  +  LP    K 
Sbjct: 185 GG---------KLISAHLPALGCLNIVVARKRTFPLLPTRAKKS 219


>gi|238750482|ref|ZP_04611983.1| hypothetical protein yrohd0001_21950 [Yersinia rohdei ATCC 43380]
 gi|238711413|gb|EEQ03630.1| hypothetical protein yrohd0001_21950 [Yersinia rohdei ATCC 43380]
          Length = 239

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 80/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+    AI + L   W    G  LL +G+     +     +       
Sbjct: 10  IDAPASWAELPWGEYYRSAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ---- 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                  N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL  
Sbjct: 66  ------VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLID 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +         +        + ++  +++  L   N+ +   SR    
Sbjct: 120 DGWLVISNFNPLSLLGAGKLVPLLRQRQPYVSRMFTQMRLLDWLSLLNYEVLHLSRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P   +              +   P    + +I ARK        P+    +K   S  +
Sbjct: 180 PWHKEGG---------HFISTHLPALGCVSLIVARKRTIPLTFNPMKSGARKPWFSRAV 229


>gi|332992537|gb|AEF02592.1| SAM-dependent methyltransferase [Alteromonas sp. SN2]
          Length = 276

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 93/257 (36%), Gaps = 24/257 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    AI++V       + G   + LG            +   ++ +P   
Sbjct: 14  EDWTDFPAGEQIKQAITQVCDDYTQRIFGYHFVKLGSLSAQIPLKQSPIRNIISQVPFSA 73

Query: 69  GATNWPDQYFSST----------------ALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
                 +   S+                  +     LP +++S+D  L+ + L+FA+DP 
Sbjct: 74  MHLEHDEISESANNSGERTESVDSSASPKIVGQSHQLPFSENSIDGFLLANELDFAQDPH 133

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH------TPFGSGQPYSWYQMISLLREAN 166
            +L E+ RV+T  G +I+   N   +    ++            + ++ Y++   L+   
Sbjct: 134 EILREVDRVITQSGYVIISGFNPLSLAGIAKYLPVKRDNKLHDARFFTSYRIKDWLQLLG 193

Query: 167 FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES- 225
           F +    + +F     ++         ++  + + P  + +YVI ARK +     I    
Sbjct: 194 FEIVEQRQIMFSTLFFEQRW-GYAKNIQQYLSTYFPWCSAVYVILARKRVMPMTAIRPKL 252

Query: 226 KKKHISSPILVPHTVST 242
           + K   SP+      ++
Sbjct: 253 QLKRQFSPVGAASARTS 269


>gi|218547663|ref|YP_002381454.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           fergusonii ATCC 35469]
 gi|218355204|emb|CAQ87811.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|323975920|gb|EGB71015.1| methyltransferase domain-containing protein [Escherichia coli
           TW10509]
 gi|324111225|gb|EGC05208.1| methyltransferase domain-containing protein [Escherichia fergusonii
           B253]
          Length = 240

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 77/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +                + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKNSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|238762658|ref|ZP_04623627.1| hypothetical protein ykris0001_8320 [Yersinia kristensenii ATCC
           33638]
 gi|238698963|gb|EEP91711.1| hypothetical protein ykris0001_8320 [Yersinia kristensenii ATCC
           33638]
          Length = 239

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 82/242 (33%), Gaps = 27/242 (11%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R  I     +     G+    AI + L   W    G  LL +G+     +     +    
Sbjct: 7   RQKIDTPTSWAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ- 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                     N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RV
Sbjct: 66  ---------VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYATDPHRILREVDRV 116

Query: 122 LTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +         +        + ++  +++  L   N+ +   SR 
Sbjct: 117 LIDDGWLVISNFNPMSLLGAGKLVPLLRQRQPHVSRMFTQMRLLDWLSLLNYEVLYLSRF 176

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSP 233
              P   +           +  +   P    + +I ARK        P+    +K   S 
Sbjct: 177 HVLPWHKEGG---------RFISTHLPALGCVSLIVARKRTIPLTFNPMKFGARKPWFSR 227

Query: 234 IL 235
            +
Sbjct: 228 AV 229


>gi|309700415|emb|CBI99704.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
          Length = 240

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 78/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 16  WGDLPWGELYRMALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            T   + + ++  + +  L   NF +   SR    P     
Sbjct: 126 SGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 186 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|325496139|gb|EGC93998.1| S-adenosyl-L-methionine-dependent methyltransferase [Escherichia
           fergusonii ECD227]
          Length = 230

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 77/233 (33%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    A+ + L+  +  + G  LL +G                 A   + Q  
Sbjct: 6   WGDLPWGELYRKALERQLNPWFTKMYGFHLLKIG--------NLSAEINCEACAVSHQ-- 55

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 56  VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLIDDGWLVI 115

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +                + + ++  + +  L   NF +   SR    P     
Sbjct: 116 SGFNPISLMGLRKLVPVLRKNSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVLPWNKHG 175

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 176 G---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 219


>gi|157147191|ref|YP_001454510.1| hypothetical protein CKO_02970 [Citrobacter koseri ATCC BAA-895]
 gi|157084396|gb|ABV14074.1| hypothetical protein CKO_02970 [Citrobacter koseri ATCC BAA-895]
          Length = 240

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 82/239 (34%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           ++   ++     G+   +A+   L+  +  + G  LL +G      +     V   +   
Sbjct: 10  VIAPHRWGDLPWGEYYREALEHQLNPWFAKMYGFHLLKIGNLSAEINSEACAVSHQVNIS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                      Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 70  L----------QGAPVQVQADPLHLPFADKSVDVCLLAHTLPWCVDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            +   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVLSGFNPISLMGLRKLVPVLRKSSPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P + +           K+ +   P    + +I ARK        P+ ++K K      +
Sbjct: 180 PWSKQGG---------KLLSTHIPALGCLQLIVARKRTIPLTLNPMKQNKSKARIRQAV 229


>gi|161504625|ref|YP_001571737.1| hypothetical protein SARI_02740 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865972|gb|ABX22595.1| hypothetical protein SARI_02740 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 240

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 79/230 (34%), Gaps = 27/230 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+     + G  LL +G               + A   + Q  
Sbjct: 16  WGDLPWGNYYREALEQRLNPWLAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVM 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPVSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISS 232
                     ++ N   P    + +I ARK        P+  +K K    
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRLNKSKAPIR 226


>gi|242240258|ref|YP_002988439.1| methyltransferase type 11 [Dickeya dadantii Ech703]
 gi|242132315|gb|ACS86617.1| Methyltransferase type 11 [Dickeya dadantii Ech703]
          Length = 239

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 82/243 (33%), Gaps = 26/243 (10%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G    + ++  LS  W  + G  LL +G            +   +   
Sbjct: 10  IAAPESWEKIPWGNLYKETLNTALSPWWSRIFGFHLLKVGALSIEIDSEECTIPHQVNMC 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           PA   A            +     LP A+ S+D  L+ H L ++ DP  +L EI RVL S
Sbjct: 70  PALGRA----------HVVADPYQLPFAEKSIDACLLAHTLSYSADPHRVLREIDRVLIS 119

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +         +        + +S  ++I  L   N+ +         
Sbjct: 120 DGWLIISGFNPISLVGMGKLLPGVRRRQPYCSRMFSQMRVIDWLSLLNYEVVHHDSLHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P  H++  +              P    I V+ ARK       IT SK     SP+  P 
Sbjct: 180 PWRHQERGVW---------RNHLPLLGCINVLIARKRTIPLT-ITPSKTLFRKSPLRRPL 229

Query: 239 TVS 241
             +
Sbjct: 230 GAT 232


>gi|261856416|ref|YP_003263699.1| methyltransferase type 11 [Halothiobacillus neapolitanus c2]
 gi|261836885|gb|ACX96652.1| Methyltransferase type 11 [Halothiobacillus neapolitanus c2]
          Length = 281

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/247 (16%), Positives = 89/247 (36%), Gaps = 19/247 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           + ++Y++ +G    + ++  L    DD  G   + +G  +P       +    +A     
Sbjct: 16  ISRWYNTPMGARLAEDLAACLGRLADDAFGYHAVMVGAVLPCEPRLRIRARTQVAAT--- 72

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                   +            LP+   S D V+ +H LE   +P  ++ E+ R++   GR
Sbjct: 73  ---REELAETPLMAVQADFDYLPIETESADLVIALHVLESTREPHDIMRELDRIIRPEGR 129

Query: 128 MIVVVPNKRGMWARME-------------HTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           +++V  N   +W   +              + + +GQ  + ++++  LR   + +     
Sbjct: 130 VLIVGVNPVSLWNLKKIGQQTWQGKDKMAQSGYLAGQHRAAWRVVDWLRLLGYDVQSVEH 189

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
                PT +            I + +     G YVI+A + +     I  + +     P 
Sbjct: 190 LGGLCPTTRPRFYDKMRSLRTISSKWLWFMQGFYVIDAVRRVSTPTAIRPAFRLPRMMPN 249

Query: 235 LVPHTVS 241
               TV+
Sbjct: 250 KTRATVA 256


>gi|330503132|ref|YP_004380001.1| hypothetical protein MDS_2218 [Pseudomonas mendocina NK-01]
 gi|328917418|gb|AEB58249.1| hypothetical protein MDS_2218 [Pseudomonas mendocina NK-01]
          Length = 252

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 82/241 (34%), Gaps = 14/241 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           + E R + +  LG+   +   ++L        G  L+  G                    
Sbjct: 17  VGEARNWLAGPLGQLLLEEERRLLEEELARFFGGYLVSFGPGAEGPPKAEQIQHNV---- 72

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                             +  E + PL + + D V++ H L+F+  P  +L E  R +  
Sbjct: 73  -------RLGAPMPGVQIVCEEQSWPLGEHAADVVVLQHGLDFSLSPHGLLREAARSVRP 125

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG ++V+  +    W              +  +  ++   L    F L       + PP 
Sbjct: 126 GGHLLVLGIHPWSAWGVRRLFAQDGLARARCIAPSRVGDWLSLLGFALEKRRFGCYRPPL 185

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                       E  G+ +    AG Y++ ARK++    P+ +S+++ +   + +P    
Sbjct: 186 ASLAWQMRLRRMESWGDAWQLPGAGFYLLVARKLVVGLRPLRQSRREPMGKLLPMPVAKI 245

Query: 242 T 242
           +
Sbjct: 246 S 246


>gi|146307093|ref|YP_001187558.1| hypothetical protein Pmen_2065 [Pseudomonas mendocina ymp]
 gi|145575294|gb|ABP84826.1| hypothetical protein Pmen_2065 [Pseudomonas mendocina ymp]
          Length = 252

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 81/241 (33%), Gaps = 14/241 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I E R + +  LG+   +   ++L        G  L+  G                    
Sbjct: 17  IGEARDWLAGPLGQLLLEEERRLLEEELARFFGGYLVSYGPGAEGPPKAGQIQHNV---- 72

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                             +  E + PL + + D V++ H L+F   P  +L E  R +  
Sbjct: 73  -------RLGAPMPGVQIVCEEQSWPLGEHAADVVVLQHGLDFCLSPHGLLREAARSVRP 125

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG ++++  +    W              +  S  ++   L    F L       + PP 
Sbjct: 126 GGHLLILGIHPWSGWGARRLFAQDGLRQARCISPSRVGDWLTLLGFALEKRRFGCYRPPL 185

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                       E+ G  +    AG Y++ ARK++    P+ +S+++ +   + +P    
Sbjct: 186 ASLAWQMRLRRLERWGEAWQLPGAGFYLLVARKLVVGLRPLRQSRREPMGKLLPLPVAKI 245

Query: 242 T 242
           +
Sbjct: 246 S 246


>gi|56414618|ref|YP_151693.1| hypothetical protein SPA2507 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|168261340|ref|ZP_02683313.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|197363546|ref|YP_002143183.1| hypothetical protein SSPA2338 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205351593|ref|YP_002225394.1| hypothetical protein SG0260 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|56128875|gb|AAV78381.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095023|emb|CAR60569.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|205271374|emb|CAR36167.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205350042|gb|EDZ36673.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|326626621|gb|EGE32964.1| putative Methyltransferase type 11 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 240

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 76/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+     + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLNPWLAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|301326097|ref|ZP_07219493.1| methyltransferase domain protein [Escherichia coli MS 78-1]
 gi|300847157|gb|EFK74917.1| methyltransferase domain protein [Escherichia coli MS 78-1]
          Length = 240

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 80/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  L  +G                 A  
Sbjct: 10  VVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHLFKIG--------NLSAEINCEACA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            + Q   N   Q           +LP AD SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 62  VSHQ--VNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLRETDRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            T   + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P               K+ N   P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWNKHGG---------KLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNKPRIRQAV 229


>gi|238799156|ref|ZP_04642609.1| hypothetical protein ymoll0001_39780 [Yersinia mollaretii ATCC
           43969]
 gi|238716997|gb|EEQ08860.1| hypothetical protein ymoll0001_39780 [Yersinia mollaretii ATCC
           43969]
          Length = 239

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 81/242 (33%), Gaps = 27/242 (11%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R  I     +     G+    AI + L   W    G  LL +G+     +     +    
Sbjct: 7   RRKIDAPASWAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ- 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                     N  +   +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RV
Sbjct: 66  ---------VNVGESGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRV 116

Query: 122 LTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +         +        + ++  +++  L   N+ +   SR 
Sbjct: 117 LIDDGWLVISNFNPMSILGAGKLIPIVRQRQPYISRMFTQMRLLDWLSLLNYEVLHLSRF 176

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSP 233
              P   +           +  +   P    + +I ARK        P+    +K   S 
Sbjct: 177 HVLPWHKEGG---------RFISTHLPALGCVSLIVARKRTIPLTFNPMKFGARKPWFSR 227

Query: 234 IL 235
            +
Sbjct: 228 AV 229


>gi|332162778|ref|YP_004299355.1| hypothetical protein YE105_C3158 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667008|gb|ADZ43652.1| hypothetical protein YE105_C3158 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 239

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 80/234 (34%), Gaps = 27/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    AI + L   W    G  LL +G+     +     +            
Sbjct: 15  SWAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ--------- 65

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G ++
Sbjct: 66  -VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLV 124

Query: 130 VVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +         +        + ++  +++  L   N+ +   SR    P   +
Sbjct: 125 ISNFNPMSLLGAGKLVPLLRQRQPHVSRMFTQMRLLDWLSLLNYEVLYLSRFHVLPWHKE 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                      +  +   P    + +I ARK        P+    +K   S  +
Sbjct: 185 GG---------RFISTHLPALGCVSLIVARKRTIPLTFNPMKFGARKPWFSRAV 229


>gi|310766703|gb|ADP11653.1| Methyltransferase type 11 [Erwinia sp. Ejp617]
          Length = 233

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 80/240 (33%), Gaps = 27/240 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+   DA++  L  +   V G  LL +G            +   +    +G+
Sbjct: 14  ESWSQIPCGEYYRDALAHQLRPSLGKVFGFHLLKIGRLSAEIDTESCAIAHQVNVGLSGE 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                              +LP    SVD  L+ H L ++ DP  +L E+ RVL   G +
Sbjct: 74  LMQ----------IRADPLSLPFESKSVDACLLAHTLAWSSDPHCLLREVDRVLVDDGWI 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +      + + YS  +++  L   N+ +   +     P   
Sbjct: 124 IISGFNLFSLLGMGKLIPGLHRRIPWNSRMYSQMRLLDWLSLLNYEVIRRTCFQVLPWNC 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +           K+ +   P    + +I ARK  +         KK    P L    V++
Sbjct: 184 QGG---------KMISTHLPALGCMNLIVARKRTFPLT--RNPAKKSAGKPRLHAVGVTS 232


>gi|261340923|ref|ZP_05968781.1| SAM-dependent methyltransferase [Enterobacter cancerogenus ATCC
           35316]
 gi|288316780|gb|EFC55718.1| SAM-dependent methyltransferase [Enterobacter cancerogenus ATCC
           35316]
          Length = 238

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/236 (17%), Positives = 76/236 (32%), Gaps = 27/236 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +    ++     G    +A+ + L      + G  LL +G      +     +   +   
Sbjct: 10  VAAPERWAELPWGDYYREALERQLKPWLAKMYGFHLLKIGNLSAEINTESCAISHQVNVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
             G                    +LP A+ SVD  ++ H L +  DP  +L E  RVL  
Sbjct: 70  LNGSPVQ----------VKADPLHLPFAEKSVDACMLAHTLPWCSDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            TP  + + ++  + +  L   NF +         
Sbjct: 120 DGWLVISGFNPLSLMGLRKLVPVLRRTPPYNSRMFTMTRQLDWLSLLNFEVLGYGGFQVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISS 232
           P T K  +         + +   P    +  I ARK        P+ +SK K    
Sbjct: 180 PWTRKGGV---------VLSTHLPALGCMQFIVARKRTIPLTLNPMKQSKSKARIR 226


>gi|293392717|ref|ZP_06637036.1| SAM-dependent methyltransferase [Serratia odorifera DSM 4582]
 gi|291424834|gb|EFE98044.1| SAM-dependent methyltransferase [Serratia odorifera DSM 4582]
          Length = 239

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 76/230 (33%), Gaps = 25/230 (10%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           + + +   G+    A+ + L   W  + G  LL LG      +     +   +    +G 
Sbjct: 14  QSWAALPWGEYYRAALERQLQPWWPKLFGFHLLKLGNLSAGLATDKCAISHQVNVGLSGD 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +     LP AD SVD  LM   L +A+DP  ML E+ R+L   G +
Sbjct: 74  HLQ----------VIADPYRLPFADKSVDACLMAQALSYADDPHRMLREVDRILIDDGWL 123

Query: 129 IVVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N         +   +      + + ++  +++  L   N+ +   +R    P   
Sbjct: 124 VLSTFNPFSVLGLGKLLPGLRQRQPFASRMFTQMRLLDWLSLLNYEVLQQTRFHVLPWHR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           +  +               P    + +I ARK      P          +
Sbjct: 184 QGGV---------FLGTHLPALGCMSMIVARKRTVPLTPTAMKLGARKPA 224


>gi|70730662|ref|YP_260403.1| hypothetical protein PFL_3298 [Pseudomonas fluorescens Pf-5]
 gi|68344961|gb|AAY92567.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 252

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 82/239 (34%), Gaps = 14/239 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I   R++ S  LG+   D   ++L        G  L+  G              +T    
Sbjct: 17  ISAAREWLSGPLGQFLLDEERRMLEEELGRFFGGYLVHYG-----------PSAQTPPAA 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P  Q              +  E   PL++ + D V++ H L+F   P  +L E    +  
Sbjct: 66  PQVQRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASSVRP 125

Query: 125 GGRMIVVVPNKRGMWARME---HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GG +++V  N    W       H      +  S  ++   L    F L       + PP 
Sbjct: 126 GGHLLIVGINPWSTWGLRHVFAHDALRLARCISPSRVGDWLNLLGFALEKRRFGCYRPPL 185

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                    + +E+    +     G Y++ ARKI     P+ + +++ +   + +P   
Sbjct: 186 ASTAWQARLAGWERRAGHWQLSGGGFYLLVARKIAVGLRPVRQVRREPMGKLVPLPMAK 244


>gi|198243385|ref|YP_002214218.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197937901|gb|ACH75234.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 240

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 78/227 (34%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+  +  + G  LL +G      +     V   +    + QGA
Sbjct: 16  WGELPWGNYYREALEQQLNPWFAKMYGFHLLKIGNLSAEINSEACAVSHQVNV--SSQGA 73

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                       L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 74  --------PMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQIIVARKRTIPLTLNPLRHNKSKT 223


>gi|123441271|ref|YP_001005258.1| hypothetical protein YE0920 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088232|emb|CAL11021.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 239

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 80/233 (34%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+    AI + L   W    G  LL +G+     +     +             
Sbjct: 16  WAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ---------- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++
Sbjct: 66  VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVI 125

Query: 131 VVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +         +        + ++  +++  L   N+ +   SR    P   + 
Sbjct: 126 SNFNPMSLLGAGKLVPLLRQRQPHVSRMFTQMRLLDWLSLLNYEVLYLSRFHVLPWHKEG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                     +  +   P    + +I ARK        P+    +K   S  +
Sbjct: 186 G---------RFISTHLPALGCVSLIVARKRTIPLTFNPMKFGARKPWFSRAV 229


>gi|50122263|ref|YP_051430.1| hypothetical protein ECA3341 [Pectobacterium atrosepticum SCRI1043]
 gi|49612789|emb|CAG76239.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 236

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/237 (16%), Positives = 74/237 (31%), Gaps = 28/237 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    +     G+   +++ + L   W  + G  L+ +G                    
Sbjct: 10  IVAPDSWDDITCGQFYRESLEQALLPWWPKLFGFHLIKIGA--------LSAEIHVTGCA 61

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            A Q   N      +         LP ++ S+D  L+   L ++ DP  +L E+ RVL  
Sbjct: 62  IAHQ--VNVAPHGDNLHVAADAHQLPFSEKSIDACLLAQTLSYSSDPHRILREVDRVLVD 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +        R+        + ++  ++   L   N+ +   +     
Sbjct: 120 DGWLILSTFNPISLVGLGKLIPRLNKKHPYCSRMFTQMRITDWLGLLNYEVIHQTHFHVT 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG--LPITESKKKHISSP 233
           P        +         N   P    + +I ARK        P+    +K     
Sbjct: 180 P------WRRNKGKL----NKHIPMLGCLTLIIARKRTIPLTFTPMRARLRKASVRR 226


>gi|283783997|ref|YP_003363862.1| hypothetical protein ROD_02181 [Citrobacter rodentium ICC168]
 gi|282947451|emb|CBG86998.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 244

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 78/242 (32%), Gaps = 28/242 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +V   ++     G+    A+ + L+  +  + G  LL +G      +     V   ++  
Sbjct: 10  VVAPERWGDMPWGEYYRQALEQQLNPWFAKMYGFHLLKVGNLSAEINSEACAVSHQVSVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                                   LP A  SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 70  I----------GGSPVQVQADPLFLPFAPKSVDVCLLAHALPWCTDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            TP  + + ++  + +  L   NF +   SR    
Sbjct: 120 DGWLVLSGFNPVSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P               K+ +   P    + +I ARK           + K  +    +P 
Sbjct: 180 PWKKNGG---------KMLSAHLPALGCMQLIVARKRTIPLTLNPMKQSKAKAR---IPQ 227

Query: 239 TV 240
            V
Sbjct: 228 AV 229


>gi|283834501|ref|ZP_06354242.1| SAM-dependent methyltransferase [Citrobacter youngae ATCC 29220]
 gi|291070051|gb|EFE08160.1| SAM-dependent methyltransferase [Citrobacter youngae ATCC 29220]
          Length = 240

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 77/234 (32%), Gaps = 27/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+   +A+   L+  +  + G  LL +G            V   +        
Sbjct: 15  SWDDLPWGEYYREALEHQLNPWFAKMYGFHLLKIGNLSAEIDSEACAVSHQVNVSL---- 70

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                 Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +I
Sbjct: 71  ------QGSPMQVTADPLHLPFADKSVDVCLLAHTLPWCADPHRLLREADRVLIDDGWLI 124

Query: 130 VVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +            T   + + ++  + +  L   NF +   SR    P   K
Sbjct: 125 LSGFNPVSLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWNRK 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                      K+ +   P    + ++ ARK        P+ ++K K      +
Sbjct: 185 GG---------KMLSAHIPALGCLQLVVARKRTIPLTLNPMKQNKSKTPIRQAV 229


>gi|318606884|emb|CBY28382.1| sam-dependent methyltransferase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 239

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 27/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    AI + L   W    G  LL +G+     +     +            
Sbjct: 15  SWAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCAISHQ--------- 65

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G ++
Sbjct: 66  -VNVGEQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLV 124

Query: 130 VVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +         +        + ++  +++  L   N+ +   SR    P   +
Sbjct: 125 ISNFNPMSLLGAGKLVPLLRQRQPHVSRMFTQMRLLDWLSLLNYEVLYLSRFHVLPWHKE 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                      +  +   P    I +I ARK        P+    +K   S  +
Sbjct: 185 GG---------RFISTHLPALGCISLIVARKRTIPLTFNPMKFGARKPWFSRAV 229


>gi|16759248|ref|NP_454865.1| hypothetical protein STY0283 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142977|ref|NP_806319.1| hypothetical protein t2603 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213021401|ref|ZP_03335848.1| hypothetical protein Salmonelentericaenterica_00876 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213162308|ref|ZP_03348018.1| hypothetical protein Salmoneentericaenterica_20863 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213428415|ref|ZP_03361165.1| hypothetical protein SentesTyphi_24458 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580946|ref|ZP_03362772.1| hypothetical protein SentesTyph_06974 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612766|ref|ZP_03370592.1| hypothetical protein SentesTyp_09779 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213646367|ref|ZP_03376420.1| hypothetical protein SentesTy_02924 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852642|ref|ZP_03382174.1| hypothetical protein SentesT_07074 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828782|ref|ZP_06546541.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25359108|pir||AD0534 conserved hypothetical protein STY0283 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501539|emb|CAD08716.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138609|gb|AAO70179.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 240

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 77/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+  +  + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLNPWFAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVLVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|238913718|ref|ZP_04657555.1| hypothetical protein SentesTe_21657 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 240

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 77/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + LS  +  + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLSPWFAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|16763645|ref|NP_459260.1| SAM-dependent methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|62178828|ref|YP_215245.1| hypothetical protein SC0258 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167554224|ref|ZP_02347965.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167995091|ref|ZP_02576181.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168232193|ref|ZP_02657251.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238649|ref|ZP_02663707.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168239996|ref|ZP_02664928.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168819166|ref|ZP_02831166.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443090|ref|YP_002039496.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447422|ref|YP_002044246.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472658|ref|ZP_03078642.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735250|ref|YP_002113279.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251859|ref|YP_002145262.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262826|ref|ZP_03162900.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|200390349|ref|ZP_03216960.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204926935|ref|ZP_03218137.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207855774|ref|YP_002242425.1| hypothetical protein SEN0264 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|16418762|gb|AAL19219.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62126461|gb|AAX64164.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|194401753|gb|ACF61975.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194405726|gb|ACF65945.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459022|gb|EDX47861.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710752|gb|ACF89973.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197215562|gb|ACH52959.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197241081|gb|EDY23701.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288609|gb|EDY27986.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|199602794|gb|EDZ01340.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204323600|gb|EDZ08795.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205321520|gb|EDZ09359.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205327155|gb|EDZ13919.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333447|gb|EDZ20211.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205340191|gb|EDZ26955.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343970|gb|EDZ30734.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206707577|emb|CAR31851.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|267991949|gb|ACY86834.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301156883|emb|CBW16359.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911227|dbj|BAJ35201.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320084511|emb|CBY94303.1| Uncharacterized protein yafS [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321224916|gb|EFX49977.1| SAM-dependent methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322614542|gb|EFY11471.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620060|gb|EFY16932.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623355|gb|EFY20194.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629347|gb|EFY26126.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632067|gb|EFY28821.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637195|gb|EFY33897.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640308|gb|EFY36968.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645925|gb|EFY42445.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652376|gb|EFY48730.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652580|gb|EFY48930.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660390|gb|EFY56626.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664543|gb|EFY60736.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669404|gb|EFY65554.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670950|gb|EFY67083.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678811|gb|EFY74866.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681840|gb|EFY77865.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687966|gb|EFY83932.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322713279|gb|EFZ04850.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128577|gb|ADX16007.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323194320|gb|EFZ79515.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197736|gb|EFZ82868.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203468|gb|EFZ88493.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206787|gb|EFZ91740.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213394|gb|EFZ98195.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214687|gb|EFZ99438.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221460|gb|EGA05876.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226222|gb|EGA10438.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229990|gb|EGA14110.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233729|gb|EGA17818.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238577|gb|EGA22635.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244265|gb|EGA28274.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246426|gb|EGA30409.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252191|gb|EGA36044.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258048|gb|EGA41727.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259854|gb|EGA43485.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265131|gb|EGA48630.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272694|gb|EGA56101.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|332987208|gb|AEF06191.1| putative SAM-dependent methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 240

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 77/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+  +  + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLNPWFAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|291616381|ref|YP_003519123.1| YafS [Pantoea ananatis LMG 20103]
 gi|291151411|gb|ADD75995.1| YafS [Pantoea ananatis LMG 20103]
 gi|327392832|dbj|BAK10254.1| hypothetical protein YafS [Pantoea ananatis AJ13355]
          Length = 244

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 80/223 (35%), Gaps = 25/223 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R ++    G    DA+++ L      + G  +L LG      +  +  +   ++      
Sbjct: 14  RSWHDMPWGVYFRDALTQQLQPYLGKLYGFHMLKLGNLSAEINTENCAISHQVSV----- 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +      L +   LP    SVD  L+ H L +++DP  +L E+ RVL   G M
Sbjct: 69  -----GTEGEQLQVLANPAQLPFESKSVDACLLAHTLSWSQDPHRILREVDRVLIDDGWM 123

Query: 129 IVVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N         M   ++     S + +S  +++  L   N+ +   +R    P   
Sbjct: 124 IISGFNPFSLLGISKMVPGIQRKAPWSSRMFSQMRLLDWLGLLNYEVVYRTRFQVLPWHR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
           +           K+ +   P    + ++ ARK  +   P    
Sbjct: 184 QGG---------KMISAHLPALGCLNIVVARKRSFPLTPTKAR 217


>gi|146310410|ref|YP_001175484.1| methyltransferase type 11 [Enterobacter sp. 638]
 gi|145317286|gb|ABP59433.1| Methyltransferase type 11 [Enterobacter sp. 638]
          Length = 238

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 79/239 (33%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +     +     G+   DA+ + L      + G  LL +G      +     +   +   
Sbjct: 10  VSAPEHWAQLPKGEYFRDALERQLKPWLAKMYGFHLLKIGNLSAEINTESCAISHQVNVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            AGQ                   +LP A+ SVD  L+ + L +  DP  +L E  RVL  
Sbjct: 70  LAGQPIQ----------VKADPLHLPFAEKSVDACLLANTLPWCSDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +                + + +++ + +  L   NF +   S     
Sbjct: 120 DGWLILSGFNPMSLMGLRKLVPVLRRKVPYNSRMFTFTRQLDWLSLLNFEVMHYSGFQVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P T +           K+     P    + +I ARK        P+ +SK K      +
Sbjct: 180 PWTQEGG---------KMLTTHFPALGCMQLIVARKRTIPLTLNPMKQSKAKSQIRQAV 229


>gi|237730197|ref|ZP_04560678.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226905736|gb|EEH91654.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 240

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 77/234 (32%), Gaps = 27/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+   +A+   L+  +  + G  LL +G            V   +        
Sbjct: 15  SWDDLPWGEYYREALEHQLNPWFAKMYGFHLLKVGNLSAEIDSEACAVSHQVNVSL---- 70

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                 Q           +LP AD SVD  L+ H L +  DP  +L E  RVL   G +I
Sbjct: 71  ------QGSPMQVTADPLHLPFADKSVDVCLLAHTLPWCSDPHRLLREADRVLIDDGWLI 124

Query: 130 VVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +            T   + + ++  + +  L   NF +   SR    P   K
Sbjct: 125 LSGFNPVSLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWNKK 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                      K+ +   P    + ++ ARK        P+ ++K K      +
Sbjct: 185 GG---------KMLSAHIPALGCLQLVVARKRTIPLTLNPMKQNKSKTPIRHAV 229


>gi|253689506|ref|YP_003018696.1| Methyltransferase type 11 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756084|gb|ACT14160.1| Methyltransferase type 11 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 236

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 77/237 (32%), Gaps = 28/237 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    +     G+   +++   LS+ W  + G  L+ +G      +     +   +   
Sbjct: 10  IVAPDSWDDITCGQFYRESLELALSSWWPKLFGFHLIKVGALSAEINITECAIAHQVNVA 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P             +   +     LP ++ S+D  L+   L ++ DP  +L E+ RVL  
Sbjct: 70  P----------HGDNLHVVADAHQLPFSEKSIDACLLAQTLSYSSDPHRVLREVDRVLVD 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +        R+        + ++  ++   L   N+ +   +     
Sbjct: 120 DGWLILSTFNPISLVGLGKLIPRLNKKHPYCSRMFTQMRITDWLGLLNYEVIHQTHFHVT 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG--LPITESKKKHISSP 233
           P        +         N   P    + +I ARK        P+    +K     
Sbjct: 180 P------WRRNKGKL----NKHIPMLGCLTLIIARKRTIPLTFTPMRARLRKASVRR 226


>gi|320538889|ref|ZP_08038565.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Serratia symbiotica str. Tucson]
 gi|320031049|gb|EFW13052.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Serratia symbiotica str. Tucson]
          Length = 239

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 74/233 (31%), Gaps = 25/233 (10%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            +   +     G+    A+ + L   W  + G  LL LG            +   +    
Sbjct: 11  TDPPSWSELPWGEYYRGALEQQLQPWWPKLFGFHLLKLGDLSADLVTDKCAISHQVNVGL 70

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           AG G             +     LP A  SVD  L+ H L + +D   +L E+ RVL   
Sbjct: 71  AGAGLQ----------VIAENCPLPFATKSVDACLLAHTLCYTDDTHRLLREVDRVLIDD 120

Query: 126 GRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           G +++   N   +         + H    + +  S  +++  L   N+ +   +R    P
Sbjct: 121 GWLVISGFNPFSLLGIGKLVPWLRHHQPYASRMLSQIRVLDWLSLLNYEVLHQARFHVLP 180

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
             HK           K      P    + VI ARK      P          S
Sbjct: 181 WQHKGN---------KFLCTHLPALGCMSVIVARKRTLPLTPTPMKMGVRKPS 224


>gi|326621962|gb|EGE28307.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 222

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/223 (20%), Positives = 77/223 (34%), Gaps = 25/223 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G    +A+ + L+  +  + G  LL +G      +     V   +    + QGA    
Sbjct: 2   PWGNYYREALEQQLNPWFAKMYGFHLLKIGNLSAEINSEVCAVSHQVNV--SSQGA---- 55

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
                   L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N
Sbjct: 56  ----PMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFN 111

Query: 135 KRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              +            TP  + + ++  + +  L   NF +   SR    P   +     
Sbjct: 112 PLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQGG--- 168

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                 ++ N   P    + +I ARK             K  +
Sbjct: 169 ------RLLNTHIPALGCLQIIVARKRTIPLTLNPLRHNKSKT 205


>gi|322831644|ref|YP_004211671.1| methyltransferase type 11 [Rahnella sp. Y9602]
 gi|321166845|gb|ADW72544.1| Methyltransferase type 11 [Rahnella sp. Y9602]
          Length = 241

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/244 (19%), Positives = 80/244 (32%), Gaps = 26/244 (10%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    +     G     A+ + L   W  + G  LL +G            +       
Sbjct: 10  IVAPASWDEIPCGGYYRAALEQQLQPWWGKLYGFHLLKIGALSAEIDARACPISHQ---- 65

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                  N+  +           +LP A  SVD  L+ H L +A+DP  +L E+ RVL  
Sbjct: 66  ------VNFAQEGEGLHVRGDPYHLPFAAKSVDACLLSHTLAYADDPHRILREVDRVLID 119

Query: 125 GGRMIVVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G M++   N         +          S + ++  +++  L   N+ + +  R    
Sbjct: 120 DGWMVLSSFNPLSLLGIGKLMPLFRKRQPYSSRLFTQMRLLDWLSLLNYEVMVHRRFHVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI-TESKKKHISSPILVP 237
           P               K+ +   P    + +I ARK  +   P   +   +    P  V 
Sbjct: 180 PWKKNGG---------KLLSTHLPALGCMTLIIARKRTFPLTPTAKKVLAQKQKIPQAVG 230

Query: 238 HTVS 241
            T S
Sbjct: 231 ATKS 234


>gi|168465315|ref|ZP_02699197.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195631734|gb|EDX50254.1| putative methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 240

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 76/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+  +  + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLNPWFAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     +  N   P    + +I ARK             K  +
Sbjct: 186 G---------RFLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|22126972|ref|NP_670395.1| hypothetical protein y3096 [Yersinia pestis KIM 10]
 gi|45442537|ref|NP_994076.1| hypothetical protein YP_2769 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597281|ref|YP_071472.1| hypothetical protein YPTB2966 [Yersinia pseudotuberculosis IP
           32953]
 gi|108806555|ref|YP_650471.1| hypothetical protein YPA_0558 [Yersinia pestis Antiqua]
 gi|108813078|ref|YP_648845.1| hypothetical protein YPN_2918 [Yersinia pestis Nepal516]
 gi|145598914|ref|YP_001162990.1| hypothetical protein YPDSF_1632 [Yersinia pestis Pestoides F]
 gi|149366917|ref|ZP_01888951.1| hypothetical protein YPE_2175 [Yersinia pestis CA88-4125]
 gi|153950302|ref|YP_001400034.1| methyltransferase [Yersinia pseudotuberculosis IP 31758]
 gi|162420142|ref|YP_001607085.1| hypothetical protein YpAngola_A2684 [Yersinia pestis Angola]
 gi|165924746|ref|ZP_02220578.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938365|ref|ZP_02226923.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011955|ref|ZP_02232853.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211355|ref|ZP_02237390.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399823|ref|ZP_02305341.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419663|ref|ZP_02311416.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423855|ref|ZP_02315608.1| putative methyltransferase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470219|ref|ZP_02334923.1| putative methyltransferase [Yersinia pestis FV-1]
 gi|170023353|ref|YP_001719858.1| type 11 methyltransferase [Yersinia pseudotuberculosis YPIII]
 gi|186896386|ref|YP_001873498.1| type 11 methyltransferase [Yersinia pseudotuberculosis PB1/+]
 gi|218928249|ref|YP_002346124.1| hypothetical protein YPO1080 [Yersinia pestis CO92]
 gi|229841011|ref|ZP_04461170.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843116|ref|ZP_04463262.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229895466|ref|ZP_04510638.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Pestoides A]
 gi|229903521|ref|ZP_04518634.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Nepal516]
 gi|270487302|ref|ZP_06204376.1| methyltransferase domain protein [Yersinia pestis KIM D27]
 gi|21960015|gb|AAM86646.1|AE013910_8 hypothetical protein y3096 [Yersinia pestis KIM 10]
 gi|45437402|gb|AAS62953.1| SAM-dependent methyltransferases [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51590563|emb|CAH22204.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108776726|gb|ABG19245.1| hypothetical protein YPN_2918 [Yersinia pestis Nepal516]
 gi|108778468|gb|ABG12526.1| hypothetical protein YPA_0558 [Yersinia pestis Antiqua]
 gi|115346860|emb|CAL19746.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145210610|gb|ABP40017.1| hypothetical protein YPDSF_1632 [Yersinia pestis Pestoides F]
 gi|149291291|gb|EDM41366.1| hypothetical protein YPE_2175 [Yersinia pestis CA88-4125]
 gi|152961797|gb|ABS49258.1| putative methyltransferase [Yersinia pseudotuberculosis IP 31758]
 gi|162352957|gb|ABX86905.1| putative methyltransferase [Yersinia pestis Angola]
 gi|165913743|gb|EDR32362.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923806|gb|EDR40938.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989122|gb|EDR41423.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207126|gb|EDR51606.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962404|gb|EDR58425.1| putative methyltransferase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050531|gb|EDR61939.1| putative methyltransferase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056704|gb|EDR66467.1| putative methyltransferase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749887|gb|ACA67405.1| Methyltransferase type 11 [Yersinia pseudotuberculosis YPIII]
 gi|186699412|gb|ACC90041.1| Methyltransferase type 11 [Yersinia pseudotuberculosis PB1/+]
 gi|229679291|gb|EEO75394.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Nepal516]
 gi|229689463|gb|EEO81524.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697377|gb|EEO87424.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701621|gb|EEO89648.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis Pestoides A]
 gi|262361133|gb|ACY57854.1| hypothetical protein YPD4_0945 [Yersinia pestis D106004]
 gi|262365376|gb|ACY61933.1| hypothetical protein YPD8_1248 [Yersinia pestis D182038]
 gi|270335806|gb|EFA46583.1| methyltransferase domain protein [Yersinia pestis KIM D27]
 gi|320014216|gb|ADV97787.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 239

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 79/242 (32%), Gaps = 27/242 (11%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R +I     +     G+    A+ + L   W    G  LL +G+     +     +    
Sbjct: 7   RQNIETPASWAELPWGEYYRAALEQQLQPWWPKFFGFHLLKVGHLSAEIASDKCAIAHQ- 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                     N  +   +   L S   LP A+ SVD  L+ H L +A +P  +L E+ RV
Sbjct: 66  ---------VNVGEWGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAANPHRILREVDRV 116

Query: 122 LTSGGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +         +        + ++  +++  L   N+ +   S  
Sbjct: 117 LIDDGWLVISGFNPFSLLGLGKLVPVLRQRQPYISRMFTQMRLLDWLSLLNYEVVHLSCF 176

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSP 233
              P                  +   P    + +I ARK        P+    +K   S 
Sbjct: 177 HVLPFNKNGG---------HFISTHLPALGCVNLIIARKRTVPLTFNPMKFGVRKPWFSR 227

Query: 234 IL 235
            +
Sbjct: 228 AV 229


>gi|224582103|ref|YP_002635901.1| hypothetical protein SPC_0272 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224466630|gb|ACN44460.1| hypothetical protein SPC_0272 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 222

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/223 (20%), Positives = 76/223 (34%), Gaps = 25/223 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G    +A+ + L+  +  + G  LL +G               + A   + Q   N  
Sbjct: 2   PWGNYYREALEQQLNPWFAKMYGFHLLKIG--------NLSAEINSEACAVSHQ--VNVS 51

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
            Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N
Sbjct: 52  SQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFN 111

Query: 135 KRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              +            TP  + + ++  + +  L   NF +   SR    P   +     
Sbjct: 112 PLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQGG--- 168

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                 ++ N   P    + +I ARK             K  +
Sbjct: 169 ------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 205


>gi|119503279|ref|ZP_01625363.1| SAM-dependent methyltransferase [marine gamma proteobacterium
           HTCC2080]
 gi|119460925|gb|EAW42016.1| SAM-dependent methyltransferase [marine gamma proteobacterium
           HTCC2080]
          Length = 270

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 86/242 (35%), Gaps = 14/242 (5%)

Query: 8   LRQFYS-SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           L Q+YS S LGK   + ++K +    D   G  LL +G           +V R L  +  
Sbjct: 18  LEQWYSTSPLGKRLREQLNKDMGVILDQWFGYNLLVIGPNTDIPISEMTRVRRVLQVLDR 77

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
            Q                 +  LPL   SVD V++++ L+ +  P  +L E+ RVLT  G
Sbjct: 78  DQQLRKGYTG-----VYAHDEELPLETESVDVVVVLNALDLSAHPHQLLREVHRVLTPHG 132

Query: 127 RMIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
            +++V  N   +                   +     ++   L    F ++     L  P
Sbjct: 133 HLLIVGTNGWSISGLWHRLARLVTGYRSEHARAPGLRRLEDWLTLLEFAIAPVRHKLVVP 192

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITE-SKKKHISSPILVPH 238
                   +     ++        F   Y+I A K++     +    + +     + VP+
Sbjct: 193 AAGSSRWTRWLVSVDEWLVDHNIPFGSTYMIFADKLVRGNTKMHSFERTRARLMGLSVPN 252

Query: 239 TV 240
           +V
Sbjct: 253 SV 254


>gi|259909389|ref|YP_002649745.1| Methyltransferase type 11 [Erwinia pyrifoliae Ep1/96]
 gi|224965011|emb|CAX56541.1| Methyltransferase type 11 [Erwinia pyrifoliae Ep1/96]
 gi|283479462|emb|CAY75378.1| Uncharacterized protein yafS [Erwinia pyrifoliae DSM 12163]
          Length = 233

 Score =  100 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 79/240 (32%), Gaps = 27/240 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+   DA++  L  +   + G  LL +G            +   +    +G+
Sbjct: 14  ESWSQIPCGEYYRDALAHQLRPSLGKIFGFHLLKIGRLSAEIDTESCAIAHQVNVGLSGE 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                              +LP    SVD  L+ H L ++ DP  +L E+ RVL   G +
Sbjct: 74  LMQ----------IRADPLSLPFESKSVDACLLAHTLAWSSDPHCLLREVDRVLVDDGWI 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +      + + YS  +++  L   N+ +   +     P   
Sbjct: 124 IISGFNLFSLLGMGKLIPGLHRRIPWNSRMYSQMRLLDWLSLLNYEVIRRTCFQVLPWNC 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +   +          +   P    + +I ARK  +         KK    P L    V++
Sbjct: 184 QGGEM---------ISTHLPALGCMNLIVARKRTFPLT--RNPAKKSAGKPRLHAVGVTS 232


>gi|238759158|ref|ZP_04620326.1| hypothetical protein yaldo0001_25220 [Yersinia aldovae ATCC 35236]
 gi|238702574|gb|EEP95123.1| hypothetical protein yaldo0001_25220 [Yersinia aldovae ATCC 35236]
          Length = 239

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 80/242 (33%), Gaps = 27/242 (11%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
           R  I     +     G+    A+ + L   W    G  LL +G+     +     +    
Sbjct: 7   RQKINAPASWAELPWGEYYRAALEQQLQPWWPKFFGFHLLKIGHLSAEIASDTCAISHQ- 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                     N   Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RV
Sbjct: 66  ---------VNVGVQGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRV 116

Query: 122 LTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +         +        + ++  +++  L   N+ +   S  
Sbjct: 117 LIDDGWLVISNFNPMSILGAGKLVPLLRQRQPYVSRMFTQMRLLDWLSLLNYEVMHMSCF 176

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSP 233
              P   +           +  +   P    + +I ARK        P+    +K   S 
Sbjct: 177 HVLPWHKEGG---------RFISTHLPALGCVSLIVARKRTVPLTFNPMKFGARKPWFSR 227

Query: 234 IL 235
            +
Sbjct: 228 AV 229


>gi|152968803|ref|YP_001333912.1| putative methyltransferase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|330005757|ref|ZP_08305369.1| methyltransferase domain protein [Klebsiella sp. MS 92-3]
 gi|150953652|gb|ABR75682.1| putative methyltransferase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|328536125|gb|EGF62513.1| methyltransferase domain protein [Klebsiella sp. MS 92-3]
          Length = 222

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 73/229 (31%), Gaps = 27/229 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G+   + + + +      + G  LL +G      +     +   +    AG       
Sbjct: 2   PWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAISHQVNVSLAGNPMQ--- 58

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
                        +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N
Sbjct: 59  -------VRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFN 111

Query: 135 KRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              +                + + ++  + +  L   NF +    R    P +       
Sbjct: 112 PVSLMGLRKLVPVLRKGTPYNSRMFTLMRQLDWLALLNFEVLHYGRYQVLPWSRHGG--- 168

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                 K+ +   P    + +I ARK        P+   K K    P +
Sbjct: 169 ------KLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLRPAV 211


>gi|288937009|ref|YP_003441068.1| methyltransferase type 11 [Klebsiella variicola At-22]
 gi|288891718|gb|ADC60036.1| Methyltransferase type 11 [Klebsiella variicola At-22]
          Length = 240

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 77/239 (32%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +     + S   G+   + + + +      + G  LL +G      +     +   +   
Sbjct: 10  VTAPEHWSSMPWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAISHQVNVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            AG                    +LP A+ SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 70  LAGNPMQ----------VRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G MI+   N   +           +    + + ++  + +  L   NF +    R    
Sbjct: 120 DGWMILTGFNPVSLMGLRKLVPLLRNGTPYNSRMFTLMRQLDWLSLLNFEVLHYGRYQVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P +             K+ +   P    + +I ARK        P+   K K    P +
Sbjct: 180 PWSRHGG---------KLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLRPAV 229


>gi|260221007|emb|CBA29142.1| hypothetical protein Csp_A10660 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 175

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 66/168 (39%), Gaps = 14/168 (8%)

Query: 89  LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148
           +P   +S+D +++ H LEF+ DP   L E+ RVL   G++++   N   +W   +     
Sbjct: 1   MPFPANSMDLLVLPHALEFSPDPHAALREVERVLVPEGKVVICGLNPASLWGWRQRRSRW 60

Query: 149 SGQP-------------YSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
             +                ++++   LR  +F +       + P       L+ +S  ++
Sbjct: 61  YQRLGWGRVFLPGWGDLIGYWRLRDWLRLLSFEVEAGRFGCYRPAVDSPEWLRRFSWLDR 120

Query: 196 IGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP-ILVPHTVST 242
           IG  + P F   Y + A K +     +  + K         VP T  T
Sbjct: 121 IGGRWWPIFGAAYFVVATKRVRGMRLLGGAWKAAAKRSTAAVPVTQQT 168


>gi|290509927|ref|ZP_06549297.1| methyltransferase [Klebsiella sp. 1_1_55]
 gi|289776643|gb|EFD84641.1| methyltransferase [Klebsiella sp. 1_1_55]
          Length = 240

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 77/239 (32%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +     + S   G+   + + + +      + G  LL +G      +     +   +   
Sbjct: 10  VTAPEHWSSMPWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAISHQVNVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            AG                    +LP A+ SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 70  LAGNPMQ----------VRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G MI+   N   +           +    + + ++  + +  L   NF +    R    
Sbjct: 120 DGWMILTGFNPVSLMGLRKLVPFLRNGTPYNSRMFTLMRQLDWLSLLNFEVLHYGRYQVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P +             K+ +   P    + +I ARK        P+   K K    P +
Sbjct: 180 PWSRHGG---------KLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLRPAV 229


>gi|161615577|ref|YP_001589542.1| hypothetical protein SPAB_03352 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364941|gb|ABX68709.1| hypothetical protein SPAB_03352 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 240

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 75/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+     + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLNPWLAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP A  SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFAGKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|261820457|ref|YP_003258563.1| methyltransferase type 11 [Pectobacterium wasabiae WPP163]
 gi|261604470|gb|ACX86956.1| Methyltransferase type 11 [Pectobacterium wasabiae WPP163]
          Length = 236

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/237 (16%), Positives = 74/237 (31%), Gaps = 28/237 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    +     G+   +++   L   W  + G  L+ +G            +   +   
Sbjct: 10  IVAPDSWDDITCGQFYRESLELALLPWWPKLFGFHLIKIGALSAEIHVTECAIAHQVNVA 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P             +         LP ++ S+D  L+   L ++ DP  +L E+ RVL  
Sbjct: 70  P----------HGDNLHVAADAHQLPFSEKSIDACLLAQTLSYSSDPHRILREVDRVLVD 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +        R+        + ++  ++   L   N+ +   +     
Sbjct: 120 DGWLILSTFNPISLVGLGKLIPRLNKKHPYCSRMFTQMRITDWLGLLNYEVIHQTHFHVT 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ--GLPITESKKKHISSP 233
           P        K     E   N   P    + +I ARK        P+    +K     
Sbjct: 180 P------WRKN----EGKLNKHIPMLGCLTLIIARKRTIPLMLTPMRSRLRKASVRR 226


>gi|88703292|ref|ZP_01101008.1| conserved hypothetical protein [Congregibacter litoralis KT71]
 gi|88702006|gb|EAQ99109.1| conserved hypothetical protein [Congregibacter litoralis KT71]
          Length = 291

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/266 (18%), Positives = 79/266 (29%), Gaps = 40/266 (15%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L  +Y+   G+    AI + L        G  +L +G                +A  P  
Sbjct: 28  LESWYARDSGEELYSAILQRLEPVLALSFGYHILQIGPL---------AQRSLIAESPIN 78

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                      S++       LPL   S+D V+  H LEF E P   L E+ RVL   G 
Sbjct: 79  HQIYASGASDRSASLYCHGDELPLESDSIDTVVAFHALEFDEHPHGSLREMQRVLRPHGH 138

Query: 128 MIVVVPNKRGMWARMEH---------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           +IVV  N   +   + +               +P S +++   LR  +  L         
Sbjct: 139 LIVVGFNPYSLLGAIHYARGLQKSSLWNRQRHRPVSLHRLTDWLRLLDCELESAQHLFPL 198

Query: 179 PPTHK-------------KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
           PP  +                 +L    +      G     +Y+  A K +         
Sbjct: 199 PPAGRPGKAGRAEQQAGQGRWRQLAGGIDAWAAGHGLPGGSVYIAHAIKQIAGIRRPRSL 258

Query: 226 KKKH---------ISSPILVPHTVST 242
           + +            SP   P    T
Sbjct: 259 RVRAKESFRGLGVAGSPAPAPQQPRT 284


>gi|261245487|emb|CBG23277.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 240

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 77/227 (33%), Gaps = 25/227 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+ + L+  +  + G  LL +G               + A   + Q  
Sbjct: 16  WGELPWGNYYREALEQQLNPWFAKMYGFHLLKIG--------NLSAEINSEACAVSHQ-- 65

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   Q      L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++
Sbjct: 66  VNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVI 125

Query: 131 VVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              N   +            TP  + + ++  + +  L   NF +   SR    P   + 
Sbjct: 126 SGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWLFLLNFEVLHYSRFHVLPWKKQG 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
                     ++ N   P    + +I ARK             K  +
Sbjct: 186 G---------RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 223


>gi|238893206|ref|YP_002917940.1| putative methyltransferase [Klebsiella pneumoniae NTUH-K2044]
 gi|238545522|dbj|BAH61873.1| putative methyltransferase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 242

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 76/239 (31%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +     + S   G+   + + + +      + G  LL +G      +     +   +   
Sbjct: 12  VTAPEHWSSMPWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAISHQVNVS 71

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            AG                    +LP A+ SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 72  LAGNPMQ----------VRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLID 121

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G MI+   N   +                + + ++  + +  L   NF +    R    
Sbjct: 122 DGWMILTGFNPVSLMGLRKLVPVLRKGTPYNSRMFTLMRQLDWLALLNFEVLHYGRYQVL 181

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P +             K+ +   P    + +I ARK        P+   K K    P +
Sbjct: 182 PWSRHGG---------KLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLRPAV 231


>gi|206576287|ref|YP_002240304.1| putative methyltransferase [Klebsiella pneumoniae 342]
 gi|206565345|gb|ACI07121.1| putative methyltransferase [Klebsiella pneumoniae 342]
          Length = 242

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 77/239 (32%), Gaps = 27/239 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +     + S   G+   + + + +      + G  LL +G      +     +   +   
Sbjct: 12  VTAPEHWSSMPWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAISHQVNVS 71

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            AG                    +LP A+ SVD  L+ H L +  DP  +L E  RVL  
Sbjct: 72  LAGNPMQ----------VRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLID 121

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G MI+   N   +           +    + + ++  + +  L   NF +    R    
Sbjct: 122 DGWMILTGFNPVSLMGLRKLVPFLRNGTPYNSRMFTLMRQLDWLSLLNFEVLHYGRYQVL 181

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           P +             K+ +   P    + +I ARK        P+   K K    P +
Sbjct: 182 PWSRHGG---------KLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLRPAV 231


>gi|26990836|ref|NP_746261.1| hypothetical protein PP_4143 [Pseudomonas putida KT2440]
 gi|24985844|gb|AAN69725.1|AE016608_11 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 266

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 84/236 (35%), Gaps = 16/236 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPAG 67
           R++++  LG+       K+L        G  L+  G  A P                P  
Sbjct: 30  REWFNGPLGQLMLKEEDKLLEEELGRFFGGYLVHYGPCAEPPPRA------------PQV 77

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q              +  E   PL++ + D V++ H L+F   P  +L E    +  GG 
Sbjct: 78  QRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGH 137

Query: 128 MIVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +++V  N    W        G+    +  S  ++   L    F L       + PP    
Sbjct: 138 LLIVGINPWSSWGMRHFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASP 197

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              +    +E++   +     G+Y++ ARK++    P+   +++ +   + +P   
Sbjct: 198 AWQQRLEGWERLAGGWQGSGGGVYLLVARKMVVGLRPLRPERREPMGKLLPLPLAK 253


>gi|258515368|ref|YP_003191590.1| Methyltransferase type 11 [Desulfotomaculum acetoxidans DSM 771]
 gi|257779073|gb|ACV62967.1| Methyltransferase type 11 [Desulfotomaculum acetoxidans DSM 771]
          Length = 240

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 80/225 (35%), Gaps = 15/225 (6%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCR-LLGLGYAIPFFSCFHGKVE-RTLA 62
             +   +    LGK      ++     + D+ G   +L +G     +             
Sbjct: 14  AAKYDLWAKLPLGKLCAKLENEAFFKAYGDIAGSDPVLDIGCGTGNYIINLAGCGLDVTG 73

Query: 63  FMPAGQGATNWPDQ-----YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
              +         +     + +S       N+P  + S   V+    LEF   P  ++ E
Sbjct: 74  LDASENMLAVARQKLTKQGFQASLVHSLAENIPFKEHSFKTVICSLALEFMGRPEKVVQE 133

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEH-------TPFGSGQPYSWYQMISLLREANFTLS 170
           I+RVL   G+ I+   N    W            T + +    S Y +  +L+EA FT  
Sbjct: 134 IFRVLQPSGQFILAFLNFWSPWNMYRMLKGYVQPTIYNNANFMSRYYVNKVLKEAGFTDF 193

Query: 171 ITSRSLFFPPTHKKCILKLW-SVFEKIGNIFGPGFAGIYVIEARK 214
              ++++FPP  K  +L      FE IG+   P  +   V++  K
Sbjct: 194 SYYKAIYFPPIEKHFMLNSMYKHFEIIGDKLFPCLSTYIVVKCHK 238


>gi|313498007|gb|ADR59373.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 257

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 84/236 (35%), Gaps = 16/236 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPAG 67
           R++++  LG+       K+L        G  L+  G  A P                P  
Sbjct: 21  REWFNGPLGQLMLKEEDKLLEEELGRFFGGYLVHYGPCAEPPPRA------------PQV 68

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q              +  E   PL++ + D V++ H L+F   P  +L E    +  GG 
Sbjct: 69  QRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGH 128

Query: 128 MIVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +++V  N    W        G+    +  S  ++   L    F L       + PP    
Sbjct: 129 LLIVGINPWSSWGMRHFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASP 188

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              +    +E++   +     G+Y++ ARK++    P+   +++ +   + +P   
Sbjct: 189 AWQQRLEGWERLAGGWQGSGGGVYLLVARKMVVGLRPLRPERREPMGKLLPLPLAK 244


>gi|227329798|ref|ZP_03833822.1| hypothetical protein PcarcW_21653 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 236

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 74/237 (31%), Gaps = 28/237 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    +     G+   ++I   L   W  + G  L+ +G            +   +   
Sbjct: 10  IVAPDSWDDITCGQFYRESIELALLPWWPKLFGFHLIKVGALSAEIHVTECAIAHQVNVA 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P             +   +     LP ++ S+D  L+   L ++ DP  +L E+ RVL  
Sbjct: 70  P----------HGDNLQVIADAHQLPFSEKSIDACLLAQTLSYSSDPHRILREVDRVLID 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +        R+        + ++  ++   L   N+ +   +     
Sbjct: 120 DGWLILSTFNPISLVGLGKLIPRLNKKHPYCSRMFTQMRITDWLGLLNYEVIDQTHFHVT 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG--LPITESKKKHISSP 233
           P        +         N   P    + +I ARK        P+    +K     
Sbjct: 180 P------WRRNKGKL----NKHIPMLGCLTLIIARKRTIPLTFTPMRARLRKASVRR 226


>gi|167034710|ref|YP_001669941.1| hypothetical protein PputGB1_3715 [Pseudomonas putida GB-1]
 gi|166861198|gb|ABY99605.1| conserved hypothetical protein [Pseudomonas putida GB-1]
          Length = 257

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 85/236 (36%), Gaps = 16/236 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPAG 67
           R++++  LG+       K+L        G  L+  G  A P  S             P  
Sbjct: 21  REWFNGPLGQLMLKEEEKLLKEELGRFFGGYLVHYGPCAEPPPSA------------PQV 68

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q              +  E   PL++ + D V++ H L+F   P  +L E    +  GG 
Sbjct: 69  QRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGH 128

Query: 128 MIVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +++V  N    W        G+    +  S  ++   L    F L       + PP    
Sbjct: 129 LLIVGINPWSSWGMRHFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASP 188

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              +    +E++   +     G+Y++ ARK++    P+   +++ +   + +P   
Sbjct: 189 AWQQRLEGWERLAGGWQGSGGGVYLLVARKMVVGLRPLRPERREPMGKLLPLPLAK 244


>gi|148546960|ref|YP_001267062.1| hypothetical protein Pput_1722 [Pseudomonas putida F1]
 gi|148511018|gb|ABQ77878.1| hypothetical protein Pput_1722 [Pseudomonas putida F1]
          Length = 257

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 84/236 (35%), Gaps = 16/236 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPAG 67
           R++++  LG+       K+L        G  L+  G  A P                P  
Sbjct: 21  REWFNGPLGQLMLKEEDKLLEEELGRFFGGYLVHYGPCAEPPPRA------------PQV 68

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           Q              +  E   PL++ + D V++ H L+F   P  +L E    +  GG 
Sbjct: 69  QRNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGH 128

Query: 128 MIVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           +++V  N    W        G+    +  S  ++   L    F L       + PP    
Sbjct: 129 LLIVGINPWSSWGMRHFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASP 188

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
              +    +E++   +     G+Y++ ARK++    P+   +++ +   + +P   
Sbjct: 189 AWQQRLEGWERLAGGWQGSGGGVYLLVARKMVVGLRPLRPERREPMGKLLPLPLAK 244


>gi|238784819|ref|ZP_04628820.1| hypothetical protein yberc0001_30750 [Yersinia bercovieri ATCC
           43970]
 gi|238714235|gb|EEQ06246.1| hypothetical protein yberc0001_30750 [Yersinia bercovieri ATCC
           43970]
          Length = 221

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 78/229 (34%), Gaps = 27/229 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G+    AI + L   W    G  LL +G+     +     +              N  
Sbjct: 2   PWGEYYRAAIEQQLQPWWPKFFGFHLLKIGHLSAEIASDKCVISHQ----------VNVG 51

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           ++  +     S   LP A+ SVD  L+ H L +A DP  +L E+ RVL   G +++   N
Sbjct: 52  ERGKNMQVFASPYQLPFAEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVISNFN 111

Query: 135 KRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              M         +        + ++  +++  L   N+ +   SR    P   +     
Sbjct: 112 PMSMLGAGKFIPILRQRQPYVSRMFTQMRLLDWLSLLNYEVLYLSRFHVLPWHKEGG--- 168

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                 +  +   P    + +I ARK        P+    +K   S  +
Sbjct: 169 ------RFISTHLPALGCVSLIVARKRTIPLTFNPMKFGARKPWFSRAV 211


>gi|268592017|ref|ZP_06126238.1| SAM-dependent methyltransferase [Providencia rettgeri DSM 1131]
 gi|291312409|gb|EFE52862.1| SAM-dependent methyltransferase [Providencia rettgeri DSM 1131]
          Length = 244

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 69/232 (29%), Gaps = 32/232 (13%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    AI   LS  W  + G  LL LG              +T   + + Q 
Sbjct: 15  SWSDIPFGEQYRQAIENQLSPWWPKIFGFHLLKLG--------HLSTEIQTEGCLISHQF 66

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N          +     LPL   S+D  LM H L ++ DP  +L E+ RVL   G +I
Sbjct: 67  --NVGTGDPRFNLVAKPEALPLTQKSIDACLMTHCLAYSHDPHWLLREVDRVLIDDGWLI 124

Query: 130 VVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N   +         +        + +   ++   L   N+ +         P    
Sbjct: 125 ISGFNPFSLLGMAKLVPVLRKRQPYCSRFFPSVRVFDWLSLLNYEVLYHRNCQIIPWLG- 183

Query: 184 KCILKLWSVFEKIGNIFGPGFAGI---YVIEARKILYQGLPITESKKKHISS 232
                                 G+    VI ARK  Y   P     K+    
Sbjct: 184 ------------ANRRVNKSCGGVGVLSVIVARKRTYPLTPTPLKFKQPKVK 223


>gi|227112971|ref|ZP_03826627.1| hypothetical protein PcarbP_08404 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 236

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 75/237 (31%), Gaps = 28/237 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    +     G+   +++   L   W  + G  L+ +G      +     +   +   
Sbjct: 10  IVAPDSWDDITCGQFYRESLELALLPWWPKLFGFHLIKVGALSAEINITECAIAHQVNVA 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P             +   +     LP ++ S+D  L+   L ++ DP  +L E+ RVL  
Sbjct: 70  P----------HGDNLHVVADAHQLPFSEKSIDACLLAQTLSYSSDPHRILREVDRVLID 119

Query: 125 GGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +        R+        + ++  ++   L   N+ +   +     
Sbjct: 120 DGWLILSTFNPISLVGLGKLIPRLNKKHPYCSRMFTQMRITDWLGLLNYEVIDQTHFHVT 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG--LPITESKKKHISSP 233
           P        +         N   P    + +I ARK        P+    +K     
Sbjct: 180 P------WRRNKGKL----NKHIPMLGCLTLIIARKRTIPLTFTPMRARLRKASVRR 226


>gi|308271520|emb|CBX28128.1| hypothetical protein N47_G34520 [uncultured Desulfobacterium sp.]
          Length = 262

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/246 (13%), Positives = 79/246 (32%), Gaps = 22/246 (8%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPF-FSCFHGKVERTLA 62
           D +E  +++     +       K+++       G  +L +G         +         
Sbjct: 9   DTIEYSKWFEKPHNRSVLALEKKLMTDMLQPSKGETILDIGCGTGESLVPYLEMGLSVTG 68

Query: 63  FMPAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
             P+         +  +     +    NLP  D+S +       LEF +DP + L E  R
Sbjct: 69  VDPSKYMLDCAIKRLANRAELRMCFAENLPFDDNSFNYASFFTSLEFTDDPKMALEEACR 128

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPF-----GSGQPYSWYQMISLLREANFTLSITSRS 175
           V      + ++       ++      F        + ++ +++  +L+E    + I+  +
Sbjct: 129 VAKDKIFIGILNSYSINAFSIRIKKHFSETLYSHAKFFNVWEIKKILKELLGDVPISWNT 188

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
           +   P     I   +   +         F GI        +   +P      +  + P+ 
Sbjct: 189 VCEFPFRSCIIANKFDKADFTIKYPFSPFVGI--------VVTLIP------RFRTKPLA 234

Query: 236 VPHTVS 241
           + ++ S
Sbjct: 235 IKYSAS 240


>gi|296101378|ref|YP_003611524.1| hypothetical protein ECL_01012 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055837|gb|ADF60575.1| hypothetical protein ECL_01012 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 238

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/233 (16%), Positives = 71/233 (30%), Gaps = 25/233 (10%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           +    ++     G+   +A+   L      + G  LL +G      +     +   +   
Sbjct: 10  VAAPERWAELPWGEYYREALELQLKPWLAKMYGFHLLKIGNLSAEINTESCAISHQVHVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                                  +LP A+ SVD  L+ H + +  DP  ML E  RVL  
Sbjct: 70  L----------GGSPVQVKADPLHLPFAEKSVDACLLAHTIPWCSDPHRMLREADRVLID 119

Query: 125 GGRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   N   +            TP  + + ++  + +  L   NF +         
Sbjct: 120 DGWLVISGFNPLSLMGLRKLVPVLRRTPPYNSRMFTMMRQLDWLSLLNFEVLSYGGFQVL 179

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
           P   K  +L          +   P    +  I ARK           + K  +
Sbjct: 180 PWARKGGVL---------LSTHLPALGCMQFIVARKRTIPLTLNPMKQSKTKT 223


>gi|188534760|ref|YP_001908557.1| hypothetical protein ETA_26360 [Erwinia tasmaniensis Et1/99]
 gi|188029802|emb|CAO97682.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 233

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 76/230 (33%), Gaps = 29/230 (12%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFF-SCFHGKVERTLAFMPAG 67
             +     G+   DA+S  L      + G  LL +G       +       +    M   
Sbjct: 14  ESWSQIPCGEYYRDALSHQLRPCLAKIFGFHLLKIGGLSAEIDTECCAIAHQVNVGMTGE 73

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                          L    +LP    SVD  L+ H L ++ DP  +L E+ RVL   G 
Sbjct: 74  PM-----------QVLADPISLPFESKSVDACLLAHTLAWSSDPHRLLREVDRVLVDDGW 122

Query: 128 MIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           +I+   N   +         +      + + YS  +++  L   N+ +   +R    P +
Sbjct: 123 IILSGFNLFSVLGIGKLIPGLHRRVPWNSKMYSQMRLLDWLSLLNYEVIQRTRLQVLPWS 182

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKH 229
            +           K+ +   P    I +I ARK  +     P     +K 
Sbjct: 183 RQGG---------KMISTHLPALGCINLIVARKRTFPLTKNPAKNMARKR 223


>gi|325277450|ref|ZP_08143059.1| hypothetical protein G1E_27667 [Pseudomonas sp. TJI-51]
 gi|324097420|gb|EGB95657.1| hypothetical protein G1E_27667 [Pseudomonas sp. TJI-51]
          Length = 245

 Score = 98.7 bits (244), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 83/235 (35%), Gaps = 14/235 (5%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
           R++++  LG+       ++L        G  L+  G                    P  Q
Sbjct: 21  REWFNGPLGQLMLKEEDQLLEEELGRFFGGYLVHYGPCAEAPPQA-----------PQVQ 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +  E   PL++ + D V++ H L+F   P  +L E    +  GG +
Sbjct: 70  RNVRLGAPLPGVEIVCEEQAWPLSEHAADVVVLQHGLDFCLSPHGLLREAASAVRPGGHL 129

Query: 129 IVVVPNKRGMWARMEHTPFGS---GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
           ++V  N    W        G+    +  S  ++   L    F L       + PP     
Sbjct: 130 LIVGINPWSSWGLRHFFSHGALRKARCISPSRVGDWLNLLGFALEKRRFGCYRPPLASPA 189

Query: 186 ILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +    +E++   +     G+Y++ ARK++    P+ + +++ +   + +P   
Sbjct: 190 WQQRLQGWERLAGGWQGAGGGVYLLVARKMVVGLRPLRQQRREPMGKLLPLPLAK 244


>gi|134299117|ref|YP_001112613.1| type 11 methyltransferase [Desulfotomaculum reducens MI-1]
 gi|134051817|gb|ABO49788.1| Methyltransferase type 11 [Desulfotomaculum reducens MI-1]
          Length = 244

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 75/183 (40%), Gaps = 9/183 (4%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +Y    G+   + I  +LS       G ++L  G        +  K    +    + +  
Sbjct: 18  WYK---GR--REIIGTLLSPFLKC--GNKILDAGCGAGGTMEYMLKYGCVVGVDISPEMV 70

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            +  +   S+        LP  + S D VL +  LE   D    LHE+ RV+  GG ++ 
Sbjct: 71  EHCRNIGLSAYCEG-VERLPFENHSFDLVLCLDVLEHLPDERPALHELKRVVRPGGMLVF 129

Query: 131 VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            VP  R +W R +       + Y++ ++I+LL+++N  +  T+   FF       + +L 
Sbjct: 130 TVPAFRWLWGRHDELN-NHYRRYNFGELINLLKKSNLRVERTTYFNFFLLPSVWLVRRLG 188

Query: 191 SVF 193
            V 
Sbjct: 189 RVL 191


>gi|238794445|ref|ZP_04638055.1| hypothetical protein yinte0001_6340 [Yersinia intermedia ATCC
           29909]
 gi|238726240|gb|EEQ17784.1| hypothetical protein yinte0001_6340 [Yersinia intermedia ATCC
           29909]
          Length = 239

 Score = 97.9 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 78/242 (32%), Gaps = 27/242 (11%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61
              I     +     G+    A+ + L   W    G  LL +G      +     +    
Sbjct: 7   HQQIDAPTSWAELPWGEYYRAALEQQLQPWWPKFFGFHLLKIGQLSAEIASDKCAISHQ- 65

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
                     N  +Q  +   L S   LP A+ SVD  L+ H L +A DP  +L E+ RV
Sbjct: 66  ---------VNVGEQGTNMQVLASPYQLPFAEKSVDACLLSHSLAYATDPHRILREVDRV 116

Query: 122 LTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           L   G +++   N   +         +        + ++  +++  L   N+ +   S  
Sbjct: 117 LIDDGWLVISNFNPISILGAGKLVPLLRQRQPYVSRMFTQMRLLDWLSLLNYEVMHMSCF 176

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSP 233
              P   +           +  +        + +I ARK        P+    +K   S 
Sbjct: 177 HVLPWHKEGG---------RFISTHLHALGCVSLIVARKRTIPLTFNPMKFGARKPWFSR 227

Query: 234 IL 235
            +
Sbjct: 228 AV 229


>gi|37524933|ref|NP_928277.1| hypothetical protein plu0941 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784359|emb|CAE13236.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 237

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 66/230 (28%), Gaps = 26/230 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    A+ + L   W  + G  LL +G            +           
Sbjct: 14  ASWADLPWGEYYRAALERQLQPWWPKIFGFHLLKVGNLSAEIDSNGCPIFNQ-------- 65

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N   +  +   +    +LP  + SVD  L+ H L ++ DP  +L E+ RV+   G +
Sbjct: 66  --INVGREGKNMQVISDPYHLPFEEKSVDACLLSHMLAYSADPHRLLREVDRVMIDDGWL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +        + +S  + +  L   N+ +         P   
Sbjct: 124 IISGFNSLSLLGLGKLVPGLWRHQPYCSRMFSMMRQLDWLSLLNYEVVYRDSFQVLP--- 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                          N        + +I ARK             +    
Sbjct: 181 ---WRNETGF----SNRHLSVLGCVSLIIARKRTLPLTLNQRKVTRLKPK 223


>gi|307132181|ref|YP_003884197.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Dickeya dadantii 3937]
 gi|306529710|gb|ADM99640.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Dickeya dadantii 3937]
          Length = 240

 Score = 97.5 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 84/239 (35%), Gaps = 26/239 (10%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + +   G+     ++  L+  W  + G  LL +G            ++  +  +P   
Sbjct: 14  DSWEAIPWGEHYLHTLNTALAPWWSRIFGFHLLKIG-------RLSTAIDSQICTIPHQV 66

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +  P    ++  +     LP  + SVD  L+ H L ++ DP  ++ E+ R+L + G +
Sbjct: 67  NVSREP---QAAHVMADPYQLPFVEKSVDACLLAHVLAYSADPHRIVREVDRILINDGWV 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         M        + +S  +++  L   N+ +   +     P   
Sbjct: 124 IISGFNPVSLVGLGRLVPGMRRRQPYCSRMFSQMRVMDWLSLLNYEIVHHNSLQVLPWRQ 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                          N   P    + +I ARK       +T +K +   SP+  P   +
Sbjct: 184 PGQGKW---------NNTLPLLGCLNLIVARKRTIPLT-MTPTKSRLRKSPLNRPVGAT 232


>gi|262044052|ref|ZP_06017132.1| SAM-dependent methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259038624|gb|EEW39815.1| SAM-dependent methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 222

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 73/229 (31%), Gaps = 27/229 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G+   + + + +      + G  LL +G      +     +   +    AG       
Sbjct: 2   PWGEYYRETLEQQMKPWLAKLYGFHLLKIGNLSAEINTEACAISHQVNVSLAGNPMQ--- 58

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
                        +LP A+ SVD  L+ H L +  DP  +L E  RVL   G MI+   N
Sbjct: 59  -------VRADPLHLPFAEKSVDACLLAHTLPWCSDPHRLLREADRVLIDDGWMILTGFN 111

Query: 135 KRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              +                + + ++  + +  L   NF +    R    P +       
Sbjct: 112 PVSLMGLRKLVPVLRKGTPYNSRMFTLMRQLDWLALLNFEVLHYGRYQVLPWSRHGG--- 168

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                 K+ +   P    + +I ARK        P+   K K    P +
Sbjct: 169 ------KLLSTHLPALGCLQLIVARKRTIPLTLNPMKSGKAKTQLWPAV 211


>gi|269140168|ref|YP_003296869.1| methyltransferase type 11 [Edwardsiella tarda EIB202]
 gi|267985829|gb|ACY85658.1| methyltransferase type 11 [Edwardsiella tarda EIB202]
 gi|304560001|gb|ADM42665.1| SAM-dependent methyltransferase [Edwardsiella tarda FL6-60]
          Length = 240

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 75/224 (33%), Gaps = 25/224 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G     A+   L+  W  + G  LL LG      +     +   ++  P G+  
Sbjct: 16  WRQIPWGVHYRAALELRLTPWWPKLFGYHLLKLGALSTDLATDRCTISHQVSVAPEGEHL 75

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                       +    +LP A  SVD  L+ H L ++ DP  +L E+ RVL   G +I+
Sbjct: 76  Q----------VIADPAHLPFAAKSVDACLLAHTLGYSRDPHRVLREVDRVLVDDGWLII 125

Query: 131 VVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              +   +         +      + + +S  ++I  L   N+ +   SR    P     
Sbjct: 126 SGFSPLSLLGMGRLVPGLRRRVPYNSRMFSMGRLIDWLNLLNYEVLAASRFQVLPWHQPC 185

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
                      + +   P    + +I ARK         +   +
Sbjct: 186 V---------SLLSRHFPAMGCLMLIVARKRTVPLTLTPQRVLR 220


>gi|183601082|ref|ZP_02962575.1| hypothetical protein PROSTU_04707 [Providencia stuartii ATCC 25827]
 gi|188019423|gb|EDU57463.1| hypothetical protein PROSTU_04707 [Providencia stuartii ATCC 25827]
          Length = 241

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 67/229 (29%), Gaps = 26/229 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    A+   L   W  + G  LL LG+           V            
Sbjct: 15  SWSDIPFGEHYRQALQYQLRPWWPKIFGFHLLKLGHLSTEVDTEECMVSHQFCL------ 68

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                +       +     LP    S+D  L+ H L ++ DP  +L E+ RVL   G +I
Sbjct: 69  ----GNDDPRFQVIAEPQALPFTAKSIDACLISHMLAYSHDPHWVLREVDRVLVDDGWLI 124

Query: 130 VVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N         M   +        + +   ++   L   N+ +        FP    
Sbjct: 125 ISGFNPFSLLGIGKMVPFLRKQQPYCSRLFPTLRVFDWLSVLNYEVLYHRNCQVFPWHGP 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           +  L               G   + VI ARK  Y   P     K+    
Sbjct: 185 ENWLNQR----------IKGVGTLNVIVARKRTYPLTPTLLKFKQPKVK 223


>gi|83590024|ref|YP_430033.1| UbiE/COQ5 methyltransferase [Moorella thermoacetica ATCC 39073]
 gi|83572938|gb|ABC19490.1| UbiE/COQ5 methyltransferase [Moorella thermoacetica ATCC 39073]
          Length = 230

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 59/166 (35%), Gaps = 14/166 (8%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMP 65
           +   +Y+  LG        + +    D   G  +L +G     FS    +   +      
Sbjct: 11  DYDDWYTRPLGALVDRVEKEPIYAYLDPHAGEHILDVGCGTGNFSLELARRGVKVTGIDI 70

Query: 66  AGQGATNWPDQYF-----SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +         +                NLP  D++ D ++ V  LEFA D   +L E +R
Sbjct: 71  SDPMLAKARKKAADAGLAIEFLHADAMNLPFGDNTFDKIVSVTALEFAPDLKAVLEESYR 130

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTP--------FGSGQPYSWYQM 158
           VL  GGRM++ +     +W+R             F   + Y+  ++
Sbjct: 131 VLKPGGRMVIGLIGGNSLWSRHYEARAAREPDCLFRYARFYTLDEL 176


>gi|212709214|ref|ZP_03317342.1| hypothetical protein PROVALCAL_00248 [Providencia alcalifaciens DSM
           30120]
 gi|212688126|gb|EEB47654.1| hypothetical protein PROVALCAL_00248 [Providencia alcalifaciens DSM
           30120]
          Length = 241

 Score = 96.7 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 70/230 (30%), Gaps = 26/230 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    A+   L+  W  + G  LL LG+           +           
Sbjct: 14  ASWSDIPFGEHYRQALEAQLAPWWQKMFGYHLLKLGHLSTEIHTKECMIPHQFTV----- 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                 +         +   LP AD  +D  LM H L ++ DP  +L E+ RVL   G +
Sbjct: 69  -----GEDPHLFDVAANPEALPFADKVIDACLMPHLLAYSHDPHWILREVDRVLIDDGWL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +        + +   ++   L   N+ +         P   
Sbjct: 124 ILSGFNPFSLAGMAKLVPILRKQQPYCSRFFPSLRVFDWLGLLNYEVLYHRNCQALPWLS 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            +          ++    G G   + VI ARK  Y   P     K+    
Sbjct: 184 SEK---------RVNKRCG-GLGVMSVIVARKRTYPLTPTPLKFKQPKVK 223


>gi|238755082|ref|ZP_04616429.1| hypothetical protein yruck0001_22750 [Yersinia ruckeri ATCC 29473]
 gi|238706642|gb|EEP99012.1| hypothetical protein yruck0001_22750 [Yersinia ruckeri ATCC 29473]
          Length = 230

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 76/235 (32%), Gaps = 27/235 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    AI + L   W    G  LL +G      +     +           
Sbjct: 5   ASWAELPWGEYYRAAIEQQLQPWWPKFFGFHLLKIGQLSAEIASGSCAISHQ-------- 56

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N  +Q  +   L S   LP A+ SVD  L+ H L ++ DP  +L E  RVL   G +
Sbjct: 57  --VNVGEQGRNMQVLASPYQLPFAEKSVDACLLSHSLTYSVDPHRILREADRVLIDDGWL 114

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +      + + ++  +++  L   N+ +   S     P   
Sbjct: 115 IITAFNPMSLLGVGKLLPVIRSRQPYASRMFTQMRLLDWLSLLNYEVMHQSCFHVLPWHK 174

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           +           +           I +I ARK        P+    +K   S  +
Sbjct: 175 QGG---------RFLGTHLHALGCISLIVARKRTIPLTFNPMKMGVRKPWLSRAV 220


>gi|253988340|ref|YP_003039696.1| hypothetical protein PAU_00859 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779790|emb|CAQ82951.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 238

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 68/230 (29%), Gaps = 26/230 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    A+ + L   W  + G  LL +G            +   +       
Sbjct: 14  ASWADLPWGEYYRAALERQLQPWWQKIFGFHLLKIGNLSAEIDSKECPIFNQINV----- 68

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +  +   +    +LP  +  VD  L+ H L +++DP  +L E+ RV+   G +
Sbjct: 69  -----GKEGKNMQVITDPYHLPFEEKCVDACLLSHMLAYSDDPHRLLREVDRVMIDDGWL 123

Query: 129 IVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +          +S  + +  L   N+ +         P   
Sbjct: 124 IISGFNSLSLLGLGKLVPGLWRYQPYCSHMFSLMRQLDWLSLLNYEVLYRGNFQVLP--- 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                     F    N + P F  + +I ARK                  
Sbjct: 181 ---WRNETGFF----NRYFPVFGCVSLIIARKRTLPLTLNQIKVTLLKPK 223


>gi|292487328|ref|YP_003530200.1| hypothetical protein EAMY_0842 [Erwinia amylovora CFBP1430]
 gi|292898574|ref|YP_003537943.1| methyltransferase [Erwinia amylovora ATCC 49946]
 gi|291198422|emb|CBJ45530.1| putative methyltransferase [Erwinia amylovora ATCC 49946]
 gi|291552747|emb|CBA19792.1| Uncharacterized protein yafS [Erwinia amylovora CFBP1430]
 gi|312171434|emb|CBX79692.1| Uncharacterized protein yafS [Erwinia amylovora ATCC BAA-2158]
          Length = 233

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 75/240 (31%), Gaps = 27/240 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+   DA+   L  +   + G  LL +G            +   +    +G 
Sbjct: 14  ESWSQIPCGEYYRDALVHQLRPSLGKIFGYHLLKIGRLSAEIDTESCAITHQVNVGFSGD 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                              +LP    SVD  L+ H L ++ DP  +L E+ R+L   G +
Sbjct: 74  LMQ----------VRADPLSLPFESKSVDACLLAHTLAWSSDPHCLLREVDRILIDDGWI 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +      +   YS  +++  L   N+ +   +     P   
Sbjct: 124 IISGFNLFSLLGIGKLIPGLHRRIPWNSSMYSQMRLLDWLSLLNYEVIRRTCFQVLPWNC 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVST 242
           +   +          +   P    + +I ARK  +         KK      L    V++
Sbjct: 184 QGGEM---------ISTHLPALGCMNLIVARKRTFPLT--KNPAKKSAGKRRLHAVGVTS 232


>gi|261346346|ref|ZP_05973990.1| SAM-dependent methyltransferase [Providencia rustigianii DSM 4541]
 gi|282565660|gb|EFB71195.1| SAM-dependent methyltransferase [Providencia rustigianii DSM 4541]
          Length = 241

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 74/235 (31%), Gaps = 27/235 (11%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           +I     + +   G+    A+   L+  W  + G  LL LG+           +    + 
Sbjct: 9   NIQMPASWSAIPFGEHYRQALDIQLAPWWQKIFGFHLLKLGHLSTEIQTKQCMIPHQFSL 68

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
                      +         +   LP AD ++D  +M H L ++ +P  +L E+ RVL 
Sbjct: 69  ----------GEDSNIFDVAAAPEALPFADKTIDACVMSHMLAYSNNPHWILREVDRVLI 118

Query: 124 SGGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
             G +I+   N   +         +        + +   ++   L   N+ +        
Sbjct: 119 DDGWLIISGFNPFSLAGMAKLVPILRKQQPYCSRFFPSLRVFDWLGLLNYEVLYHQNCQV 178

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
            P       +       K G     G   I VI ARK  Y   P     K+    
Sbjct: 179 IP------WMSPDKRINKCG-----GVGVISVIVARKRTYPLTPTPLKFKQPKVK 222


>gi|239996321|ref|ZP_04716845.1| SAM-dependent methyltransferase [Alteromonas macleodii ATCC 27126]
          Length = 285

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 48/266 (18%), Positives = 95/266 (35%), Gaps = 34/266 (12%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    A++ V S   + + G     LG      +     +   +  +P    
Sbjct: 15  NWNDFPAGEHIRHAVNAVCSDYAERIFGYHFAKLGSLSADINLDTSPIRHHINHVPFSDL 74

Query: 70  ATNWPDQYFS--------------------------STALVSEGNLPLADSSVDCVLMVH 103
           A+  P    +                          +T +     LP A++S+D  L+ +
Sbjct: 75  ASERPHHNETKEGFPNHNASGISLGGDKREPKISRENTVVGQSHCLPFAENSIDGFLLAN 134

Query: 104 YLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSG------QPYSWYQ 157
            L+FA+DP  +L E+ RV+T  G +I+   N   +    +  P   G      + ++ Y+
Sbjct: 135 ELDFAQDPHEILREVDRVITQNGYVIISGFNPLSLAGIAKFLPVKRGNILHDARFFTSYR 194

Query: 158 MISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
           +   L+   F +    + +F     ++   K     +     + P  + +YVI A+K + 
Sbjct: 195 IKDWLQLLGFEIVEQRQVMFSTLFFQQKW-KGAVKLQDYLASYLPWCSAVYVILAKKRVI 253

Query: 218 QGLPITESKK-KHISSPILVPHTVST 242
               I   +  K   S +      ST
Sbjct: 254 PMTAIKPKRNLKPRFSAVGASVRTST 279


>gi|300724513|ref|YP_003713836.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Xenorhabdus nematophila ATCC 19061]
 gi|297631053|emb|CBJ91739.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Xenorhabdus nematophila ATCC 19061]
          Length = 246

 Score = 95.6 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 76/234 (32%), Gaps = 28/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+     + + L   W  + G  LL +G               + + + + Q 
Sbjct: 15  SWAELPWGEYYRTVLERQLEPWWPKIFGFHLLKIG--------NLSTAIDSRSCLVSHQ- 65

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N      +   +     LP A  SVD  L+ H L ++ DP  +L E+ RV+   G +I
Sbjct: 66  -VNIGLPGENMDVMADPHYLPFATKSVDACLLAHMLTYSVDPHWLLREVDRVIIDDGWVI 124

Query: 130 VVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N             +        + +S  + +  LR  N+ +   +     P  + 
Sbjct: 125 ISGFNPISALGLKTAVSSIYRRQPCRVRMFSMLRQLDWLRLLNYEVIYHANFHVLPWQNG 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
               +               F  + +I ARK        P+  ++ K   S  L
Sbjct: 185 SRCHRSDPSI----------FGCLNMIIARKRTIPLTLNPMRSTRLKPKFSNAL 228


>gi|27479698|gb|AAO17225.1| Orf71 [Photorhabdus luminescens]
          Length = 257

 Score = 95.6 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 65/230 (28%), Gaps = 26/230 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    A+ + L   W  + G  LL +G            +           
Sbjct: 33  ASWVDLPWGEYYRAALERQLQPWWPKIFGFHLLKVGNLSAEIDSKECPIFNQ-------- 84

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N   +  +   +    +LP  + SVD  L+ H L ++ DP  +L E+ RV+   G +
Sbjct: 85  --INVGKEGKNMQVITDPYHLPFEEKSVDACLLSHMLAYSADPHRLLREVDRVMIDDGWL 142

Query: 129 IVVVPNKRGMW------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +        + +S  + +  L   N+ +         P   
Sbjct: 143 IISGFNSLSLLGLGKLVPGLWRHQPYCSRMFSLMRQLDWLSLLNYEVMYRDSFQILP--- 199

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                          N        + +I ARK                  
Sbjct: 200 ---WRNETGFV----NRRLSVLGCVSLIIARKRTLPLTLNQMKVTLLKPK 242


>gi|294503096|ref|YP_003567158.1| hypothetical protein YPZ3_0986 [Yersinia pestis Z176003]
 gi|294353555|gb|ADE63896.1| hypothetical protein YPZ3_0986 [Yersinia pestis Z176003]
          Length = 230

 Score = 94.8 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 75/229 (32%), Gaps = 27/229 (11%)

Query: 15  FLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWP 74
             G+    A+ + L   W    G  LL +G+     +     +              N  
Sbjct: 11  PWGEYYRAALEQQLQPWWPKFFGFHLLKVGHLSAEIASDKCAIAHQ----------VNVG 60

Query: 75  DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +   +   L S   LP A+ SVD  L+ H L +A +P  +L E+ RVL   G +++   N
Sbjct: 61  EWGKNMQVLASPYQLPFAEKSVDACLLSHTLAYAANPHRILREVDRVLIDDGWLVISGFN 120

Query: 135 KRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
              +         +        + ++  +++  L   N+ +   S     P         
Sbjct: 121 PFSLLGLGKLVPVLRQRQPYISRMFTQMRLLDWLSLLNYEVVHLSCFHVLPFNKNGG--- 177

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                    +   P    + +I ARK        P+    +K   S  +
Sbjct: 178 ------HFISTHLPALGCVNLIIARKRTVPLTFNPMKFGVRKPWFSRAV 220


>gi|251788639|ref|YP_003003360.1| type 11 methyltransferase [Dickeya zeae Ech1591]
 gi|247537260|gb|ACT05881.1| Methyltransferase type 11 [Dickeya zeae Ech1591]
          Length = 239

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 83/239 (34%), Gaps = 27/239 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + S   G      ++  L+  W  + G  LL +G            ++     +P   
Sbjct: 14  DSWDSIPWGPHYLHTLNMALAPWWSRIFGFHLLKIGGLS-------TAIDSQTCTIPHQV 66

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +  P     +  +     LP  + SVD  L+ H L +A DP  ++ E+ RVL + G +
Sbjct: 67  NVSREP----LAHVMADPYQLPFVEKSVDACLLAHVLTYAADPHRVVREVDRVLINDGWV 122

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         M        + +S  +++  L   N+ +   +     P   
Sbjct: 123 IISGFNPVSLIGLGRLVPGMRRRQPYCSRMFSQMRVMDWLSLLNYEIVHHNSLQVLP--- 179

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTVS 241
                +     E   +   P    + +I ARK       +T SK     SP+  P  V+
Sbjct: 180 ---WRRPG---EGAWSNTLPLLGCLTLIVARKRTIPLT-MTPSKSLLRKSPLHRPVGVT 231


>gi|238921064|ref|YP_002934579.1| hypothetical protein NT01EI_3195 [Edwardsiella ictaluri 93-146]
 gi|238870633|gb|ACR70344.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 234

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 75/221 (33%), Gaps = 25/221 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G     A+   L+  W  + G  LL LG      +     +   ++  P G+  
Sbjct: 10  WRQIPWGLHYRAALELRLTPWWPKLFGYHLLKLGTLSTDLATDRCTISHQVSVAPEGEHL 69

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                       +    +LP A  SVD  L+ H L ++ DP  +L E+ RVL   G +I+
Sbjct: 70  Q----------VIAEPAHLPFAAKSVDACLLAHTLGYSHDPHRVLREVDRVLVDDGWLII 119

Query: 131 VVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              +   +         +      S + +S  ++I  L   N+ +   SR    P  +  
Sbjct: 120 SGFSPLSLLGMGKLVPGLRRRLPYSSRMFSMGRLIDWLNLLNYEVLAASRFQVLPWHNPC 179

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                      + +   P    + +I ARK         + 
Sbjct: 180 V---------SLLSRHFPAMGCLMLIVARKRTVPLTLTPQR 211


>gi|332141408|ref|YP_004427146.1| SAM-dependent methyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551430|gb|AEA98148.1| SAM-dependent methyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 297

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/265 (17%), Positives = 91/265 (34%), Gaps = 34/265 (12%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+   DA+  V     + + G     LG      +     +   +  +P    
Sbjct: 27  SWKDFPAGEHIRDAVKTVCDDYAEHIFGYHFAKLGSLSAEINLDTSPIRHHINQVPFDNQ 86

Query: 70  ATNWPDQYFSSTALVSE--------------------------GNLPLADSSVDCVLMVH 103
                D   +S  +                              +LP A++S+D  L+ +
Sbjct: 87  FGRQLDANNASEDIADNKVSPSQLHEKSSESTINKGNMVVGQSHSLPFAENSIDGFLLAN 146

Query: 104 YLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSG------QPYSWYQ 157
            L+FA+DP  +L E+ RV+T  G +I+   N   +    +  P   G      + ++ Y+
Sbjct: 147 ELDFAQDPHEILREVDRVITQNGYVIISGFNPLSLAGIAKFLPVKRGNILHDARFFTSYR 206

Query: 158 MISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
           M   L+   F +    + LF     ++   K  +  +     + P  + +YVI A+K + 
Sbjct: 207 MKDWLQLLGFEIVEQRQVLFSTLFFQQRW-KGAAKLQHYLASYLPWCSAVYVILAKKRVI 265

Query: 218 QGLPITESKKKHISSPILVPHTVST 242
               I   +         V  +  T
Sbjct: 266 PMTAIKPKRN-LKPRFSAVGASART 289


>gi|37521990|ref|NP_925367.1| hypothetical protein gll2421 [Gloeobacter violaceus PCC 7421]
 gi|35212989|dbj|BAC90362.1| gll2421 [Gloeobacter violaceus PCC 7421]
          Length = 253

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 64/195 (32%), Gaps = 7/195 (3%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFM 64
            +L  +Y+  LG+     + + +      + G   L +G     +S    +   R     
Sbjct: 48  ADLDDYYAGPLGRRYLRRVWEAVEPLLRPLGGVEALDVGCGAGHYSELLARAGARVTGID 107

Query: 65  PAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           P          +       +     LP AD   + +L  + LEF  D    + E+ RV  
Sbjct: 108 PDADLVELARRRVPGGEFQIAGVNALPFADGRFERLLCANVLEFVRDQGGAMREMRRVCR 167

Query: 124 SGGRMIVVVPNKRGM-----WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
               + V+            +      P+  G+ ++  ++    +   + L     ++ F
Sbjct: 168 GEAVVCVLNRGSLWGVQQQLFGPFTSHPYYQGRFFTPERLEQAAKLGGWRLVSLQEAVRF 227

Query: 179 PPTHKKCILKLWSVF 193
           PP   + +L     +
Sbjct: 228 PPLPVEPLLGWLDGW 242


>gi|94970154|ref|YP_592202.1| methyltransferase type 11 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552204|gb|ABF42128.1| Methyltransferase type 11 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 261

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 81/254 (31%), Gaps = 35/254 (13%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            ++  FY  F+ +     I +V+ST   D     +L +G           +         
Sbjct: 10  YDVESFYWWFIAR--RKLIREVVSTHSKDPAHTTILDVGCGTGLNHEMLSEFGEVFGTDA 67

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           + +       +   +  L     L  AD + + V  +  LE   D    + EIWRV+   
Sbjct: 68  SEEALRFSRQRNIQNLVLSDAEALQFADETFEIVTALDVLEHVNDDLKAISEIWRVMKPD 127

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL---FFPPTH 182
           G  ++ VP    +W+  +       + Y+ +++ + L  A F +  ++  +   FFP   
Sbjct: 128 GVFVISVPAYGFLWSEHDEAL-HHRRRYAAHELRNKLINAGFEVERSTYFISSLFFPILF 186

Query: 183 KKCILKLWSV------------------------FEKI-GNIFGPGFAGIYVIEARK--- 214
            + +  L                           FE+         F    +  ARK   
Sbjct: 187 MRIVQNLRKKSLRPSTSHVILPKWLNSFLVGILDFERWFLRFANLPFGVSIICTARKPTA 246

Query: 215 -ILYQGLPITESKK 227
             +     +    K
Sbjct: 247 ERVAALRDVAMQAK 260


>gi|225075627|ref|ZP_03718826.1| hypothetical protein NEIFLAOT_00643 [Neisseria flavescens
           NRL30031/H210]
 gi|224953049|gb|EEG34258.1| hypothetical protein NEIFLAOT_00643 [Neisseria flavescens
           NRL30031/H210]
          Length = 225

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 70/226 (30%), Gaps = 26/226 (11%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M   +     F  + +G+      +         + G   + LG     +          
Sbjct: 1   MHRGVFNGSFFMQTPMGQYLAQKEADFFRRHLQYLNGQVAVQLG---GIWQR-------- 49

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
               P+                 +    L     SVD +LM H LE      L+L E +R
Sbjct: 50  ----PSENMIM------VPRDVRMDAEMLAFETHSVDVLLMPHLLE-ISSADLVLQEAFR 98

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSL 176
           +L   GR+I+   N + +W               Q  +  ++        F +       
Sbjct: 99  ILKPEGRLILTGFNPKSLWGLSSWFDGKRLPMKSQCLALAELKRKTVAIGFEMEYGQFMD 158

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           + P  +    L+ W   EK G+ + P  A +Y +   K L    P+
Sbjct: 159 YLPAVNSPSALRFWQFMEKAGDRWWPQCAAVYGVVLTKHLIGVHPL 204


>gi|304413388|ref|ZP_07394861.1| SAM-dependent methyltransferase [Candidatus Regiella insecticola
           LSR1]
 gi|304284231|gb|EFL92624.1| SAM-dependent methyltransferase [Candidatus Regiella insecticola
           LSR1]
          Length = 237

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 82/234 (35%), Gaps = 26/234 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            +     G+    AI + +   W    G  LL +G+     +     +   ++ +     
Sbjct: 15  SWSELPWGEYYRAAIEEAMQPWWSKFFGFHLLKIGHLSAEIASDQCSISHQVSAV----- 69

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                +Q +++  L S   LP A+ SVD  L++H L +  DP  +L E+ R+LT  G ++
Sbjct: 70  -----EQGYNTQVLASPYQLPFAEKSVDVCLLLHTLAYGTDPHRILREVDRILTDDGWLV 124

Query: 130 VVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
               N   +         + H      + ++  +++  L   ++ +   S     P   +
Sbjct: 125 TTHFNPLSLLGVGKLLPLLRHREPYVSRMFTRIRILDWLNLLDYQVMHQSHFHVLPWHKR 184

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                         N        I +  ARK        PI  + +K   +  +
Sbjct: 185 GGG--------SAMNTHLTALGCISLTIARKRTLPLTLMPIKFATRKPCFNRAV 230


>gi|271501673|ref|YP_003334699.1| type 11 methyltransferase [Dickeya dadantii Ech586]
 gi|270345228|gb|ACZ77993.1| Methyltransferase type 11 [Dickeya dadantii Ech586]
          Length = 239

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/243 (18%), Positives = 81/243 (33%), Gaps = 27/243 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           IV    + +   G+     ++  L+  W  + G  LL +G            +   +   
Sbjct: 10  IVAPDSWEAIPWGENYLHTLNTALAPWWSRIFGFHLLKIGGLSIAIDSQTCTIPHQVNVS 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
              Q           +  +     LP  + SVD  L+ H L ++ DP  ++ E+ RVL +
Sbjct: 70  RDQQ-----------AHVMADPYQLPFIEKSVDACLLTHVLAYSADPHRIVREVDRVLIN 118

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +I+   N   +         M        + +S  +++  L   N+ +   +  L  
Sbjct: 119 DGWVIISGFNPVSLVGMGRLVPGMRRRQPYCSRMFSQMRVMDWLSLLNYEIVHHNSLLVL 178

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPH 238
           P                  N   P    + +I ARK       +T SK     SP+  P 
Sbjct: 179 PWREPGQGKW---------NNTLPLLGCLNLIVARKRTIPLT-MTPSKSLLRKSPMHRPV 228

Query: 239 TVS 241
             +
Sbjct: 229 GAT 231


>gi|126179180|ref|YP_001047145.1| methyltransferase type 11 [Methanoculleus marisnigri JR1]
 gi|125861974|gb|ABN57163.1| Methyltransferase type 11 [Methanoculleus marisnigri JR1]
          Length = 238

 Score = 92.9 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 75/231 (32%), Gaps = 20/231 (8%)

Query: 2   RVDIVELRQ-FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFF-SCFHGKVER 59
             ++ ++    Y    GK     IS+ + +      G  LL +G     F   +  +  R
Sbjct: 8   YDEVADIYDERYDGSRGKYYHGHISEHVMSELP--KGGFLLDIGCGTGLFVQRYVAEGGR 65

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
                 +     +   +   S   V   + LP  D + D +  +    +  DP  ML E 
Sbjct: 66  AFGLDISPGMVRHGRQRCPESGFCVGTADVLPFKDGTFDALASLLAFSYVPDPEGMLREC 125

Query: 119 WRVLTSGGRMIVVVP------------NKRGMWARMEHTPFGSG--QPYSWYQMISLLRE 164
           +RVL  GGR+ V                + G    ++    G      Y+  ++  L RE
Sbjct: 126 YRVLKPGGRIAVCTLSRTVFTSIVPIAYQVGEKVGLKKVGVGHFDEHYYTNSEIAGLFRE 185

Query: 165 ANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
           A FT     R  F        +  L    E I     P  A   V  A K 
Sbjct: 186 AGFTDVSVGRCSFAHLNLADPVFNLARKVEPIVEEKLPYLA-YNVCAAGKK 235


>gi|255067092|ref|ZP_05318947.1| methyl-transferase [Neisseria sicca ATCC 29256]
 gi|255048688|gb|EET44152.1| methyl-transferase [Neisseria sicca ATCC 29256]
          Length = 219

 Score = 92.9 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 73/216 (33%), Gaps = 26/216 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           F  + +G+      +           G  ++  G        +    E  +A        
Sbjct: 5   FEDTAMGRYVAQNEAAFFERHLQYFDGQTVVQQG------GQWLRSSENVVAV------- 51

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                       L++   +     S+D +LM H  E A     +LHE  RVL   GR+++
Sbjct: 52  --------PRDVLMTADAMAWESHSIDVLLMPHSHETAA-LTQVLHEASRVLKPEGRLVL 102

Query: 131 VVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
              N + +W   +              +   +   L + +F +      ++ P  + +  
Sbjct: 103 TGFNPKSLWFFSKWFDGTRLPKKEHCLTLPALKQRLGDLDFEVEFGKFMVYLPAVNSQKG 162

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           L+ W   EK G+ + P  A +Y +   K +    P+
Sbjct: 163 LRFWRFMEKAGDRWWPQCAAVYGLVLVKRMAGVTPL 198


>gi|261380508|ref|ZP_05985081.1| methyl-transferase [Neisseria subflava NJ9703]
 gi|284796761|gb|EFC52108.1| methyl-transferase [Neisseria subflava NJ9703]
          Length = 219

 Score = 92.5 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 68/216 (31%), Gaps = 26/216 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           F  + +G+                + G   + LG     +              P+    
Sbjct: 5   FMQTPMGQYLAQKEEDFFRRHLQYLNGQVAVQLG---GIWQR------------PSENMI 49

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                        +    L     SVD +LM H LE      L+L E +R+L   GR+I+
Sbjct: 50  V------VPRDVRMDAEMLAFETHSVDVLLMPHLLE-ISSADLVLQEAFRILKPEGRLIL 102

Query: 131 VVPNKRGMWARMEHTPFGSG----QPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
              N + +W               Q  +  ++   +    F +       + P  +    
Sbjct: 103 TGFNPKSLWGLSSWFDGKRLPTKSQCLALAELKRKIAAIGFEMEYGQFMDYLPAVNSPST 162

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           LK W   EK G+ + P  A +Y +   K L    P+
Sbjct: 163 LKFWRFMEKAGDRWWPQCAAVYGVVLTKHLIGVHPL 198


>gi|294637716|ref|ZP_06715993.1| SAM-dependent methyltransferase [Edwardsiella tarda ATCC 23685]
 gi|291089146|gb|EFE21707.1| SAM-dependent methyltransferase [Edwardsiella tarda ATCC 23685]
          Length = 251

 Score = 92.5 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 73/233 (31%), Gaps = 27/233 (11%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G     A+   L+  W  + G  LL LG      +     +             
Sbjct: 27  WRQIPWGMHYRAALELRLTPWWPKLFGYHLLKLGALSADLATDRCTISHQ---------- 76

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
            N   +      +    +LP A  SVD  L+ H L +A  P  +L E+ RVL   G +I+
Sbjct: 77  VNVAAEGEHLQVITDLAHLPFAAKSVDACLLGHSLGYAAAPHRVLREVDRVLVDDGWLII 136

Query: 131 VVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
              +   +         +   P  + + +S  +++  L   N+ +   SR    P     
Sbjct: 137 SGFSPFSLLGVGRLVPGLRRRPPYNSRMFSMGRIMDWLTLLNYEVLEASRFQVLPWHQPS 196

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ--GLPITESKKKHISSPIL 235
                      + +   P    + +I ARK        P      +      L
Sbjct: 197 M---------SLLSRHFPAMGCLMLIVARKRTIPLTLTPQRALHARPGMRRAL 240


>gi|218779346|ref|YP_002430664.1| methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01]
 gi|218760730|gb|ACL03196.1| Methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01]
          Length = 271

 Score = 92.1 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 76/238 (31%), Gaps = 14/238 (5%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPF-FSCFHGKVERTL 61
            D      +      +       ++++       G RLL +G    +    F  +     
Sbjct: 8   QDAASYDDWLFDPSRRAAAQLEMRLMTRMLGKGQGRRLLDIGCGTGWSLELFLRQGFNCT 67

Query: 62  AFMPAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
              P+        ++  +          +L   D+S D   +V  LEF EDP   L E  
Sbjct: 68  GLDPSIPMLEKARERLGNRVDLHPGLGESLDFDDNSFDVASLVTTLEFVEDPKACLEEAC 127

Query: 120 RVLTSGGRMIVVVPN-----KRGMWARMEHTPFGSGQPYSWYQMISLLRE-ANFTLSITS 173
           RV      +  +        +R +      T +   Q +S ++M SL+R  A        
Sbjct: 128 RVAKDQLFVGFLNRYAIKGLQRRLKGLFSATVYNKAQFFSVWEMKSLIRSVAGDAPIRWR 187

Query: 174 RSLFFP--PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKH 229
            +   P     +   L+   + ++        F G+ V+   K   + LP+     + 
Sbjct: 188 TTCQLPGVYGQRSLQLEQSPIVQRAPT---GAFCGMIVVLNPKFRTRPLPLRVEPSRK 242


>gi|312143276|ref|YP_003994722.1| Methyltransferase type 11 [Halanaerobium sp. 'sapolanicus']
 gi|311903927|gb|ADQ14368.1| Methyltransferase type 11 [Halanaerobium sp. 'sapolanicus']
          Length = 236

 Score = 91.7 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 82/234 (35%), Gaps = 22/234 (9%)

Query: 1   MRVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHG-KV 57
           M +D    +   +Y +  G    +   + L+    D +G +++ +G    FF        
Sbjct: 1   MDLDQLAEKYADWYKTARGSYVGENEYQCLARHIGDCSGKKIIEVGCGTGFFLRKFAVDA 60

Query: 58  ERTLAFMPAGQGATNWP-----DQYFSSTALVS-EGNLPLADSSVDCVLMVHYLEFA--- 108
           E T+         T             +        N+P AD+  D V     +EF    
Sbjct: 61  EETVGLDITEGMLTAGRKIAREKGIDINFIQGDVTENIPFADNYFDIVYSNSMIEFFEAG 120

Query: 109 EDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME-------HTPFGSGQPYSWYQMISL 161
           E+   +L E+WRVL  GGR ++ V N +  WA           + F     YSW ++ ++
Sbjct: 121 EELEAVLKEMWRVLKPGGRYVIGVLNSKSTWAYKRIAETIEKDSIFSEATFYSWEELKAI 180

Query: 162 LREANFTLSITSRSLFFPP-THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           L +  F       +LF PP    K     +   E       P    + V    K
Sbjct: 181 LGK--FGQVKIESTLFVPPYFKAKEDFDWFKDLEAEFKARYPKRGALLVASVVK 232


>gi|241759762|ref|ZP_04757862.1| methyl-transferase [Neisseria flavescens SK114]
 gi|241319770|gb|EER56166.1| methyl-transferase [Neisseria flavescens SK114]
          Length = 219

 Score = 91.7 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 70/216 (32%), Gaps = 26/216 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           F  + +G+      +         + G   + LG     +              P+    
Sbjct: 5   FMQTPMGQYLAQKEADFFRRHLQYLNGQVAVQLG---GIWQR------------PSENMI 49

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                        +    L     SVD +LM H LE      L+L E +R+L   GR+I+
Sbjct: 50  V------VPRDVRMDAEMLAFETHSVDVLLMPHLLE-ISSADLVLQEAFRILKPEGRLIL 102

Query: 131 VVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
              N + +W               Q  +  ++   + +  F +       + P  +    
Sbjct: 103 TGFNPKSLWGLSSWFDGKRLPMKSQCLALAELKRRIADIGFEMEYGQFMDYLPAVNSPSA 162

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           LK W   EK G+ + P  A +Y +   K L    P+
Sbjct: 163 LKFWRFMEKAGDRWWPQCAAVYGVVLTKHLIGVHPL 198


>gi|320355149|ref|YP_004196488.1| type 11 methyltransferase [Desulfobulbus propionicus DSM 2032]
 gi|320123651|gb|ADW19197.1| Methyltransferase type 11 [Desulfobulbus propionicus DSM 2032]
          Length = 224

 Score = 91.3 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 66/217 (30%), Gaps = 10/217 (4%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS-CFHGKVERTLAFM 64
            +  +++ +  G+      S +L        G R+L  G     F+     +    +   
Sbjct: 11  EQYDRWFDTPTGQLVKIYESALLLEFLAPQPGERILDAGCGTGLFTGDVLDRGAMVIGVD 70

Query: 65  PAGQGATNWPDQYFSS---TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
            +         +             G LP AD+S D V  +  +EF  D    + E+ RV
Sbjct: 71  LSVPMLDRARKRAAGPRFTALCADMGALPFADNSFDRVFSMTAIEFVADAAKAIAELNRV 130

Query: 122 LTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSW---YQMISLLREANFTLSITSRSLFF 178
           +  GG ++V   N R  WA         G        ++    +R           ++  
Sbjct: 131 VRRGGPVVVTTLNSRSPWATRRKRKAEQGHSLFQEICFRSPEEMRSLVPVPCQVKTAIH- 189

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
               K   + L    E  G    P       +  +K 
Sbjct: 190 --FQKDDPVDLIPATETRGGRLSPDAGAFLAVRWQKQ 224


>gi|154151205|ref|YP_001404823.1| methyltransferase type 11 [Candidatus Methanoregula boonei 6A8]
 gi|153999757|gb|ABS56180.1| Methyltransferase type 11 [Methanoregula boonei 6A8]
          Length = 243

 Score = 91.3 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 69/227 (30%), Gaps = 20/227 (8%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLA 62
           ++ +L   Y    G+     IS+ +        G  LL +G     F   +       + 
Sbjct: 18  EVYDLH--YDHPRGRTYHTRISRHVMEALPR--GGALLDIGCGTGLFVEKYLHHGGSAVG 73

Query: 63  FMPAGQGATNWPDQY-FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
              +         +       L +  +LP  D+S D V  +    +  DP  ML+E +RV
Sbjct: 74  IDLSRNMIERARRRCSCCGFTLGTGESLPFRDNSFDAVASLLVFSYVRDPESMLNEAYRV 133

Query: 122 LTSGGRMIVV------------VPNKRGMWARMEHTPFGSG--QPYSWYQMISLLREANF 167
           +  GG + +             V  K     R+ H          Y    M +L   A F
Sbjct: 134 MRPGGAISICTLGKKLLTSGIPVLYKVSEKIRIPHVVMKDFGEHYYDEEDMRALFSRAGF 193

Query: 168 TLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                S   F        +  L    E       P       ++A+K
Sbjct: 194 CNVKVSWCSFAHIDMGDPLFNLAQRMEPFIERRIPQLTYNICVDAQK 240


>gi|295696861|ref|YP_003590099.1| Methyltransferase type 11 [Bacillus tusciae DSM 2912]
 gi|295412463|gb|ADG06955.1| Methyltransferase type 11 [Bacillus tusciae DSM 2912]
          Length = 227

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 65/228 (28%), Gaps = 26/228 (11%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAF 63
                 F  + LG         ++        G   + LG     ++ +  ++       
Sbjct: 8   AESYDDFCRTPLGHFVDAVERSLIGEMARPRAGESAVDLGCGTGSYTYWLHELGLSVSGV 67

Query: 64  MPAGQGATNWPDQYFSS--TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRV 121
             + +       +             +LP    S D  L    LEF  DP   LHE +RV
Sbjct: 68  DLSEEMLEVARRKGDGRVPFIRADITHLPFQPDSFDLALSNVTLEFVADPKAALHEAYRV 127

Query: 122 LTSGGRMIVV-------VPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           +  GGR++V           +     R + T    G  +  +     +            
Sbjct: 128 VKPGGRLVVGFIAKLGPWAEQYSKRGREDATSVYHGARF--FSYEEAVEIGPCIPEQVRF 185

Query: 175 SLFFPP-------THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
            L+  P       +     ++     ++ G       AG  V+  RK 
Sbjct: 186 GLYVSPREFTDEASAWSLEMRRRVSQDEAG-------AGFMVVRWRKR 226


>gi|290476064|ref|YP_003468961.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Xenorhabdus bovienii SS-2004]
 gi|289175394|emb|CBJ82197.1| putative S-adenosyl-L-methionine-dependent methyltransferase
           [Xenorhabdus bovienii SS-2004]
          Length = 238

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 72/233 (30%), Gaps = 16/233 (6%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           I     +     G+    A+ + L   W  + G  L  LG            +       
Sbjct: 10  ITSPASWAELPWGEYYRVALERQLELWWPKIFGLHLAKLGNLSAEIDSRTCPISHQFNIG 69

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
                             +     LP    SVD  L+ H L ++ DP  +L E+ R++T 
Sbjct: 70  LMEGSM----------DVIADPYCLPFEAKSVDACLLAHMLTYSADPHWLLREVDRIITD 119

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
            G +I+   N   +    +       +     QM S+LR+ ++   +    +     H  
Sbjct: 120 DGWLIISGFNPISLLGLRKVLLPIHRRQAYEAQMFSMLRQVDWLSLLNYEIVHHVSFHVL 179

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
                 S      N     F  + +I ARK        P+  +  K     +L
Sbjct: 180 PWQSGKSF----CNRSASMFGCMNMIIARKRTIPLTLNPMWATSLKPKFRNVL 228


>gi|296314517|ref|ZP_06864458.1| hypothetical protein NEIPOLOT_01527 [Neisseria polysaccharea ATCC
           43768]
 gi|296838829|gb|EFH22767.1| hypothetical protein NEIPOLOT_01527 [Neisseria polysaccharea ATCC
           43768]
          Length = 221

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G                   MP
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVGG---------------RWLMP 46

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           +                 +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 47  SEDVV------CVPRDMSMSAENMALADVSADMLLFPHTLE-CGAPSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                  +   +   L +  F + +    ++ PP 
Sbjct: 100 GRVMLTGFNPHSLWGFSRWFDGERLPEKRFCLTLRGLKRQLADTGFDIELGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                +  W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSPGQIHFWQFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|218665099|ref|YP_002425247.1| methyltransferase, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|218517312|gb|ACK77898.1| methyltransferase, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 216

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/214 (15%), Positives = 62/214 (28%), Gaps = 12/214 (5%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTL 61
           +D      +Y +  G+    A  ++LS       G  LL +G    +F+    +      
Sbjct: 4   MDAAAYDAWYDTPRGRWIGMAEFRLLSRLLQTQPGNTLLDVGCGTGWFTRRFAEEGLLVT 63

Query: 62  AFMPAGQGATNWPDQYF--SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
              P          +              L   D S D V+ V  L F +D    + EI 
Sbjct: 64  GLDPNPDWLAFARAKGPPEIRWIAGDARALSFPDRSFDQVVSVAALCFVDDERRAVAEIV 123

Query: 120 RVLTSG---GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
           RV       G +                  +   + +   +++               ++
Sbjct: 124 RVARRRFAIGWLNRTSLLYAQKGQGGGSGAYHGARWHRPDELLDFFSGLPVRRLAVHSAI 183

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVI 210
           FFP  +      +    E++     P   G+ VI
Sbjct: 184 FFPAGNG-----VARTLERLLPHTLPW-GGLIVI 211


>gi|307545283|ref|YP_003897762.1| methyltransferase type 11 [Halomonas elongata DSM 2581]
 gi|307217307|emb|CBV42577.1| methyltransferase type 11 [Halomonas elongata DSM 2581]
          Length = 258

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 74/238 (31%), Gaps = 18/238 (7%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
             E R++++S  G+    A    +    +   G   L LG+                +  
Sbjct: 14  ADEGRRYWASASGQAIWRAERACIGPLCERWFGPHALELGFGPALTDMCPVHHSIRWS-- 71

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P  +           ST +     LPL D  +  V++ H LE   +P  +L E  RV   
Sbjct: 72  PTEELVE------VPSTLVCPPDALPLPDGCLSLVVVHHLLEVLPNPHHVLQEAARVTAD 125

Query: 125 GGRMIVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            G +++   +  G+      W        G G+  S  ++   L   +F         F 
Sbjct: 126 EGHLVLFAWSPFGIAGGARLWPERRRHFPGRGRWRSPARLRDWLTFVDFETHRVDYCGFR 185

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
            P      L   +V E +G          Y+I AR+      P           P   
Sbjct: 186 LPGG----LARNAVLETVGRRHNLPLGDCYMIHARRRSQLAQPRRGKVSFAPPLPGSA 239


>gi|309379225|emb|CBX22182.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 221

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 74/221 (33%), Gaps = 29/221 (13%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G                   MP
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVGG---------------RWLMP 46

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           +                 +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 47  SEDVV------CVPRDMSMSAENMALADVSADMLLFPHTLE-CGAPSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWA---RMEHTPFGSGQP-YSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W      +       +   +   +   + +A F + +    ++ PP 
Sbjct: 100 GRVMLTGFNPHSLWGPGSWFDGERLPEKRFCLTLRGLKRQIADAGFDIELGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
                ++ W   EK G+ + P  A +Y +   K      P+
Sbjct: 160 SSPGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPL 200


>gi|325130339|gb|EGC53105.1| hypothetical protein NMBOX9930304_0857 [Neisseria meningitidis
           OX99.30304]
 gi|325208257|gb|ADZ03709.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33]
          Length = 221

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 73/224 (32%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPC 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++  LL +A F + +    ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRLLADAGFDIELGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWQFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|156935273|ref|YP_001439189.1| hypothetical protein ESA_03126 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533527|gb|ABU78353.1| hypothetical protein ESA_03126 [Cronobacter sakazakii ATCC BAA-894]
          Length = 238

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 77/235 (32%), Gaps = 27/235 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + +   G      + + L      + G  LL +G               T A   + Q
Sbjct: 14  AHWDAFSWGDHYRATLERELQPWLGKMYGFHLLKIG--------NLSAEINTEACAISHQ 65

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N   Q  +        +LP A  SVD  L+ H L +  DP  +L+E  RVL   G +
Sbjct: 66  --VNVALQGDALHVKCDPLHLPFAAKSVDACLLAHTLPWCPDPHRLLNEADRVLIDDGWL 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         +      + + ++  + +  L   NF L   SR    P   
Sbjct: 124 IMTGFNPVSLLGAAKLLPFVRKRAPVNSRMFTMMRQMDWLSLLNFELLYYSRCQVLPWCR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           +           K+     P    + V+ ARK        P+ + + +    P +
Sbjct: 184 QGG---------KMLTRHLPALGCLQVMVARKRTIPLTINPLMKPRARTHLRPAV 229


>gi|298368588|ref|ZP_06979906.1| methyltransferase type 11 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282591|gb|EFI24078.1| methyltransferase type 11 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 232

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 57/146 (39%), Gaps = 4/146 (2%)

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA 140
             ++    L  A  S+D +LM H  E+ + P++ L E  RVL SGGR+++   N   +W 
Sbjct: 60  DVVMDGTALAWAAQSLDILLMPHSHEYCQQPYVALVEAARVLKSGGRLVISGFNLSSLWG 119

Query: 141 RMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
                           ++       +    F +      ++ PP   +  LK W   EK 
Sbjct: 120 MSGWFDGNLLPEKKNCFTLPVFKKKVLSLGFEIEYGKFMVYVPPVKTESGLKFWQFMEKA 179

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPI 222
           G+ + P  A +Y +   K       +
Sbjct: 180 GDRWWPAAAAVYGLVLVKREAGLTLL 205


>gi|167949087|ref|ZP_02536161.1| generic methyl-transferase [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 167

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 60/169 (35%), Gaps = 11/169 (6%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           EL+ +++   G+   +    ++      + G  ++ LG              R    +  
Sbjct: 4   ELQAWFARMPGQVLAEQEQALIEEWGSSLFGYHVVQLGAPAATMDLLATSPARHRILLSK 63

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
             GA        S   +     LP A  SVD V++ H L+++ DP   L E+ R+L   G
Sbjct: 64  EDGA-----GGASPALIGDCTRLPFATDSVDGVVLPHTLDYSTDPHQALREVERILIPEG 118

Query: 127 RMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTL 169
           R+++   N   +W            P   G  +   ++   L    F  
Sbjct: 119 RVLITGFNPWSLWGMWQLFRLRRRQPPWCGHFFGAGRIQDWLSLLGFRP 167


>gi|325128406|gb|EGC51289.1| hypothetical protein NMXN1568_0859 [Neisseria meningitidis N1568]
          Length = 221

 Score = 90.2 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 70/221 (31%), Gaps = 29/221 (13%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DSWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
                ++ W   EK G+ + P  A +Y +   K      P+
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPL 200


>gi|121635009|ref|YP_975254.1| hypothetical protein NMC1233 [Neisseria meningitidis FAM18]
 gi|218768319|ref|YP_002342831.1| hypothetical protein NMA1506 [Neisseria meningitidis Z2491]
 gi|304387406|ref|ZP_07369597.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|120866715|emb|CAM10467.1| hypothetical protein NMC1233 [Neisseria meningitidis FAM18]
 gi|121052327|emb|CAM08657.1| hypothetical protein NMA1506 [Neisseria meningitidis Z2491]
 gi|304338499|gb|EFM04618.1| conserved hypothetical protein [Neisseria meningitidis ATCC 13091]
 gi|319410564|emb|CBY90932.1| putative methyltransferase [Neisseria meningitidis WUE 2594]
 gi|325132502|gb|EGC55195.1| hypothetical protein NMBM6190_0907 [Neisseria meningitidis M6190]
 gi|325138276|gb|EGC60845.1| hypothetical protein NMBES14902_1004 [Neisseria meningitidis
           ES14902]
          Length = 221

 Score = 89.8 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DSWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|325136199|gb|EGC58807.1| hypothetical protein NMBM0579_0933 [Neisseria meningitidis M0579]
          Length = 221

 Score = 89.8 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGI-PSQILSEAHRILKPC 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSIGQIRFWRFMEKAGDRWWPQCAAVYALVLVKRAAGVTPLPAW 203


>gi|261392422|emb|CAX49967.1| putative methyltransferase [Neisseria meningitidis 8013]
 gi|325142418|gb|EGC64822.1| hypothetical protein NMB9615945_0916 [Neisseria meningitidis
           961-5945]
          Length = 221

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DSWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPC 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|261400682|ref|ZP_05986807.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
 gi|269209593|gb|EEZ76048.1| conserved hypothetical protein [Neisseria lactamica ATCC 23970]
          Length = 221

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 74/221 (33%), Gaps = 29/221 (13%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G                   MP
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVGG---------------RWLMP 46

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           +                 +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 47  SEDVV------CVPRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWA---RMEHTPFGSGQP-YSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W      +       +   +   +   + +A F + +    ++ PP 
Sbjct: 100 GRVMLTGFNPHSLWGPGSWFDGERLPEKRFCLTLRGLKRQIADAGFDIELGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
                ++ W   EK G+ + P  A +Y +   K      P+
Sbjct: 160 SSPGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPL 200


>gi|313668435|ref|YP_004048719.1| hypothetical protein NLA_11310 [Neisseria lactamica ST-640]
 gi|313005897|emb|CBN87353.1| hypothetical protein NLA_11310 [Neisseria lactamica 020-06]
          Length = 221

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 74/224 (33%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G                   MP
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVGG---------------RWLMP 46

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           +                 +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 47  SEDVV------CVPRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWA---RMEHTPFGSGQP-YSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W      +       +   +   +   + +A F + +    ++ PP 
Sbjct: 100 GRVMLTGFNPHSLWGPGSWFDGERLPEKRFCLTLRGLKRQIADAGFDIELGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSPGQIRFWRFMEKAGDRWWPHCAAVYGLVLVKRAAGVTPLPAW 203


>gi|260596629|ref|YP_003209200.1| hypothetical protein CTU_08370 [Cronobacter turicensis z3032]
 gi|260215806|emb|CBA28255.1| Uncharacterized protein yafS [Cronobacter turicensis z3032]
          Length = 238

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 78/235 (33%), Gaps = 27/235 (11%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + +   G      + + L      + G  LL +G               T A   + Q
Sbjct: 14  AHWDAFSWGDHYRATLERELQPWLGKMYGFHLLKIG--------NLSAEINTEACAISHQ 65

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
              N   Q  +        +LP A  SVD  L+ H L +  DP  +L+E  RVL   G +
Sbjct: 66  --VNIALQGDALQVQGDPLHLPFAAKSVDACLLAHTLPWCPDPHRLLNEADRVLIDDGWL 123

Query: 129 IVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           I+   N   +         M      + + ++  + +  L   NF L   SR    P   
Sbjct: 124 IMTGFNPVSLLGAAKLLPVMRKRAPVNSRMFTMMRQMDWLSLLNFELLYYSRCQVLPWCR 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGL--PITESKKKHISSPIL 235
           +           K+     P    + V+ ARK        P+ +++ +    P +
Sbjct: 184 QGG---------KMLTKHLPALGCLQVMVARKRTIPLTMNPLMKARARTHLRPAV 229


>gi|323703735|ref|ZP_08115375.1| Methyltransferase type 11 [Desulfotomaculum nigrificans DSM 574]
 gi|323531323|gb|EGB21222.1| Methyltransferase type 11 [Desulfotomaculum nigrificans DSM 574]
          Length = 240

 Score = 88.7 bits (218), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 67/183 (36%), Gaps = 9/183 (4%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +Y     +  +  I   L           +L  G        +  +    +    + +  
Sbjct: 18  WYKGRR-EFISKLIRPYLR------PNLHILDAGCGAGGTMEYMARYGSVVGIDISEEMV 70

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                +  S+    S   LP A+   D VL +  LE      + + E+ RV+  GG +++
Sbjct: 71  EYCRKEGLSAY-HGSVTKLPFANGLFDLVLCLDVLEHLPMDQIAVEELKRVIRPGGLLVI 129

Query: 131 VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            VP+   +W R +       + Y++ ++I L++ A  ++  ++   FF         KL 
Sbjct: 130 SVPSFSWLWGRHDELN-QHCRRYNFGELIKLVQLAGLSVERSTYFNFFLLPPIWLARKLG 188

Query: 191 SVF 193
            + 
Sbjct: 189 RLL 191


>gi|254805098|ref|YP_003083319.1| hypothetical protein NMO_1137 [Neisseria meningitidis alpha14]
 gi|254668640|emb|CBA06275.1| hypothetical protein NMO_1137 [Neisseria meningitidis alpha14]
          Length = 221

 Score = 88.7 bits (218), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 71/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DSWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPC 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +A F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRRLADAGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|59801037|ref|YP_207749.1| hypothetical protein NGO0609 [Neisseria gonorrhoeae FA 1090]
 gi|194098868|ref|YP_002001932.1| hypothetical protein NGK_1307 [Neisseria gonorrhoeae NCCP11945]
 gi|239999154|ref|ZP_04719078.1| hypothetical protein Ngon3_06705 [Neisseria gonorrhoeae 35/02]
 gi|240013938|ref|ZP_04720851.1| hypothetical protein NgonD_04688 [Neisseria gonorrhoeae DGI18]
 gi|240016380|ref|ZP_04722920.1| hypothetical protein NgonFA_04284 [Neisseria gonorrhoeae FA6140]
 gi|240080499|ref|ZP_04725042.1| hypothetical protein NgonF_04182 [Neisseria gonorrhoeae FA19]
 gi|240113133|ref|ZP_04727623.1| hypothetical protein NgonM_06101 [Neisseria gonorrhoeae MS11]
 gi|240115889|ref|ZP_04729951.1| hypothetical protein NgonPID1_06539 [Neisseria gonorrhoeae PID18]
 gi|240118187|ref|ZP_04732249.1| hypothetical protein NgonPID_06966 [Neisseria gonorrhoeae PID1]
 gi|240121507|ref|ZP_04734469.1| hypothetical protein NgonPI_07018 [Neisseria gonorrhoeae PID24-1]
 gi|240123735|ref|ZP_04736691.1| hypothetical protein NgonP_07329 [Neisseria gonorrhoeae PID332]
 gi|240125926|ref|ZP_04738812.1| hypothetical protein NgonSK_06867 [Neisseria gonorrhoeae SK-92-679]
 gi|240128438|ref|ZP_04741099.1| hypothetical protein NgonS_07381 [Neisseria gonorrhoeae SK-93-1035]
 gi|254493928|ref|ZP_05107099.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260440296|ref|ZP_05794112.1| hypothetical protein NgonDG_04246 [Neisseria gonorrhoeae DGI2]
 gi|268594987|ref|ZP_06129154.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596633|ref|ZP_06130800.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599215|ref|ZP_06133382.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601562|ref|ZP_06135729.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268603901|ref|ZP_06138068.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682364|ref|ZP_06149226.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684522|ref|ZP_06151384.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686832|ref|ZP_06153694.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043589|ref|ZP_06569305.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398901|ref|ZP_06643066.1| hypothetical protein NGNG_00085 [Neisseria gonorrhoeae F62]
 gi|59717932|gb|AAW89337.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934158|gb|ACF29982.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512968|gb|EEH62313.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548376|gb|EEZ43794.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550421|gb|EEZ45440.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583346|gb|EEZ48022.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585693|gb|EEZ50369.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588032|gb|EEZ52708.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622648|gb|EEZ55048.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268624806|gb|EEZ57206.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268627116|gb|EEZ59516.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012052|gb|EFE04041.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610315|gb|EFF39425.1| hypothetical protein NGNG_00085 [Neisseria gonorrhoeae F62]
 gi|317164442|gb|ADV07983.1| hypothetical protein NGTW08_1015 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 221

 Score = 88.7 bits (218), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+          +        +G   + +G     +      +        
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFNRYVASYRFSGMCAVQVG---GQWLSLSEDIVCVP---- 54

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD   D +L+ H LE    P  +L E  R+L   
Sbjct: 55  --------------RDMSMSAENMALADVFADMLLLPHTLE-CGVPSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +A F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFCRWFDGVRLPEKRFCLPLPELKRQLADAGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|325144562|gb|EGC66861.1| hypothetical protein NMBM01240013_0975 [Neisseria meningitidis
           M01-240013]
 gi|325205929|gb|ADZ01382.1| conserved hypothetical protein [Neisseria meningitidis M04-240196]
          Length = 221

 Score = 88.3 bits (217), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DSWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRRLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|307824634|ref|ZP_07654858.1| Methyltransferase type 11 [Methylobacter tundripaludum SV96]
 gi|307734288|gb|EFO05141.1| Methyltransferase type 11 [Methylobacter tundripaludum SV96]
          Length = 239

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 44/248 (17%), Positives = 87/248 (35%), Gaps = 22/248 (8%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M+ +   L  +Y +  GK      +  L  +        +L +G            + + 
Sbjct: 1   MKRNF--LFAWYQTPRGKLLQQLEADYLQRSITVSCQQTILQIGGLDWESEFIDCTLYKN 58

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
              + A     N   +           +LPL  + +D +++ H LEF    F  + EI R
Sbjct: 59  FTVLDAKSMGCNKARK-----IQAKAYSLPLQSNCIDMIIVPHLLEFDAFRFQTMREIER 113

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPF------GSGQPYSWYQMISLLREANFTLSITSR 174
           VL   G ++++  N   +W R ++           G   S  +++  L+  NF ++++S 
Sbjct: 114 VLKPEGILVILNFNPWSLWIRYQYLWDKKMADSWGGHFISRSRILDWLKLLNFEVTVSSE 173

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPI 234
                               + G+      +  Y I+A K  Y  +P+T  +  +    +
Sbjct: 174 FNLDTVKST-----HGKFITR-GHSL---TSTAYAIKAIKRRYNLIPLTPVRALNPRLIL 224

Query: 235 LVPHTVST 242
             P    T
Sbjct: 225 TNPLNSPT 232


>gi|325201992|gb|ADY97446.1| conserved hypothetical protein [Neisseria meningitidis M01-240149]
          Length = 221

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRNLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ +AD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMAVADVSADMLLFPHTLEGGV-PSQILSEAHRILKPC 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFGRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSIGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|198283040|ref|YP_002219361.1| type 11 methyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|198247561|gb|ACH83154.1| Methyltransferase type 11 [Acidithiobacillus ferrooxidans ATCC
           53993]
          Length = 216

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 65/214 (30%), Gaps = 12/214 (5%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +D      +Y +  G+       ++LS       G  LL +G    +F+    +     A
Sbjct: 4   MDATAYDAWYDTSRGRWIGTVEFRLLSGLLHAQPGDTLLDVGCGTGWFTRRFAEDGLRAA 63

Query: 63  FMPAGQ---GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            + + Q                 +     LP  D S D V+ V  L F +D    + EI 
Sbjct: 64  GLDSNQDWLAFARAKGPPEIRWIVGDARALPFPDYSFDQVVSVAALCFVDDERRAVAEIV 123

Query: 120 RVLTSG---GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
           RV       G +                  +   + +   +++               ++
Sbjct: 124 RVARRRFAIGWLNRTSLLYAQKGQGGGSGAYHGARWHRPDELLDFFSGLPVRRLAVHSAI 183

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVI 210
           FFP  +      +    E++     P   G+ VI
Sbjct: 184 FFPAGNG-----VARTLERLLPHTLPW-GGLIVI 211


>gi|15677163|ref|NP_274316.1| hypothetical protein NMB1296 [Neisseria meningitidis MC58]
 gi|7226537|gb|AAF41672.1| hypothetical protein NMB1296 [Neisseria meningitidis MC58]
 gi|316984087|gb|EFV63065.1| methyltransferase type 11 [Neisseria meningitidis H44/76]
 gi|325134461|gb|EGC57106.1| hypothetical protein NMBM13399_0904 [Neisseria meningitidis M13399]
 gi|325140478|gb|EGC62999.1| hypothetical protein NMBCU385_0870 [Neisseria meningitidis CU385]
 gi|325200077|gb|ADY95532.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
          Length = 221

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GPWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPC 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSRWFDGERLPEKRFCLPLPELKRRLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|152978856|ref|YP_001344485.1| methyltransferase type 11 [Actinobacillus succinogenes 130Z]
 gi|150840579|gb|ABR74550.1| Methyltransferase type 11 [Actinobacillus succinogenes 130Z]
          Length = 231

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 73/232 (31%), Gaps = 22/232 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G   +  I       +  + G RLL +   +      +  +++ +      +
Sbjct: 15  ASWSQLPFGDAYSTLIGANFEKWFARIAGRRLLKI-SGLSAEVPCYQPLQQVVLNDKTSE 73

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                  +  +     S   LP  + +VD  L+ + L F +DP  +L E  R+L+  G +
Sbjct: 74  KLAALCRRQQAILIEGSLQELPFGEETVDACLLANTLNFTQDPHQLLRETERILSDDGYL 133

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           ++ + N                + +  +++I  L   NF +       F           
Sbjct: 134 LISLFNPCSKLLFKRRLGKFDFRLFLPFRVIDWLELLNFEILSQQTLCFGHE-------- 185

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                          F  + +I A+K       +   K +  +  IL P   
Sbjct: 186 ------------PKVFGSLCLIVAQKRTLPLT-LQPQKVRFENQEILNPAGA 224


>gi|198284153|ref|YP_002220474.1| type 11 methyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|198248674|gb|ACH84267.1| Methyltransferase type 11 [Acidithiobacillus ferrooxidans ATCC
           53993]
          Length = 216

 Score = 87.9 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 66/216 (30%), Gaps = 16/216 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTL 61
           +D      +Y +  G+    A  ++LS       G  LL +G    +F+    +      
Sbjct: 4   MDAAAYDAWYDTPRGRWIGMAEFRLLSRLLQTQPGNTLLDVGCGTGWFTRRFAEEGLLVT 63

Query: 62  AFMPAGQGATNWPDQYF--SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
              P          +              L   D S D V+ V  L F ED    + EI 
Sbjct: 64  GLDPNPDWLAFARAKGPPEIRWIAGDARALSFPDRSFDQVVSVAALCFVEDERRAVAEIV 123

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSG-----QPYSWYQMISLLREANFTLSITSR 174
           RV     R ++   N+  +  R +    GSG       +   +++               
Sbjct: 124 RVAR--RRFVIGWLNRASLLYRQKGQGGGSGAYHGAHWHRPNELLDFFSGLPVRRLAVHS 181

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVI 210
           ++F P         +    E +     P   G+ VI
Sbjct: 182 AIFLPAGDG-----MARTLEHLLPHTLPW-GGLVVI 211


>gi|319638533|ref|ZP_07993295.1| methyl-transferase [Neisseria mucosa C102]
 gi|317400282|gb|EFV80941.1| methyl-transferase [Neisseria mucosa C102]
          Length = 219

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/216 (17%), Positives = 69/216 (31%), Gaps = 26/216 (12%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           F  + +G+      +         +     + LG     ++             P+    
Sbjct: 5   FMQTPMGQYLAQKEADFFRRHLQYLNRQVAVQLG---GVWTR------------PSENMI 49

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                        +    L     SVD +LM H LE      L+L E +R+L   GR+I+
Sbjct: 50  V------VPRDVRMDAEMLAFETHSVDVLLMPHLLE-VSSADLVLQEAFRILKPEGRLIL 102

Query: 131 VVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCI 186
              N + +W                  +  ++   + +  F +       + P  +    
Sbjct: 103 TGFNPKSLWGLSSWFDGEKLPLKSHCLALAKLKRKIADVGFEMEYGQFMDYLPAVNSLSA 162

Query: 187 LKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           LK W   EK G+ + P  A +Y +   K L    P+
Sbjct: 163 LKFWRFMEKAGDRWWPQCAAVYGMVLTKHLIGVHPL 198


>gi|46198416|ref|YP_004083.1| methyltransferase [Thermus thermophilus HB27]
 gi|46196038|gb|AAS80456.1| methyltransferase [Thermus thermophilus HB27]
          Length = 212

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 59/205 (28%), Gaps = 7/205 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
                 +Y + LG        + L        G  LL +G    ++        R     
Sbjct: 8   AEAYEAWYETPLGAYVIAEEERALKGLLP--PGESLLEVGAGTGYWLRRLPYPRRV-GVE 64

Query: 65  PAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           P+         +   ++        LP +  S D VL+   LEF ED   +L E  RVL 
Sbjct: 65  PSEAMLAVGRRRAPEATWVRAWGEALPFSGESFDVVLLFTTLEFVEDVERVLLEARRVLR 124

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQ---MISLLREANFTLSITSRSLFFPP 180
            GG ++V V      WA +       G              L+           ++F  P
Sbjct: 125 PGGALVVGVLEALSPWAALYRRLGEKGVLPWARARFLAREDLKALLGPPEAEGEAVFLAP 184

Query: 181 THKKCILKLWSVFEKIGNIFGPGFA 205
                  +      + GN       
Sbjct: 185 EANPPYEEADQAGRRAGNRPALYLG 209


>gi|121998365|ref|YP_001003152.1| type 11 methyltransferase [Halorhodospira halophila SL1]
 gi|121589770|gb|ABM62350.1| Methyltransferase type 11 [Halorhodospira halophila SL1]
          Length = 243

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 83/238 (34%), Gaps = 23/238 (9%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             L  +Y + LG+    A    ++ +   +    +L LG                 A +P
Sbjct: 2   QHLHAWYGTPLGQRVGRAEQSAVADSLAHLGIGDVLCLG--------------PVAAPLP 47

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                  W         + +   LP    S+D +++ H LEF  +P  +L E ++VL   
Sbjct: 48  LAPTVRQWRVGA-GRDLVAAPQQLPFRGQSIDALILSHVLEFNAEPGAVLSEAYQVLAPE 106

Query: 126 GRMIVVVPNKRGMWA-------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           GR++V+  N  G+W                 G+ +    +   LR   F         F 
Sbjct: 107 GRLMVLTFNPLGLWGARRLWGRWRSAPVPWGGRQWLASTVGVHLRRCGFETVARHDLCFR 166

Query: 179 PPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
           PP   + + K    +E      G   AG+ +  A +    G    +++ + +   + V
Sbjct: 167 PPIQGERLQKRLDPWEDRLRRLGRFAAGVQITVAIRRE-PGSLRGKTRVERLGRGVPV 223


>gi|325204298|gb|ADY99751.1| conserved hypothetical protein [Neisseria meningitidis M01-240355]
          Length = 221

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 70/224 (31%), Gaps = 29/224 (12%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++  + +G+              D    +G   + +G        +    E  +    
Sbjct: 2   DAWFEDTAMGRYVAKLEQDFFGRYLDSYRFSGMCAVQVG------GRWLSLSEDVVCV-- 53

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S  N+ LAD S D +L  H LE    P  +L E  R+L   
Sbjct: 54  -------------PRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                     ++   L +  F +      ++ PP 
Sbjct: 100 GRLMLTGFNPYSLWGFSCWFDGERLPEKRFCLPLPELKRRLADVGFDIEFGKFMVYLPPV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
                ++ W   EK G+ + P  A +Y +   K      P+   
Sbjct: 160 SSLGQIRFWRFMEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 203


>gi|295096914|emb|CBK86004.1| Methylase involved in ubiquinone/menaquinone biosynthesis
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 199

 Score = 87.1 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/204 (20%), Positives = 67/204 (32%), Gaps = 27/204 (13%)

Query: 37  GCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSV 96
           G  LL +G      +     +   ++    G                    +LP A+ S+
Sbjct: 3   GFHLLKIGNLSAEINTESCAISHQVSVSLNGSPVQ----------VKADPLHLPFAEKSI 52

Query: 97  DCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM------EHTPFGSG 150
           D  L+ H L +  DP  +L E  RVL   G +I+   N   +            TP  + 
Sbjct: 53  DACLLAHTLPWCSDPHRLLREADRVLIDDGWLILSGFNPLSLMGLRKLTPVLRRTPPYNS 112

Query: 151 QPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVI 210
           + ++  + +  L   NF +         P T K  +L          +   P    +  I
Sbjct: 113 RMFTMMRQLDWLSLLNFEVLSYGGFQVIPWTRKGGVL---------LSTHLPALGCMQFI 163

Query: 211 EARKILYQGL--PITESKKKHISS 232
            ARK        P+ +SK K    
Sbjct: 164 VARKRTIPLTLNPMKQSKSKTRIR 187


>gi|284009178|emb|CBA76230.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 227

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 69/224 (30%), Gaps = 14/224 (6%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     GK    A+++ L   W  + G  LL +G            +    +      
Sbjct: 3   DSWEDIPWGKYYRIALNQQLQPWWPKIFGFHLLKIGQLSLQIDTQSSLITHQFSM----- 57

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                     +   L +   +P  D S+D  L++  L ++ +P  +L E  R+L   G +
Sbjct: 58  -----NITGNNFQLLGAPNEMPFEDKSIDACLLIQQLSYSTNPHWLLREADRILVDDGWL 112

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           I+   N   +    +  PF   +      M S+ R+ ++   +    L          + 
Sbjct: 113 ILSNFNPFSLLGIGKCIPFLRKRQPFPSHMFSIWRQLDWLSLLNYEVLHQQSFQIIPWIS 172

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                    N        I VI ARK      P      +    
Sbjct: 173 PDHFI----NRNLQFAGCINVIIARKRTLPLTPTPIKLMRTRMK 212


>gi|225023941|ref|ZP_03713133.1| hypothetical protein EIKCOROL_00808 [Eikenella corrodens ATCC
           23834]
 gi|224942966|gb|EEG24175.1| hypothetical protein EIKCOROL_00808 [Eikenella corrodens ATCC
           23834]
          Length = 230

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 74/226 (32%), Gaps = 19/226 (8%)

Query: 8   LRQFYS-SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           L ++   +  G     A     +    D  G  ++                     +   
Sbjct: 7   LAEWLDNTATGGYLKAAEQAFFAAHTADPYGITVV----------------ASLCCWDCW 50

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
            Q           +  + +   LPL   SV  +L+ H LE    P  +L E +RVL   G
Sbjct: 51  PQQVVRLGRGRAQADVVCALPQLPLLSGSVQTLLLPHGLELCAQPEELLRECFRVLLPNG 110

Query: 127 RMIVVVPNKRGMW--ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKK 184
           ++++   N   +W     E             ++  +L EA F         + PP   +
Sbjct: 111 KLVLSGFNPYSLWRFGLPEKQLGLRAHALPLPKVRRMLAEAGFRPDTGRFMAYVPPWENE 170

Query: 185 CILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHI 230
             L+ W   E  GN + P  A  Y + A K +Y   P+ E   K  
Sbjct: 171 RALQRWHFMELAGNRWWPAAAAAYGLAAVKTVYPLTPLREKAGKLR 216


>gi|330861139|emb|CBX71402.1| uncharacterized protein yafS [Yersinia enterocolitica W22703]
          Length = 203

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/212 (19%), Positives = 73/212 (34%), Gaps = 27/212 (12%)

Query: 32  WDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPL 91
           W    G  LL +G+     +     +              N  +Q  +   L S   LP 
Sbjct: 1   WPKFFGFHLLKIGHLSAEIASDKCAISHQ----------VNVGEQGKNMQVLASPYQLPF 50

Query: 92  ADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWA------RMEHT 145
           A+ SVD  L+ H L +A DP  +L E+ RVL   G +++   N   +         +   
Sbjct: 51  AEKSVDACLLSHTLAYAADPHRILREVDRVLIDDGWLVISNFNPMSLLGAGKLVPLLRQR 110

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
                + ++  +++  L   N+ +   SR    P   +           +  +   P   
Sbjct: 111 QPHVSRMFTQMRLLDWLSLLNYEVLYLSRFHVLPWHKEGG---------RFISTHLPALG 161

Query: 206 GIYVIEARKILYQGL--PITESKKKHISSPIL 235
            + +I ARK        P+    +K   S  +
Sbjct: 162 CVSLIVARKRTIPLTFNPMKFGARKPWFSRAV 193


>gi|116747803|ref|YP_844490.1| type 11 methyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116696867|gb|ABK16055.1| Methyltransferase type 11 [Syntrophobacter fumaroxidans MPOB]
          Length = 299

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 67/221 (30%), Gaps = 15/221 (6%)

Query: 13  SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGAT 71
            +  G+       ++L   W  +T  R+L +G     F      +         +     
Sbjct: 22  QTPAGRLALLIEQELLLRLWRPLTPQRVLEVGCGTGLFLERLVREGHIVTGIDASPAMLE 81

Query: 72  NWPDQYFSSTA--LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM- 128
               +     A       +LP  D+  D V ++  LE+  DP   L E +RV      + 
Sbjct: 82  IARRRLAPRVALRQGFAEDLPFDDNEFDTVALIGTLEYVNDPVAALREAFRVARQHVLLG 141

Query: 129 ----IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLR--EANFTLSITSRSLFFPPTH 182
                 +   K       + + +   + YS Y++  L+    A          L FP   
Sbjct: 142 AANRYSLETFKLCAQRLWKRSFYDHARFYSVYRLRHLVERALAGSVPVRWGTCLSFPL-- 199

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT 223
              +LK     E+   +          +    ++Y    I 
Sbjct: 200 --GLLKYVRFLERSRLLQWHPLGHFIGMRVD-MVYPMQTIQ 237


>gi|269213591|ref|ZP_05982335.2| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
 gi|269146051|gb|EEZ72469.1| conserved hypothetical protein [Neisseria cinerea ATCC 14685]
          Length = 221

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 70/222 (31%), Gaps = 29/222 (13%)

Query: 9   RQFYSSF-LGKCTTDAISKVLSTTWDDVT--GCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
             ++    +G+          +         G   L +G     +      +        
Sbjct: 2   DSWFEHEVMGRYVAKLEQDFFNRYVASYRFGGMCALQVG---GPWLRPSEDIVCVP---- 54

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                             +S   + LAD S D +L+ H LE    P  +L E  R+L   
Sbjct: 55  --------------RDMSMSAEEMALADISADMLLLPHTLE-CGIPSQILSEAHRILKPS 99

Query: 126 GRMIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           GR+++   N   +W                  S +++   L +A F +      ++ P  
Sbjct: 100 GRLMLTGFNPYSLWGLGSWFDGVRLPEKRFCLSLHELKKQLADAGFDIEYGKFMVYLPAV 159

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPIT 223
                ++ W   EK G+ + P  A +Y +   K +    P+ 
Sbjct: 160 SSLGKIRFWQFMEKAGDRWWPQCAAVYGLVLLKNVAGVTPLR 201


>gi|218295235|ref|ZP_03496071.1| Methyltransferase type 11 [Thermus aquaticus Y51MC23]
 gi|218244438|gb|EED10963.1| Methyltransferase type 11 [Thermus aquaticus Y51MC23]
          Length = 212

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 67/209 (32%), Gaps = 15/209 (7%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
                 +Y + LG        + L        G  LL +G    ++        +     
Sbjct: 8   AEAYEAWYETPLGAFVIAEEERALLRLLP--PGESLLEVGAGTGYWLRRLPYPRKV-GLE 64

Query: 65  PAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           P+         +   +        +LP A+ S D VL+   LEF ED    L E  RVL 
Sbjct: 65  PSEAMRRLGQARAPEAVWVAGRGEDLPFAEGSFDLVLLFTTLEFVEDVEKTLSEARRVLR 124

Query: 124 SGGRMIVVVPNKRGMWARMEHT-------PFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            GG ++V +      WA +          P+   +  S   +++LL          + ++
Sbjct: 125 PGGALVVGILEALSPWAALYRRLGEKGVLPWTRARFLSREDLLALL----GPPEAEAGAV 180

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
              P      L+  +   + GN       
Sbjct: 181 HLAPEAPPPFLEAEAAGRRAGNRPALYLG 209


>gi|301058669|ref|ZP_07199670.1| methionine biosynthesis protein MetW [delta proteobacterium NaphS2]
 gi|300447233|gb|EFK10997.1| methionine biosynthesis protein MetW [delta proteobacterium NaphS2]
          Length = 264

 Score = 86.0 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 70/183 (38%), Gaps = 12/183 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMPA 66
              +  S   +    +I  +L +  D   G R+L +G           K+         +
Sbjct: 13  YDSWRKSHQNRTIERSIEPLLVSLLDPRPGERVLDIGCGTGTHLIMFSKMGLDVSGVDAS 72

Query: 67  GQGATNWPDQ--YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            +       +  + S+  +    +LP  D+  D  ++++ +EF ++P   L E  RV   
Sbjct: 73  PEVLAKARARLGHKSNFKIGMAEDLPFDDNEFDLAVLINAMEFMDNPLSALREAGRVARK 132

Query: 125 GGRMIVVVPNKRGMWARMEHTP-------FGSGQPYSWYQMISLLREANFTLSITSRSLF 177
             ++ + V N       ++          FG  + Y+ +Q+ SLL+ A   + I+ + + 
Sbjct: 133 --KVFIGVLNSFSWNGFLKTVQGYFGDPLFGQAKLYNLWQLKSLLKLAYGPVPISWQCIR 190

Query: 178 FPP 180
             P
Sbjct: 191 VTP 193


>gi|198282334|ref|YP_002218655.1| type 11 methyltransferase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|198246855|gb|ACH82448.1| Methyltransferase type 11 [Acidithiobacillus ferrooxidans ATCC
           53993]
          Length = 213

 Score = 86.0 bits (211), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 71/216 (32%), Gaps = 16/216 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT-L 61
           +D      +Y++  G+    A  ++LS       G  LL +G    +F+    +      
Sbjct: 1   MDAASYDAWYATARGRWIGMAEFRLLSKLLQARRGDTLLDVGCGTGWFTRRFAEEGLLAS 60

Query: 62  AFMPAGQGATNWPDQYF--SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
              P          +        +     LP  D   D V+ V  L F ED    + EI 
Sbjct: 61  GLDPNPDWLAFAQVKGPPAIRWIVGDARALPFPDRGFDRVVSVAALCFVEDERQAVAEIV 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSG-----QPYSWYQMISLLREANFTLSITSR 174
           RV     R  +   N+  +  R +    GSG     + +   +++               
Sbjct: 121 RVTR--RRFAIGWLNRTSLLYRQKGRGGGSGAYRGTRWHQPREVLDFFSGLRVRRLAVHS 178

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVI 210
           ++F P  +     ++    E++     P   G+ VI
Sbjct: 179 AIFLPSGN-----RMARTMERVLPHTLPW-GGLVVI 208


>gi|317151873|ref|YP_004119921.1| type 11 methyltransferase [Desulfovibrio aespoeensis Aspo-2]
 gi|316942124|gb|ADU61175.1| Methyltransferase type 11 [Desulfovibrio aespoeensis Aspo-2]
          Length = 238

 Score = 85.6 bits (210), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 74/214 (34%), Gaps = 9/214 (4%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFH-GKV 57
           M  D     Q++ +  G+   D  +++L +        G +LL LG              
Sbjct: 1   MDWDPERYEQWFDTAEGRFALDCETRLLQSVLAGWPRRGHKLLELGCGTGLILEMLYQMG 60

Query: 58  ERTLAFMPAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
                   + +       +  +     L +    P AD+  D  L+   LEF++DP  ML
Sbjct: 61  FDVTGLDNSPEMIMAARRRLGNRAELHLGNGELTPYADNEFDYALIWATLEFSDDPAAML 120

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHT--PFGSGQPYSWYQMISLLREANFTLSITS 173
            E  RV   G  +  +  +       + +T     +G  ++W ++  +++ A      T+
Sbjct: 121 TEAARVAEKGVLVGFLNKHSLYYAMNVRNTGSTLDAGTWHTWCEIQDMIKRATGFRPTTA 180

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
           +S+   P       +L         ++ P     
Sbjct: 181 QSVLPGPLQTWKAGRLAQCVN--CGLYPPFVGAF 212


>gi|55980451|ref|YP_143748.1| hypothetical protein TTHA0482 [Thermus thermophilus HB8]
 gi|55771864|dbj|BAD70305.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 212

 Score = 85.2 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 60/205 (29%), Gaps = 7/205 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
                 +Y + LG        + L        G  LL +G    ++       ++     
Sbjct: 8   AEAYEAWYGTPLGAYVIAEEERALKGLLP--PGESLLEVGAGTGYWLRRLPYPQKV-GVE 64

Query: 65  PAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           P+         +   ++        LP    S D VL+   LEF ED   +L E  RVL 
Sbjct: 65  PSEAMLAVGRRRAPEATWVRAWGEALPFPGESFDVVLLFTTLEFVEDVERVLLEARRVLR 124

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYS---WYQMISLLREANFTLSITSRSLFFPP 180
            GG ++V V      WA +       G        +     L+           ++F  P
Sbjct: 125 PGGALVVGVLEALSPWAALYRRLGEKGVLPWAQARFLAREDLKALLGPPEAEGEAVFLAP 184

Query: 181 THKKCILKLWSVFEKIGNIFGPGFA 205
                  +      + GN       
Sbjct: 185 EAHPPYEEADLAGRRAGNRPALYLG 209


>gi|226328905|ref|ZP_03804423.1| hypothetical protein PROPEN_02807 [Proteus penneri ATCC 35198]
 gi|225202091|gb|EEG84445.1| hypothetical protein PROPEN_02807 [Proteus penneri ATCC 35198]
          Length = 238

 Score = 85.2 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 74/236 (31%), Gaps = 29/236 (12%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             +     G+    AI   L   W  + G  LL LG            V   +       
Sbjct: 14  DSWRDIPWGEYYRMAIELRLQNWWPKMYGFHLLKLGQLSAELDTKLSIVSHQVNVT---- 69

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                     ++  + S   LP  + S+D  LM H L+++ DP  +L E  RVL   G +
Sbjct: 70  ------SNKINADVIASLDYLPFENKSIDVCLMAHVLDYSADPHWLLREADRVLIDDGWI 123

Query: 129 IVVVPNKRGMWARMEHT------PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +    + T         S + +S  + I  L   N+ +         P   
Sbjct: 124 VLTSFNPMSLLGLGKCTPFLRQRQPYSSRMFSLRRQIDWLSVLNYEVMTQQNFQIMP--- 180

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK---KKHISSPIL 235
                      +  G+ +      + +I ARK      P        +  +   +L
Sbjct: 181 ------FSRPIKCDGSRY-HIGGCLNLIIARKRTLPLTPTALKFVLPRMSVKGRVL 229


>gi|298530692|ref|ZP_07018094.1| Methyltransferase type 11 [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298510066|gb|EFI33970.1| Methyltransferase type 11 [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 246

 Score = 85.2 bits (209), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 39/245 (15%), Positives = 82/245 (33%), Gaps = 23/245 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCR--LLGLGYAIPFFSCFHGK-VERTL 61
                +++++  G+   +   +++          R  LL +G     F     +      
Sbjct: 7   ADNYDRWFTTPEGRFALEQERRLIQHLVSGWPRRRQSLLEIGCGTGIFLDMFWEYGFDIY 66

Query: 62  AFMPAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
               +        D+        L S  +LP  D+  D   M+  LEF  D   +L E  
Sbjct: 67  GIDSSPDMLRKARDKLGCRADLHLGSAESLPFDDNEFDFAAMITLLEFCRDQGQVLAEAG 126

Query: 120 RVLTSGGRMIVVVPNKRGMWA------RMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           RV   G  +  +  N     +                + +S+ ++ SL++E        +
Sbjct: 127 RVARKGLLICFLNKNSLYHISHKLLRLWRRDKLLVRARWHSYREVRSLVQENLGNKKTYA 186

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSP 233
           RS+       + + +   VF+ +  +  P   G          + G+ +    ++ I +P
Sbjct: 187 RSV---LLGTRILWRDRHVFKTLNRMLWPPVFGA---------FTGMRVDLIDREPIKTP 234

Query: 234 ILVPH 238
           +L P 
Sbjct: 235 LLAPV 239


>gi|52841751|ref|YP_095550.1| generic methyl-transferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628862|gb|AAU27603.1| generic methyl-transferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 247

 Score = 85.2 bits (209), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 73/217 (33%), Gaps = 14/217 (6%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
            L +++ S LG       +  L      + G  LL LG             +      P 
Sbjct: 12  TLYEWFQSPLGVFVAKEFTDQLDPVKKFLKGETLLQLGDCATNPWLNLLDFKHKWIASPF 71

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                             S   LPL   ++DCV++   LE   + F ++ EI R+L   G
Sbjct: 72  S--------STNRIHLECSLNQLPLNRDTLDCVIVPLTLEPFGNNFSLIDEIDRILKPMG 123

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS------RSLFFPP 180
            +I +  N   +W         +       ++ S        L             + PP
Sbjct: 124 FLIFLCINPWSLWGGAMKWGVLNCYGNRTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
            + + ++K  + F++IG +  P  +G Y    +K  Y
Sbjct: 184 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEY 220


>gi|23004411|ref|ZP_00047755.1| COG0500: SAM-dependent methyltransferases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 113

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 65/112 (58%), Gaps = 2/112 (1%)

Query: 132 VPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
           +PN+ G+WAR + TPFG GQPYS  Q+  L+RE  F+    + +L+ PP   +  L+  +
Sbjct: 1   MPNRTGVWARRDATPFGHGQPYSRSQLSRLMRETLFSPEGWAETLYMPPIRSRFWLRSAA 60

Query: 192 VFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKK--KHISSPILVPHTVS 241
            +E+ G      FAG++V++A K LY+ + + + ++    + + +LVP    
Sbjct: 61  AWERFGTGLAMPFAGLHVVDATKQLYRPVTVRQVRRLESRVPARVLVPAGQP 112


>gi|323699823|ref|ZP_08111735.1| Methyltransferase type 11 [Desulfovibrio sp. ND132]
 gi|323459755|gb|EGB15620.1| Methyltransferase type 11 [Desulfovibrio desulfuricans ND132]
          Length = 238

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 79/240 (32%), Gaps = 16/240 (6%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFH-GKV 57
           M  D      ++ +  G+   D    +L            ++L +G     F        
Sbjct: 1   MSWDPDIYEAWFDTPEGRYALDREVLLLQEVLAGWPRRKRKILEIGCGTGLFLETLYQMG 60

Query: 58  ERTLAFMPAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
                   + +       ++ +     L    N+P +D+  D  L+   LEFA++P  ML
Sbjct: 61  LDVTGMDRSPEMIAAARKRFGNRAQLHLGHGENMPFSDNEFDYALLWSVLEFADNPEAML 120

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHTP--FGSGQPYSWYQMISLLREANFTLSITS 173
            E  RV   G  +  +  N    +  +  T         ++W +M  L+R+A       +
Sbjct: 121 AEAARVAEKGLLVGFLNKNSLYYYMNIRGTDSSMAGAHWFTWCEMQDLVRKATGFAPTLA 180

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY----QGLPITESKKKH 229
           RS+   P        L +      ++  P         A ++ +       P+   K++ 
Sbjct: 181 RSVLAGPMKTWKPTGLANQLN--AHLLPPALGAF---VAVRVDFANMKPLTPLFAWKREP 235


>gi|238899159|ref|YP_002924841.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466919|gb|ACQ68693.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 235

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 73/234 (31%), Gaps = 29/234 (12%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGY-AIPFFSCFHGKVERTLAFMPAGQ 68
            +    LG      I + +   W    G  LL +G  +    +       +        Q
Sbjct: 15  SWNEFPLGPNYRFEIQQHMQPWWPKFFGFYLLKIGALSTEIDTRECAIPHQINVGERGDQ 74

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                         +     LP ++ S D  L+ H L   EDP+  L E+ R+L   G +
Sbjct: 75  M-----------QVIADLNQLPFSEKSSDVCLLFHTLSAVEDPYRFLREVDRILVDDGWL 123

Query: 129 IVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           ++   N   +         ++         +S  +++  L   N+ +         P  H
Sbjct: 124 VISHFNSFSLLGIGKLLPVIKRRQPYVCPMFSRMRVLDWLGLLNYEIVHQIGFHVLPWHH 183

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLP--ITESKKKHISSPI 234
           +          E   NI  P  + + +I ARK         +     K   SP+
Sbjct: 184 RG---------EYSMNIHLPAISCLSLIIARKRTMPLSLDALKLRTPKRCFSPV 228


>gi|54297433|ref|YP_123802.1| hypothetical protein lpp1478 [Legionella pneumophila str. Paris]
 gi|53751218|emb|CAH12629.1| hypothetical protein lpp1478 [Legionella pneumophila str. Paris]
          Length = 247

 Score = 84.8 bits (208), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 73/217 (33%), Gaps = 14/217 (6%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
            L +++ S LG       +  L      + G  LL LG             +      P 
Sbjct: 12  TLYEWFQSPLGVFVAKEFTDQLEPVKKFLKGETLLQLGDCATNPWLNLLDFKHKWIASPF 71

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                             S   LPL   ++DCV++   LE   + F ++ EI R+L   G
Sbjct: 72  S--------STNRIHLECSLNQLPLNRDTMDCVIVPLTLEPFGNNFSLIDEIDRILKPMG 123

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS------RSLFFPP 180
            +I +  N   +W         +       ++ S        L             + PP
Sbjct: 124 FLIFLCINPWSLWGGAMKWGLLNCYGNQTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
            + + ++K  + F++IG +  P  +G Y    +K  Y
Sbjct: 184 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEY 220


>gi|148359054|ref|YP_001250261.1| generic methyl-transferase [Legionella pneumophila str. Corby]
 gi|296107103|ref|YP_003618803.1| generic methyl-transferase [Legionella pneumophila 2300/99 Alcoy]
 gi|148280827|gb|ABQ54915.1| generic methyl-transferase [Legionella pneumophila str. Corby]
 gi|295649004|gb|ADG24851.1| generic methyl-transferase [Legionella pneumophila 2300/99 Alcoy]
          Length = 246

 Score = 84.8 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 73/217 (33%), Gaps = 14/217 (6%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
            L +++ S LG       +  L      + G  LL LG             +      P 
Sbjct: 11  TLYEWFQSPLGVFVAKEFTDQLEPVKKFLKGETLLQLGDCATNPWLNLLDFKHKWIASPF 70

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                             S   LPL   ++DCV++   LE   + F ++ EI R+L   G
Sbjct: 71  S--------STNRIHLECSLNQLPLNRDTMDCVIVPLTLEPFGNNFSLIDEIDRILKPMG 122

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS------RSLFFPP 180
            +I +  N   +W         +       ++ S        L             + PP
Sbjct: 123 FLIFLCINPWSLWGGAMKWGLLNCYGNQTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 182

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
            + + ++K  + F++IG +  P  +G Y    +K  Y
Sbjct: 183 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEY 219


>gi|326803850|ref|YP_004321668.1| methyltransferase domain protein [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650466|gb|AEA00649.1| methyltransferase domain protein [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 224

 Score = 84.8 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/208 (13%), Positives = 63/208 (30%), Gaps = 6/208 (2%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMP 65
           +   +Y   +G       + +  +  D   G  +L  G     +S    +   +  A   
Sbjct: 10  DYDSWYQGEVGAFVDQIEADLAFSLVDVQAGMSVLDAGCGTGNYSIRLAQAGAQVQAIDI 69

Query: 66  AGQGATNWPDQY-----FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           + Q       +        +   +   +L     + D +  +  +EF  D    +   + 
Sbjct: 70  SSQMLKEAKRKAETLDLPIAFQKMDMNHLDFPRETFDLIFSMTAIEFIADLEAFIASCFD 129

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +L  GG +++    + G W +       S   Y+ ++      +      +  R   + P
Sbjct: 130 LLKPGGYLLIGSITESGDWGQYYQEKKDSIYNYAHFRDTQDFIKHYPKQFLGYREGLYLP 189

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIY 208
            H    L L S          P F  + 
Sbjct: 190 VHPDVDLDLASQEANYAKSASPSFTCVL 217


>gi|242277516|ref|YP_002989645.1| methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
 gi|242120410|gb|ACS78106.1| Methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
          Length = 262

 Score = 84.4 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 65/222 (29%), Gaps = 25/222 (11%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFH-GKVER 59
            D  +   ++ +  G+   +    ++            +LL +G     F          
Sbjct: 6   FDAEKFETWFKTPAGQFALEQEVGLMDHLISGWPRRKRKLLEVGCGTGLFLDHLYRCGFD 65

Query: 60  TLAFMPAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
                 +         +  +     L +  +LP  D+  D  ++   LEF  +P  ML E
Sbjct: 66  VSGVDHSPVMLEAAHKRLGNRASLYLCNGEHLPFTDNEFDFTVLWTVLEFCSEPEEMLRE 125

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
             RV   G  +        G   R     F  G+ + W    +L +   ++ S   R++ 
Sbjct: 126 AARVSAGGILI--------GFLNRHSIYFFTHGRMWPWASPSTLRQAHWYSPSEMRRAVK 177

Query: 178 F------------PPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
                         P           + +  G I+ P F   
Sbjct: 178 KTSGYSPIMTRSVLPGPMWSWKNRTPLKQLNGIIYPPYFGAF 219


>gi|225388299|ref|ZP_03758023.1| hypothetical protein CLOSTASPAR_02034 [Clostridium asparagiforme
           DSM 15981]
 gi|225045646|gb|EEG55892.1| hypothetical protein CLOSTASPAR_02034 [Clostridium asparagiforme
           DSM 15981]
          Length = 211

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/189 (17%), Positives = 54/189 (28%), Gaps = 16/189 (8%)

Query: 2   RVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK--V 57
             D    +    Y    G+       +V+      + G R+L LG           +   
Sbjct: 14  YFDRVAEDYDASYD---GRFVRCMYREVVRRAVS-LPGDRVLDLGCGNGNLIRMLREVKQ 69

Query: 58  ERTLAFMPAGQGATNWPD--QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
                   + Q             +  +     LP  D   D V+         +P   +
Sbjct: 70  ASCWGADLSSQMIREAGKNLGDKVNLTVADAAALPYGDGQFDIVICNASFHHYTEPERAV 129

Query: 116 HEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ------PYSWYQMISLLREANFTL 169
            EI RVL +GG +I+  P   G  AR         +       Y   ++ SL     F +
Sbjct: 130 EEIRRVLKTGGTLILGDPTIPGRLARKLLNQAVHKRDSGDFKIYGKTEITSLFAARGFRV 189

Query: 170 SITSRSLFF 178
               R  F 
Sbjct: 190 HSWKRINFR 198


>gi|237745985|ref|ZP_04576465.1| methyltransferase [Oxalobacter formigenes HOxBLS]
 gi|229377336|gb|EEO27427.1| methyltransferase [Oxalobacter formigenes HOxBLS]
          Length = 221

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/207 (12%), Positives = 58/207 (28%), Gaps = 10/207 (4%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK--VERTLAFMP 65
              +Y +  G+   +   ++L+ +     G  +L +G     F+         +      
Sbjct: 6   YDGWYDTPRGRWVEEREYRLLADSLGPEKGDSILDIGCGTGRFTRRLANGTGAQVTGVDV 65

Query: 66  AGQGATNWPDQY-FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
             +       +  FS   L     LP  D S   V  V  L F  +    + E  RV   
Sbjct: 66  NAEWLAYARSRDAFSRYLLADAMALPFEDRSFTHVCSVTALCFTPNWRKAVAEALRVARE 125

Query: 125 --GGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
                ++           R + + +      +  ++   ++E          ++  P   
Sbjct: 126 RFAIGLLNRHSLLWLTKGRQKKSAYQGADWITEAELADSVKELPVCGLEFRTAICLP--- 182

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYV 209
               +      E +        + + +
Sbjct: 183 SGSWV--ARFVEDVLPPCLKPGSFLLM 207


>gi|56460797|ref|YP_156078.1| SAM-dependent methyltransferase [Idiomarina loihiensis L2TR]
 gi|56179807|gb|AAV82529.1| SAM-dependent methyltransferase [Idiomarina loihiensis L2TR]
          Length = 256

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/246 (15%), Positives = 77/246 (31%), Gaps = 20/246 (8%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           +D+     +     G    +  ++++      +   + + +G   P  +       + L 
Sbjct: 10  IDLAAPGDWQQMACGHYMMEQTAELIRAHQRRLKPGKTVAIGSLSPGLNECIKNGAQWLT 69

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
                                     L L + SVD ++    LEF   P  +L E  RVL
Sbjct: 70  V-----------GTGSDVAVRSKLTELALKEDSVDNLVAPFVLEFCRHPHQLLREATRVL 118

Query: 123 TSGGRMIVVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
              G +I+   N          + R + +    G+ ++  ++   L    F +  +   +
Sbjct: 119 DDDGVLILTGFNPYSPAVASGFFIRHKKSFPWCGRYFTPVRVKDWLELLGFEVLESEFYV 178

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILV 236
                H +      S +    +   PG    Y I ARK          +++K ++     
Sbjct: 179 SNFLHHSE---HRGSDWSTKLSNLVPGLRAAYFIVARKQTLINRLKPSAQRKQLAVNGRQ 235

Query: 237 PHTVST 242
             T  T
Sbjct: 236 AATAMT 241


>gi|54294436|ref|YP_126851.1| hypothetical protein lpl1505 [Legionella pneumophila str. Lens]
 gi|53754268|emb|CAH15745.1| hypothetical protein lpl1505 [Legionella pneumophila str. Lens]
          Length = 247

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 73/217 (33%), Gaps = 14/217 (6%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
            L +++ S LG       +  L      + G  LL LG             +      P 
Sbjct: 12  TLYEWFQSPLGVFVAKEFTDQLEPVKKFLKGETLLQLGDCATNPWLNLLDFKSKWIASPF 71

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                             S   LPL   ++DC+++   LE   + F ++ EI R+L   G
Sbjct: 72  S--------STNRIHLECSLNQLPLNRDTLDCIIVPLTLEPFGNNFSLIDEIDRILKPMG 123

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS------RSLFFPP 180
            +I +  N   +W         +       ++ S        L             + PP
Sbjct: 124 FLIFLCINPWSLWGGAMKWGLLNCYGNRTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
            + + ++K  + F++IG +  P  +G Y    +K  Y
Sbjct: 184 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEY 220


>gi|269926413|ref|YP_003323036.1| Methyltransferase type 11 [Thermobaculum terrenum ATCC BAA-798]
 gi|269790073|gb|ACZ42214.1| Methyltransferase type 11 [Thermobaculum terrenum ATCC BAA-798]
          Length = 223

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 74/222 (33%), Gaps = 19/222 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAF 63
             +  Q+Y   LG       + ++        G  +  +G     F+    ++    +A 
Sbjct: 10  ASKYDQWYQEPLGNYIDQLETSLVMALLAPQAGETIADVGAGTGRFAAQLARIGVNVVAI 69

Query: 64  MPAGQG---ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
            P+G                    +  ++ LAD+SVD  + +  LEF   P +++ E+ R
Sbjct: 70  EPSGPMRDIGVRTTRDLSVRWINSTAEHMALADNSVDAAVAITVLEFVSYPEIVISEMKR 129

Query: 121 VLTSGGRMIVVVPNKRGMWARMEHT------PFGSGQPYSWYQMISLLREANFTLSITSR 174
           ++   GR+++ V N    WA +         P      +       + R           
Sbjct: 130 IVRPHGRIVLGVLNALSPWAALYRYLGDLDIPPWPHAKFKSR--EDIGRLLGIESEEVKG 187

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL 216
            +   P  +    +      + GN   P F     + A+K +
Sbjct: 188 CVHLAPDARPPFDEADKAGVRAGN--QPAF-----LVAKKEV 222


>gi|329894916|ref|ZP_08270715.1| SAM-dependent methyltransferase in cluster with
           Hydroxyacylglutathione hydrolase [gamma proteobacterium
           IMCC3088]
 gi|328922645|gb|EGG29980.1| SAM-dependent methyltransferase in cluster with
           Hydroxyacylglutathione hydrolase [gamma proteobacterium
           IMCC3088]
          Length = 252

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/243 (13%), Positives = 73/243 (30%), Gaps = 21/243 (8%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           ++Q+Y     +     + + L        G  L+ L              +         
Sbjct: 11  IQQWYHRPSLQDALACVKRELDQALPTCFGYHLVQL-------------ADIRFVACYQS 57

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
               +          +    +LP    S+D ++ +H L+ + +P  +L EI RVL   G+
Sbjct: 58  SKINHCVRCQPDGEVVSESEHLPFDADSIDVLIAMHSLDTSSNPHQVLREIQRVLAPQGQ 117

Query: 128 MIVVVPNKRGMWARMEHTPFGSGQ-------PYSWYQMISLLREANFTLSITSRSLFFPP 180
           + ++  N   + A        + +         S +++    R      +        P 
Sbjct: 118 LFLLGLNPSSLSALSGLLAKLTLREQTSPRSALSVHRLDDWFRLLGMERTRLRYFAHLPY 177

Query: 181 THKKCILKLW-SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
           +     L    S   +           +Y I A K +        ++ +     I +  +
Sbjct: 178 SGTHSKLSRALSKVTRWLEAHRMPAGRLYFIRATKQVCAINRPHLARFRPRLRTIGIGKS 237

Query: 240 VST 242
           V T
Sbjct: 238 VVT 240


>gi|145579455|pdb|2GS9|A Chain A, Crystal Structure Of Tt1324 From Thermus Thermophilis Hb8
 gi|145579456|pdb|2GS9|B Chain B, Crystal Structure Of Tt1324 From Thermus Thermophilis Hb8
          Length = 211

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 60/205 (29%), Gaps = 7/205 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
                 +Y + LG        + L        G  LL +G    ++       ++     
Sbjct: 7   AEAYEAWYGTPLGAYVIAEEERALKGLLP--PGESLLEVGAGTGYWLRRLPYPQKV-GVE 63

Query: 65  PAGQGATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
           P+         +   ++        LP    S D VL+   LEF ED   +L E  RVL 
Sbjct: 64  PSEAXLAVGRRRAPEATWVRAWGEALPFPGESFDVVLLFTTLEFVEDVERVLLEARRVLR 123

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYS---WYQMISLLREANFTLSITSRSLFFPP 180
            GG ++V V      WA +       G        +     L+           ++F  P
Sbjct: 124 PGGALVVGVLEALSPWAALYRRLGEKGVLPWAQARFLAREDLKALLGPPEAEGEAVFLAP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFA 205
                  +      + GN       
Sbjct: 184 EAHPPYEEADLAGRRAGNRPALYLG 208


>gi|307610220|emb|CBW99778.1| hypothetical protein LPW_15441 [Legionella pneumophila 130b]
          Length = 247

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 72/217 (33%), Gaps = 14/217 (6%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
            L +++ S LG       +  L        G  LL LG             +      P 
Sbjct: 12  TLYEWFQSPLGVFVAKEFTDQLEPVKKFFKGETLLQLGDCATNPWLNLLDFKSKWIASPF 71

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                             S   LPL   ++DCV++   LE   + F ++ EI R+L   G
Sbjct: 72  S--------STNRIHLECSLNQLPLNRDTLDCVIVPLTLEPFGNNFSLIDEIDRILKPMG 123

Query: 127 RMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS------RSLFFPP 180
            +I +  N   +W         +       ++ S        L             + PP
Sbjct: 124 FLIFLCINPWSLWGGAMKWGVLNCYGNRTVKLRSAFNLNRIFLQRGYKQCSLTNFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILY 217
            + + ++K  + F++IG +  P  +G Y    +K  Y
Sbjct: 184 VNSQSLIKKLTFFDEIGKMIWPFPSGFYCYITQKYEY 220


>gi|261363683|ref|ZP_05976566.1| methyl-transferase [Neisseria mucosa ATCC 25996]
 gi|288568234|gb|EFC89794.1| methyl-transferase [Neisseria mucosa ATCC 25996]
          Length = 222

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 77/219 (35%), Gaps = 24/219 (10%)

Query: 9   RQFY-SSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
            +++  + +G+ T +   +      +           +A         +    L    + 
Sbjct: 2   EEWFERTMIGRYTAEREKQFFMHYLER----------FAPCGVQTVVRQGGEWLG---SS 48

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           +     P        L++   +     S+D +LM H  E A     +LHE  RVL   GR
Sbjct: 49  ENVVAVP-----HDVLMTADAMAWESHSIDVLLMPHSHETAA-LTQVLHEASRVLKPEGR 102

Query: 128 MIVVVPNKRGMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +++   N + +W   +              +   +   L + +F +      ++ P  + 
Sbjct: 103 LVLTGFNPKSLWFFSKWFDGTRLPKKEHCLTLPALKQRLVDLDFEVEFGKFMVYLPAVNS 162

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
           K  L+ W   EK G+ + P  A +Y +   K +    P+
Sbjct: 163 KKGLRFWRFMEKAGDRWWPQCAAVYGLVLIKRMAGVTPL 201


>gi|332159397|ref|YP_004424676.1| hypothetical protein PNA2_1757 [Pyrococcus sp. NA2]
 gi|331034860|gb|AEC52672.1| hypothetical protein PNA2_1757 [Pyrococcus sp. NA2]
          Length = 304

 Score = 83.3 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 46/214 (21%), Positives = 77/214 (35%), Gaps = 24/214 (11%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
              ++     K    +    +            + +G     F+         L   P+ 
Sbjct: 14  YDNWFERH--KYAYLSELNAIREIMPSRD---CVEVGVGTGRFAEPL---GIKLGVEPSK 65

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + A     +           NLP  D+S+DC+LMV  + F +DP   + E +RVL  GG 
Sbjct: 66  KMAEIAEKRG-IKVIEGVAENLPFPDNSLDCILMVTTICFVDDPEKAIKEAYRVLKPGGH 124

Query: 128 MIVVVPNKRGMWAR-----MEHTPFGS-GQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           +I+   ++     R      E + F    + +S  ++I LL ++ F +    ++LF P  
Sbjct: 125 IIIGFIDRESEIGREYERNKEKSVFYREARFFSTREIIDLLEKSGFKVERIVQTLFHPLN 184

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
             K I     V E  G            I ARK 
Sbjct: 185 EIKDI---EPVEEGFGK------GSFVGIRARKK 209


>gi|116750921|ref|YP_847608.1| type 11 methyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116699985|gb|ABK19173.1| Methyltransferase type 11 [Syntrophobacter fumaroxidans MPOB]
          Length = 225

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 56/166 (33%), Gaps = 11/166 (6%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMPA 66
             Q++ S +G    +  + +L        G RLL +G     F+        R      +
Sbjct: 12  YDQWFESPIGSLVREYEAGLLLEMARPAPGERLLDVGCGTGVFTLVLLDAGARVTGLELS 71

Query: 67  GQGATNW---PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
                                    LP AD++ D  + V  +EF +D    + E++RV  
Sbjct: 72  LPMLRRAGNKATGRPFHMVRGDMRTLPFADAAFDKTVSVTAIEFLDDARGAVAELFRVTR 131

Query: 124 SGGRMIVVVPNKRGMWARME-------HTPFGSGQPYSWYQMISLL 162
            GG ++V   N    WA          H  F   +  S  +M  L+
Sbjct: 132 PGGLVVVASLNALSPWATRRTSAAREGHALFRHARFRSPAEMAGLM 177


>gi|213422239|ref|ZP_03355305.1| hypothetical protein Salmonentericaenterica_32668 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 161

 Score = 82.9 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 56/158 (35%), Gaps = 15/158 (9%)

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
              L    +LP AD SVD  L+ H L +  DP  +L E  RVL   G +++   N   + 
Sbjct: 3   MQVLADPLHLPFADKSVDVCLLAHTLPWCTDPHRLLREADRVLIDDGWLVISGFNPLSLM 62

Query: 140 ARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
                      TP  + + ++  + +  L   NF +   SR    P   +          
Sbjct: 63  GLRKLVLVLRKTPPYNSRMFTLMRQLDWLSLLNFEVLHYSRFHVLPWKKQGG-------- 114

Query: 194 EKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHIS 231
            ++ N   P    + +I ARK             K  +
Sbjct: 115 -RLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSKT 151


>gi|261403421|ref|YP_003247645.1| Methyltransferase type 11 [Methanocaldococcus vulcanius M7]
 gi|261370414|gb|ACX73163.1| Methyltransferase type 11 [Methanocaldococcus vulcanius M7]
          Length = 224

 Score = 82.9 bits (203), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 49/228 (21%), Positives = 82/228 (35%), Gaps = 28/228 (12%)

Query: 7   ELRQFYSS-----------FLGKCTTDAISKVLSTTWDD--VTGCRLLGLGYAIPFFSCF 53
           ++++FY +            L K   + I + +S+   D  V    +L  G     F   
Sbjct: 3   DIKEFYETWNVEELPQYIKILIKFADELIFEEISSMLSDFEVKDPLVLDCGCGFGTFYR- 61

Query: 54  HGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFL 113
             +   T+    +      +           +  +LP  D + D +L ++ LE   D   
Sbjct: 62  LTETFNTIYLDISLNMLKKFTKTE--RKICGNILHLPFKDKTFDLILCINVLEHV-DKSK 118

Query: 114 MLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
            L EI RVL   GR+IVVV NK+      +   F   + +     I   +   F +   +
Sbjct: 119 ALKEINRVLKDNGRVIVVVVNKKC---LFKEEVFNDFKIFHETMGIDDFK-VEFKILKYT 174

Query: 174 RSLFFPPTHK-------KCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            + F PP  K         +LK W   +K  +    G     +IE  K
Sbjct: 175 STYFLPPIVKILPRSVLSRVLKPWKWIDKRLSKIFKGRGQFLIIELEK 222


>gi|18977547|ref|NP_578904.1| hypothetical protein PF1175 [Pyrococcus furiosus DSM 3638]
 gi|18893258|gb|AAL81299.1| hypothetical protein PF1175 [Pyrococcus furiosus DSM 3638]
          Length = 210

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 80/215 (37%), Gaps = 24/215 (11%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
             +++     K    +    L +          + +G     F+         +   P+ 
Sbjct: 14  YEEWFERN--KFAYLSELNALKSLLPTRE---CVEVGIGSGRFAAPL---GIKMGVEPSK 65

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           + A     +           NLP  D+S+DC+LMV  + F +DP   + E +RVL  GG 
Sbjct: 66  KMAEIARKRG-IRVIEGVAENLPFEDNSLDCILMVTTICFVDDPEKAIKEAYRVLKPGGY 124

Query: 128 MIVVVPNKRGMWA-----RMEHTPFGS-GQPYSWYQMISLLREANFTLSITSRSLFFPPT 181
           +++   +K  +       R + + F    + +S  +++ LL    F +    ++LF    
Sbjct: 125 IVIGFVDKESLIGREYEKRKDKSVFYRDARFFSAREIMELLERNGFKIDGVVQTLFK--- 181

Query: 182 HKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKIL 216
               I  +  V E  G           VI A+K++
Sbjct: 182 KLDEIRDVEPVEEGYGR------GSFVVIRAKKVV 210


>gi|227357999|ref|ZP_03842341.1| type 11 methyltransferase [Proteus mirabilis ATCC 29906]
 gi|227161734|gb|EEI46766.1| type 11 methyltransferase [Proteus mirabilis ATCC 29906]
          Length = 237

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 71/229 (31%), Gaps = 26/229 (11%)

Query: 10  QFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQG 69
            + +   G+    AI   L   W  + G  +L LG            V   +        
Sbjct: 15  SWRNIPWGEYYRMAIELRLQNWWPKIYGFHMLKLGQLSAELDTKSSMVSHQV-------- 66

Query: 70  ATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
             N      ++  + S   LP  + SVD  LM H L+++ DP  +L E  RVL   G +I
Sbjct: 67  --NVTTTTTNTDVMASLNYLPFENKSVDVCLMAHVLDYSADPHWLLREADRVLVDDGWII 124

Query: 130 VVVPNKRG------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHK 183
           +   N             + H      + +S  + +  L   N+ +         P    
Sbjct: 125 LSSFNPISLLGIGKCTPILRHKQPYYCRMFSLRRQVDWLSVLNYEVITQQNFQIMP---- 180

Query: 184 KCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                     ++ G  +      + +I ARK      P          S
Sbjct: 181 -----FSRPVKRDGKRY-HVGGCLNLILARKRTLPLTPTAMKFALPRMS 223


>gi|303246882|ref|ZP_07333159.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ]
 gi|302491899|gb|EFL51779.1| Methyltransferase type 11 [Desulfovibrio fructosovorans JJ]
          Length = 243

 Score = 82.5 bits (202), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 63/216 (29%), Gaps = 16/216 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFM 64
              ++++  G+       ++L          G RLL +G     F               
Sbjct: 10  YDAWFTTPTGEFALKREMRLLEHMTAGWPRRGQRLLEVGCGTGIFLDVLHNAGFDVTGLD 69

Query: 65  PAGQGATNWPDQ--YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            A         +    +   L    +LP  D + D  +++  LEF  DP  +L E  RV 
Sbjct: 70  AAPAMLEAARQRLGDKADLHLGDAAHLPFDDHAFDFCVLLTVLEFCPDPGAVLAEAGRVA 129

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGS-------GQPYSWYQMISLLREANFTLSITSRS 175
             G  +  +  N+  ++        G         + +S   M  L+R          R+
Sbjct: 130 RKGILVGYL--NRCSLYGLSMRFFGGRRGGPLREARWFSPCAMGKLVRANLG--RRCQRT 185

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIE 211
               P  K    +     +    ++          E
Sbjct: 186 ASVLPGPKSTWREKTPWRQCNSFLWPLPLGAFCACE 221


>gi|158521536|ref|YP_001529406.1| methyltransferase type 11 [Desulfococcus oleovorans Hxd3]
 gi|158510362|gb|ABW67329.1| Methyltransferase type 11 [Desulfococcus oleovorans Hxd3]
          Length = 273

 Score = 82.1 bits (201), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/220 (13%), Positives = 67/220 (30%), Gaps = 11/220 (5%)

Query: 2   RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSC-FHGKVERT 60
             D     ++ +           + ++        G  +L +G         F  +  + 
Sbjct: 7   FRDAEAYEKWAADERHASVIRLQTGLMLDMLRPARGESVLDIGCGTGLIMRVFMDRGLQV 66

Query: 61  LAFMPAGQGATNWPDQYFSSTA--LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
               P+         Q             +LP  D++ +  ++   LEF  +P   L E 
Sbjct: 67  TGIDPSPYMLEVAEKQLGRRACLHRGVAEDLPFDDNAFNHAVLFTTLEFVNNPLQALEEA 126

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSITS 173
            RV      + V+         R        T +   + +S +++ ++LR     + I  
Sbjct: 127 CRVAKDRLFVGVLNRYALISLQRRLKGVFTDTIYNRARFFSVWELTAMLRGLLGNVPIEW 186

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEAR 213
           +S+   P     + ++     ++       F     + A+
Sbjct: 187 KSVCHLPLSAGRLTQILDA-SRLARRT--PFGAFVGVSAQ 223


>gi|261867848|ref|YP_003255770.1| SmtA protein [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413180|gb|ACX82551.1| SmtA protein [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 232

 Score = 81.7 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/222 (14%), Positives = 69/222 (31%), Gaps = 20/222 (9%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+S   +     + G ++L +G      +C      +           
Sbjct: 16  WQQLPNGSAYCNALSDYFAPWLTKICGYQILKIGGLSAEITCDLPLRHQISVNEKTPPNL 75

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           T      + S        LP  +  +D  ++ + L F +DP  +L E  RVL   G + +
Sbjct: 76  TAL-LGDYHSVVQSKLTELPFIEQHIDACILTNTLNFVQDPHQVLRETHRVLADDGYLFL 134

Query: 131 VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            + N    +           + Y  +++   L   NF +                     
Sbjct: 135 SLFNPLSTFMFKTRLGEFPLRHYCAWRVADWLELLNFEILEQQNLA-------------- 180

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                +       F+ + V+ A+K  Y  +   +  +  I +
Sbjct: 181 -----LNERQSGWFSPLIVMVAQKRTYPLILNPKKVRSKIPA 217


>gi|251792198|ref|YP_003006918.1| SmtA protein [Aggregatibacter aphrophilus NJ8700]
 gi|247533585|gb|ACS96831.1| SmtA protein [Aggregatibacter aphrophilus NJ8700]
          Length = 231

 Score = 81.7 bits (200), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 75/222 (33%), Gaps = 20/222 (9%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+   +A++   +  +  + G ++L +G       C      +        +  
Sbjct: 16  WQQLPNGRAYCNALNAYFAPWFTKICGYQILKIGGLSAEIQCDLPLRHQISLSEKITENL 75

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           T   D + S         LP     +D  ++ + L F +DP  +L E  RVLT  G + +
Sbjct: 76  TALLDDHHSI-VQAKLTELPFIQQQLDACVLTNTLNFVQDPHQVLRETHRVLTDDGYLFL 134

Query: 131 VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            + N          T     + Y  +++I  L   NF +                  +  
Sbjct: 135 SLFNPLNGLFFKSKTGDFPSRHYCIWRIIDWLELLNFDILE---------------QRNL 179

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           ++  +    F P    + VI A+K  Y      +  +  I +
Sbjct: 180 ALSHQTAGWFSP----LTVIVAQKRTYPLTLNPQKVRSKIPA 217


>gi|320102021|ref|YP_004177612.1| type 11 methyltransferase [Isosphaera pallida ATCC 43644]
 gi|319749303|gb|ADV61063.1| Methyltransferase type 11 [Isosphaera pallida ATCC 43644]
          Length = 539

 Score = 81.7 bits (200), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 63/173 (36%), Gaps = 4/173 (2%)

Query: 7   ELRQFYSSF---LGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           E  + Y +            +        +   G  +L +G      +    +    +  
Sbjct: 300 EYERMYRTEDHYWWFVARRELVADWVARLNLPEGAVILDVGCGTGANALAWTRFGTVVGV 359

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
             + Q       +  S  A      LPL D++ D ++    LE  ED    L E  RVL 
Sbjct: 360 DFSDQALERCQRRGLSELARGDATKLPLGDATADALVATDILEHLEDDRAALIEWKRVLK 419

Query: 124 SGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            GG +++ VP  R +W   +       + Y   ++++  REA F ++ ++ + 
Sbjct: 420 PGGHLVLTVPAYRFLWGEHDVALMHH-RRYVASELLARAREAGFEVTRSTYAF 471


>gi|262275950|ref|ZP_06053759.1| biotin synthesis protein BioC [Grimontia hollisae CIP 101886]
 gi|262219758|gb|EEY71074.1| biotin synthesis protein BioC [Grimontia hollisae CIP 101886]
          Length = 271

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/163 (15%), Positives = 53/163 (32%), Gaps = 8/163 (4%)

Query: 19  CTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQY 77
                +   L     D  G  +L LG    +F+     +    +A   + +       + 
Sbjct: 38  AFQRRVGHQLMACCTDWMGKTVLDLGCGTGYFTQQLLNEGASVIALDLSDKMLEKAWKRC 97

Query: 78  FSSTAL--VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
            +           LPL D+ +D       L++ +D  + L E+ RV+  GG++      +
Sbjct: 98  GNQAVYIAGDAECLPLPDNCLDAAFSSLALQWCDDLSVPLRELKRVVKPGGKIYFTTLLE 157

Query: 136 RGMWARMEHTPFGSGQ-----PYSWYQMISLLREANFTLSITS 173
             +    +      G+       S  Q+   L +A    +   
Sbjct: 158 GSLEELKQAWRGVKGESHVNAFLSLKQVNIALAQAKCNHTHIE 200


>gi|167755585|ref|ZP_02427712.1| hypothetical protein CLORAM_01099 [Clostridium ramosum DSM 1402]
 gi|237734335|ref|ZP_04564816.1| S-adenosylmethionine-dependent methyltransferase [Mollicutes
           bacterium D7]
 gi|167704524|gb|EDS19103.1| hypothetical protein CLORAM_01099 [Clostridium ramosum DSM 1402]
 gi|229382565|gb|EEO32656.1| S-adenosylmethionine-dependent methyltransferase [Coprobacillus sp.
           D7]
          Length = 201

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 53/169 (31%), Gaps = 12/169 (7%)

Query: 12  YSSFL-GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCF---HGKVERTLAFMPAG 67
           Y +   GK     I   L        G  +L LG                        + 
Sbjct: 18  YDTTFYGKHARK-IYPYLLNEIIRCYGEEVLDLGCGTGALMKQVISEDSHRHLTGIDLSS 76

Query: 68  QGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           Q       Q  +     +    NLP  D + D V          +P   + EI+RVL  G
Sbjct: 77  QMIEKAKHQLKNKATLVVGDSENLPFFDQTFDIVYCNDSFHHYPNPQKAIAEIYRVLKIG 136

Query: 126 GRMIVV-----VPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTL 169
           G +I+      V  ++ M   +     G  + YS  +MIS L E    +
Sbjct: 137 GTLIIGDTYLPVIARQVMNYFIRFNKDGDVRIYSKKEMISFLEELFHEI 185


>gi|163782665|ref|ZP_02177662.1| hypothetical protein HG1285_17315 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882238|gb|EDP75745.1| hypothetical protein HG1285_17315 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 215

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 75/216 (34%), Gaps = 19/216 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
            ++   +Y    G+   +   K L     ++     L +G     F+             
Sbjct: 8   ALKYDLWYEKPFGRSAFELEVKCLKELAGEL--GSALEVGVGTGRFAEAL---GVEFGLD 62

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P+ +      D+        +  +LP  +   D VL+V  + F ++P  +L E  RVL  
Sbjct: 63  PSYEMLKLARDRG-IKCVQGAGESLPFRNEVFDLVLIVVSICFVDNPAEVLEECRRVLKR 121

Query: 125 GGRMIVVVPNKRGMW-------ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           GG +++ +  +   W       AR  H  +     YS   +  LL    F +     +L 
Sbjct: 122 GGTLLLGLIVRESRWADFYIKKAREGHPIYRHATFYSLRDIEVLLESKGFRIERMLSTLL 181

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEAR 213
             P  ++ + K   + E          AG   I+A 
Sbjct: 182 EEPQDEEPVSKR-DILEG-----FEPLAGFTCIKAT 211


>gi|254448766|ref|ZP_05062223.1| methyltransferase type 11, putative [gamma proteobacterium
           HTCC5015]
 gi|198261607|gb|EDY85895.1| methyltransferase type 11, putative [gamma proteobacterium
           HTCC5015]
          Length = 240

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/242 (17%), Positives = 82/242 (33%), Gaps = 26/242 (10%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           EL ++  S +G+     +  VL        G   L +            K          
Sbjct: 9   ELGRWLQSPVGQQLEARLLAVLPNLSQAWPGINHLQV---------DLEKALP------- 52

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                    Q   +    S    PL   S+D + +++ L+ A +P  +LH   + L   G
Sbjct: 53  ---VKRNVRQMSYAELFSSSEYSPLPGGSLDSLTLMYSLDVAREPHRVLHMADQWLAGSG 109

Query: 127 RMIVVVPNKRGMWARMEH------TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +++V  N   +W  +        T       YS +++   L+  N+ +   +     PP
Sbjct: 110 YLVIVGFNPYSLWGLLRWVMRWFQTTPWKAGFYSVHRIRDWLKVLNYDIHYHTSFGHTPP 169

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
             +    +L   +E+  +   P    + +I A++ LY   P  +     +  P+      
Sbjct: 170 LERVYQSRLCRPYERFMSWLLPRMGAVNIIVAKRPLYPMTPTRQRLTH-LEKPVAGAVAG 228

Query: 241 ST 242
            T
Sbjct: 229 PT 230


>gi|124514942|gb|EAY56453.1| putative methyltransferase [Leptospirillum rubarum]
          Length = 209

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/214 (16%), Positives = 69/214 (32%), Gaps = 10/214 (4%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTL 61
           +D      +Y +  G+       ++L +      G  LL +G    +F+    G    T+
Sbjct: 1   MDAYSYDDWYQTLRGRWIGRTEYRLLQSVLKARPGTTLLDVGCGTGYFTRLFTGDGFETV 60

Query: 62  AF--MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
                P+                L     LP  + S D  + V  L F  +    + E+ 
Sbjct: 61  GIDRDPSRVAFARNRQGQRDHYLLGDVRCLPFRNRSFDFSVAVTSLCFVPEISRAISEMA 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           RV      + ++  +      + E   +   Q ++  ++ SL+   +  +     ++FFP
Sbjct: 121 RVTRHRFALGLLNRHSLLFREKWEKETYKGAQWHTAGEVRSLISGLSDDI-NLKSAIFFP 179

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEAR 213
                    +    E+          G   I AR
Sbjct: 180 SGTF-----VARTLERAIPQNLLY-GGFLAISAR 207


>gi|328473151|gb|EGF43999.1| biotin synthesis protein BioC [Vibrio parahaemolyticus 10329]
          Length = 268

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 52/177 (29%), Gaps = 10/177 (5%)

Query: 19  CTTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATNWPDQ 76
                +   L      D+T  R+L LG    +FS     +    +    +        ++
Sbjct: 35  AFQRDVGHRLLEKLPSDLTNKRVLDLGCGTGYFSQLLLERGASVVCADLSQGMLDKARER 94

Query: 77  ---YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
              +     +    +LP  D+S D V     L++  D    L EI R+LT+ G+      
Sbjct: 95  CGDHNVRYVVADAESLPFEDASFDYVFSSLALQWCVDLSYPLREIRRILTANGKGCFSTL 154

Query: 134 NKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
               +    +      T        +  Q+   L ++         +          
Sbjct: 155 VDGSLCELRDSWAKIDTYQHVNNFITLNQVKIALAQSRCHNHHLDSTTNTVWYDSAF 211


>gi|94986789|ref|YP_594722.1| SAM-dependent methyltransferases [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731038|emb|CAJ54401.1| SAM-dependent methyltransferases [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 263

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 46/251 (18%), Positives = 79/251 (31%), Gaps = 15/251 (5%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
           + +L ++Y S  G    +   K+              LL +G  +  F          + 
Sbjct: 7   VKQLAEWYVSPQGSFALEQEYKLFQNLISIWPRRDYTLLNIGCGVGAFLEMFWDYGFDVT 66

Query: 63  FMPAGQGATN---WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +              +  +   L +  +LP  D S +   +V  LE+ EDP  +L E +
Sbjct: 67  GLDNNLEVLELSSNRLKNRAEFQLGALDDLPFEDESFNYASLVTILEYVEDPKKILAEAF 126

Query: 120 RVLTSGGRM-----IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSR 174
           RV + G  +       +          +   P    Q  S +Q+I L ++      I  R
Sbjct: 127 RVASDGIIVGFTNKWSINHIINSTLQLLHKKPKKDSQWVSPWQLIRLTKQLYPECRIYCR 186

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI-LYQGLPITESKKKHISS- 232
           S    P     +   WS   +I  I          +   K       P+    K+   + 
Sbjct: 187 STLLGPKRTWDVTSSWSKLNRI--ILSFPIGTYVGMRIEKRPKPTLTPLLLKAKEQAVNV 244

Query: 233 -PILVPHTVST 242
              L P   ST
Sbjct: 245 YNALSPEATST 255


>gi|114319787|ref|YP_741470.1| methyltransferase type 11 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226181|gb|ABI55980.1| Methyltransferase type 11 [Alkalilimnicola ehrlichii MLHE-1]
          Length = 224

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 46/163 (28%), Gaps = 2/163 (1%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMPA 66
              +Y S  G+        +L        G R+L +G     F+    +     +   P 
Sbjct: 13  YEAWYHSPRGRWVAKREFDLLFRLLRPALGSRVLDVGCGTGHFTRRFAQAGLDLVGLDPD 72

Query: 67  GQGATNWPD-QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           G             +        LP  D +    + +  L F E P + L E+ RV   G
Sbjct: 73  GDALRYARSLDDSVAYVRGDARTLPFPDGAFANCIAITSLCFVESPEVALAEMARVAREG 132

Query: 126 GRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFT 168
             + ++       W +     +   +      +    +     
Sbjct: 133 VALGLLHRPSLLHWQKAGRGGYRGARWDRGVDLRRWFQALPGW 175


>gi|118588066|ref|ZP_01545476.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol
           methylase-like protein [Stappia aggregata IAM 12614]
 gi|118439688|gb|EAV46319.1| 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1 4-benzoquinol
           methylase-like protein [Stappia aggregata IAM 12614]
          Length = 249

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/199 (14%), Positives = 59/199 (29%), Gaps = 12/199 (6%)

Query: 26  KVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVS 85
           + ++   +     R+L +G+ +                 P+ +          +      
Sbjct: 55  RYIADYVNARAPGRVLDIGFGLGELLEQVTGQNDCFGLDPSQKAVEVARQWCSADLRHGV 114

Query: 86  EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR---- 141
                   +  D V   H +E  ++P   +  I+ +L  GG  I   PN     AR    
Sbjct: 115 LEKGTFPANMFDVVTANHVIEHVDEPIPFVEAIFEILKPGGEFICGTPNFACAAARVYGD 174

Query: 142 --MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK-LWSVFEKIGN 198
                        +S   ++ LLR+  F + +       P    +   +  +    +   
Sbjct: 175 RFRLLHDPTHVSLFSDDSLVRLLRDTGFRIEMVEY----PYFGTRFATRETFDSMVRADA 230

Query: 199 IFGPGF-AGIYVIEARKIL 216
              P F      + ARK +
Sbjct: 231 DVSPAFWGSFVTVFARKPV 249


>gi|269960805|ref|ZP_06175176.1| biotin synthesis protein BioC [Vibrio harveyi 1DA3]
 gi|269834469|gb|EEZ88557.1| biotin synthesis protein BioC [Vibrio harveyi 1DA3]
          Length = 268

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 54/190 (28%), Gaps = 25/190 (13%)

Query: 7   ELRQFYS------SFLGKCT---------TDAISKVLSTTWDD-VTGCRLLGLGYAIPFF 50
            L  FY       S  GK              +   L     + + G R+L LG    +F
Sbjct: 8   TLESFYQDKEAIASSFGKAAETYDKHAAFQRDVGHRLLDKLPENLMGKRVLDLGCGTGYF 67

Query: 51  SCFH-GKVERTLAFMPAGQGATNWPDQYFSSTAL---VSEGNLPLADSSVDCVLMVHYLE 106
           S     +    +    +         +  +           NLP  D S D V     L+
Sbjct: 68  SQLLQQRGAEVVCGDISQAMLDKAELRCGAVRMHYQIADAENLPFDDESFDYVFSSLALQ 127

Query: 107 FAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH-----TPFGSGQPYSWYQMISL 161
           +  D    L E  RVL + G++         ++   E      T        +  Q+   
Sbjct: 128 WCTDLSYPLREARRVLKTDGKVCFSTLVDGSLYELREAWSKIDTYQHVNNFITHNQVKIA 187

Query: 162 LREANFTLSI 171
           L ++      
Sbjct: 188 LAQSWCHNHH 197


>gi|297195809|ref|ZP_06913207.1| methyltransferase type 11 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197720747|gb|EDY64655.1| methyltransferase type 11 [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 239

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 75/237 (31%), Gaps = 37/237 (15%)

Query: 8   LRQFYSSFL-----GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHG---KVER 59
           LR FY         G   +   +++L+       G  ++ +G      +       +  R
Sbjct: 9   LRDFYEDPAVPVASGDARSRRQARLLAEALGTSPGQLVVDVGCGDGSAARAAAPFLRGHR 68

Query: 60  TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +    +            +      +  LPLAD   D VL    +E   DP   L E+ 
Sbjct: 69  LVGVDWSHDALRRARPHLGNVVRGELDCGLPLADGCADAVLFSEVIEHLVDPDHALDELR 128

Query: 120 RVLTSGGRMIVVVPN----------------------KRGMWARMEHTPFGSGQPYSWYQ 157
           R+L  GG +++  PN                       RG+  R      G  + Y+   
Sbjct: 129 RILRPGGHLMLSTPNLAAWYNRALLLAGVQPVFSEVSLRGIHGRPGSQVVGHLRLYTARA 188

Query: 158 MISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
           + S L  A F     + + F        +L   +          PG A + +  AR+
Sbjct: 189 LRSYLTAAGFHDVRITGAPFHGVPRGLRLLDRAAC-------AVPGAASVLLAHARR 238


>gi|254784643|ref|YP_003072071.1| SAM-dependent methyltransferase, UbiE family [Teredinibacter
           turnerae T7901]
 gi|237685585|gb|ACR12849.1| SAM-dependent methyltransferase, UbiE family [Teredinibacter
           turnerae T7901]
          Length = 246

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/202 (18%), Positives = 57/202 (28%), Gaps = 34/202 (16%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC---------FHGKVERTLAFMPAGQGATNWPDQYF-- 78
                  G  +L LG      +                  +    +         +    
Sbjct: 7   EKLPLKPGDCVLDLGCGEGRHTLGLYFSAPLGELSGQLSLIGIDISAIDLATANKRKTDF 66

Query: 79  ---------SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                              LPL D+SVD ++    LE   D   ML EI RVL  GG + 
Sbjct: 67  PLPESQRAGIQFVRGDGLKLPLPDASVDHLICSEVLEHIPDYHAMLREINRVLKPGGTLC 126

Query: 130 VVVPNK------RGMWARMEHTPFGSGQPYSWYQMISLLREA--NFTLSITSRSLFFPPT 181
           V VP          +  R      G  + ++   +   LR           + +L  P  
Sbjct: 127 VSVPRAWPERICWWLEPRYHQVAGGHIRIFNRASLKRDLRSHGIQLFFEHGAHALHAP-- 184

Query: 182 HKKCILKLWSVFEKIGNIFGPG 203
                LK    +++ G+ F P 
Sbjct: 185 --YWWLKCL-FWDR-GDRFWPV 202


>gi|260768127|ref|ZP_05877061.1| biotin synthesis protein BioC [Vibrio furnissii CIP 102972]
 gi|260616157|gb|EEX41342.1| biotin synthesis protein BioC [Vibrio furnissii CIP 102972]
          Length = 267

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/165 (15%), Positives = 49/165 (29%), Gaps = 10/165 (6%)

Query: 19  CTTDAISKVLSTTWDD-VTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQ 76
                +++ L     D ++G  +L LG    + S     +  R      +         +
Sbjct: 34  AFQRDVAQRLLAKLPDDLSGWHILDLGCGTGYCSQELQRRGARVTCADLSPAMLAQAKQR 93

Query: 77  Y---FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
                          LP AD++ DCV     L++ +D  L L E+ RVL           
Sbjct: 94  CGSDNMRYVEADAEALPFADATFDCVFSSLALQWCDDLSLPLKEMRRVLKPSASAYFSTL 153

Query: 134 NKRGMWARMEHT-----PFGSGQPYSWYQMISLLREANFTLSITS 173
               ++                +  +  Q+   L +A+       
Sbjct: 154 LDGSLFELQRAWMKIDAHQHVNRFITLKQVKIALAQAHCGKHHID 198


>gi|78355056|ref|YP_386505.1| hypothetical protein Dde_0009 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217461|gb|ABB36810.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 246

 Score = 80.6 bits (197), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/245 (18%), Positives = 78/245 (31%), Gaps = 23/245 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVE-RTL 61
           +     +Y+   G        ++L          G  LL +G    +F     +      
Sbjct: 7   VQRYEAWYAGKAGSFALRQEKRLLENLISGWPRRGRSLLEVGCGPGYFLEMFWEAGLDVT 66

Query: 62  AFMPAGQGATNWPDQYFSSTA--LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
               +         +  +     + +  +LP  D+  D V ++  LEF E+P   L E  
Sbjct: 67  GLDRSLAMLDAARARMGNRARLDVGNGEHLPYEDNRFDYVALLASLEFMENPQAALEEAI 126

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSG-----QPYSWYQMISLLREANFTLSITSR 174
           RV   G  +  +                 SG     Q YS Y++ ++LREA     +T R
Sbjct: 127 RVAARGVVVGFLNSWSLYYALSGRKRCPASGTLQAAQWYSPYRIRAMLREAAGNKPMTLR 186

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIF--GPGFAGIYVIEARKI----LYQGLPITESKKK 228
           S+   P           +  ++ N +     F G     A ++    +    PI    K 
Sbjct: 187 SVLPGPVVT----WRDVLIFRLCNGWVSPLPFGGF---AAVRLDLVNIAPVTPIMAKAKS 239

Query: 229 HISSP 233
               P
Sbjct: 240 VKPVP 244


>gi|15602551|ref|NP_245623.1| hypothetical protein PM0686 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720970|gb|AAK02770.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 238

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/248 (17%), Positives = 84/248 (33%), Gaps = 33/248 (13%)

Query: 2   RVDIVEL-RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
             +++ L   +     G C  +A++   S  +  + G  +L LG      +         
Sbjct: 7   YPNVMHLPHSWQQLQNGSCYCNALTDYFSAWYPKILGHHVLKLG---GLSAEIQSDCFLH 63

Query: 61  LAFMPAGQ---GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHE 117
            A + A        +   Q  +S    +   LP  + S+D  ++ + L F++DP  +L E
Sbjct: 64  HAILLAPHISPSLQSLGLQKNTSVIQANLTELPFIEQSIDACMLSNTLNFSQDPHQILRE 123

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTP-----FGSGQPYSWYQMISLLREANFTLSIT 172
           + RVL   G + + + N         H           + Y  ++++  L   NF +   
Sbjct: 124 VTRVLREDGYLFLSLFNPFSPLLFKRHLHTVSHSPLPVRHYVPWRILDWLALLNFDILD- 182

Query: 173 SRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                          K    ++K  +   P       I ARK +Y    +   K     +
Sbjct: 183 --------------QKRLVSWDK--HRCFPHL---IAIVARKRVYPLT-LNPQKVHFKKN 222

Query: 233 PILVPHTV 240
            +L P   
Sbjct: 223 ELLTPVNA 230


>gi|161870170|ref|YP_001599340.1| hypothetical protein NMCC_1209 [Neisseria meningitidis 053442]
 gi|161595723|gb|ABX73383.1| conserved hypothetical protein [Neisseria meningitidis 053442]
          Length = 205

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 55/150 (36%), Gaps = 5/150 (3%)

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                  +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N  
Sbjct: 36  CVPRDMSMSAENMALADVSADMLLFPHTLEGGI-PSQILSEAHRILKPCGRLMLTGFNPY 94

Query: 137 GMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
            +W                     ++   L +  F +      ++ PP      ++ W  
Sbjct: 95  SLWGFSRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPVSSIGQIRFWRF 154

Query: 193 FEKIGNIFGPGFAGIYVIEARKILYQGLPI 222
            EK G+ + P  A +Y +   K      P+
Sbjct: 155 MEKAGDRWWPQCAAVYGLVLVKRAAGVTPL 184


>gi|325198449|gb|ADY93905.1| conserved hypothetical protein [Neisseria meningitidis G2136]
          Length = 188

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 55/153 (35%), Gaps = 5/153 (3%)

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                  +S  N+ LAD S D +L  H LE    P  +L E  R+L   GR+++   N  
Sbjct: 19  CVPRDMSMSAENMALADVSADMLLFPHTLEGGV-PSQILSEAHRILKPCGRLMLTGFNPY 77

Query: 137 GMWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSV 192
            +W                     ++   L +  F +      ++ PP      ++ W  
Sbjct: 78  SLWGFSRWFDGERLPEKRFCLPLPELKRQLADVGFDIEFGKFMVYLPPVSSLGQIRFWRF 137

Query: 193 FEKIGNIFGPGFAGIYVIEARKILYQGLPITES 225
            EK G+ + P  A +Y +   K      P+   
Sbjct: 138 MEKAGDRWWPQCAAVYGLVLVKRAAGVTPLPAW 170


>gi|119719939|ref|YP_920434.1| methyltransferase type 11 [Thermofilum pendens Hrk 5]
 gi|119525059|gb|ABL78431.1| Methyltransferase type 11 [Thermofilum pendens Hrk 5]
          Length = 222

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/175 (22%), Positives = 61/175 (34%), Gaps = 13/175 (7%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPA 66
           +   +Y S  G+   +  + +L        G   + +G     F+ F  +    +   PA
Sbjct: 16  QYDSWYDSPAGRVVLEVEASMLDEVLPSGIG---VDVGAGTCRFAPFLSRGREIVCLEPA 72

Query: 67  GQGATN-WPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
                  +           +  N PL   S D   MV  LEF EDP L L  IW  L SG
Sbjct: 73  YGMLVYGYARGRCEHPLCATSENAPLRP-SFDFAYMVTVLEFLEDPALSLTRIWEALKSG 131

Query: 126 GRMIVVVPNKRGMWARMEHT--------PFGSGQPYSWYQMISLLREANFTLSIT 172
           G + V+   +   W ++                + YS  ++  LL  A F +   
Sbjct: 132 GLLAVLYVERDSKWGKLYSELAEKGADPVLARARFYSQPEVDKLLSAAGFEVREH 186


>gi|302551048|ref|ZP_07303390.1| methyltransferase [Streptomyces viridochromogenes DSM 40736]
 gi|302468666|gb|EFL31759.1| methyltransferase [Streptomyces viridochromogenes DSM 40736]
          Length = 253

 Score = 80.2 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A     +                  P+
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDQNAEEIREVAKWFAAMKEAGEAPE 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 W   +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYKADELLTKIREAGLQPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|315179827|gb|ADT86741.1| biotin synthesis protein BioC [Vibrio furnissii NCTC 11218]
          Length = 267

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/165 (15%), Positives = 49/165 (29%), Gaps = 10/165 (6%)

Query: 19  CTTDAISKVLSTTWDD-VTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQ 76
                +++ L     D ++G  +L LG    + S     +  +      +         +
Sbjct: 34  AFQRDVAQRLLAKLPDDLSGWHILDLGCGTGYCSQTLQQRGAQVTCADLSPAMLAQAKQR 93

Query: 77  Y---FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
                          LP AD++ DCV     L++ +D  L L E+ RVL           
Sbjct: 94  CGSDNMRYVEADAEALPFADATFDCVFSSLALQWCDDLSLPLKEMRRVLKPSASAYFSTL 153

Query: 134 NKRGMWARMEHT-----PFGSGQPYSWYQMISLLREANFTLSITS 173
               ++                +  +  Q+   L +A+       
Sbjct: 154 LDGSLFELQRAWMKIDAHQHVNRFITLKQVKIALAQAHCGKHHID 198


>gi|288817945|ref|YP_003432292.1| SAM-dependent methyltransferase [Hydrogenobacter thermophilus TK-6]
 gi|288787344|dbj|BAI69091.1| SAM-dependent methyltransferase [Hydrogenobacter thermophilus TK-6]
 gi|308751543|gb|ADO45026.1| Methyltransferase type 11 [Hydrogenobacter thermophilus TK-6]
          Length = 215

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 74/214 (34%), Gaps = 19/214 (8%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
             ++Y    GK       + L +   +  G   L +G     F+   G        +   
Sbjct: 11  YDEWYERPFGKSAYKLELECLKS-LYNQKGLS-LEIGVGSGRFAQALG----IKYGVDTS 64

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
           +G      +      L     LP  DS  D  L+V  L F EDP   L E +RVL  G  
Sbjct: 65  KGLLRMAHKRGVRPILAKAEELPFKDSVFDSALIVVSLCFFEDPLASLKEAYRVLKEGSF 124

Query: 128 MIVVVPNKRGMWARMEHTPFGSGQ-------PYSWYQMISLLREANFTLSITSRSLFFPP 180
           +++ +      WA         G         YS+ Q++SL++ A F       +LF  P
Sbjct: 125 LLLGLVLSESPWAEFYREKAKKGHPIYSYAKFYSYPQLLSLIQSAGFKKDKAYTTLFEEP 184

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
             K  + K   + E           G + + A K
Sbjct: 185 QDKYPV-KNRRIVEG-----FSPEGGFFCLRALK 212


>gi|21220785|ref|NP_626564.1| methyltransferase [Streptomyces coelicolor A3(2)]
 gi|256788064|ref|ZP_05526495.1| methyltransferase [Streptomyces lividans TK24]
 gi|289771956|ref|ZP_06531334.1| methyltransferase [Streptomyces lividans TK24]
 gi|8250587|emb|CAB93437.1| putative methyltransferase [Streptomyces coelicolor A3(2)]
 gi|289702155|gb|EFD69584.1| methyltransferase [Streptomyces lividans TK24]
          Length = 244

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 63/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFM-------------PAGQGATNWPD 75
           + +    G R+L LG      +   + +  R +A                A + A   P 
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGARVVALDQNAEEIREVAKWFAAMEEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 W   +       G  + Y   Q+++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYRADQLLTRIREAGLKPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|156974098|ref|YP_001445005.1| methyltransferase [Vibrio harveyi ATCC BAA-1116]
 gi|156525692|gb|ABU70778.1| hypothetical protein VIBHAR_01809 [Vibrio harveyi ATCC BAA-1116]
          Length = 268

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 58/190 (30%), Gaps = 25/190 (13%)

Query: 7   ELRQFYS------SFLGKCT----------TDAISKVLSTTWDDVTGCRLLGLGYAIPFF 50
            L  FY       S  GK             D   ++L    +++TG R+L LG    +F
Sbjct: 8   TLESFYQDKEAIASSFGKAAETYDKHAAFQRDVGHRLLDKFPENLTGKRVLDLGCGTGYF 67

Query: 51  SCFH-GKVERTLAFMPAGQGATNWPDQYFSSTAL---VSEGNLPLADSSVDCVLMVHYLE 106
           S     +    +    +         +  +           NLP  D S D V     L+
Sbjct: 68  SQLLQQRGAEVICGDISQAMLDKAQQRCGTQQMQYQIADAENLPFDDESFDYVFSSLALQ 127

Query: 107 FAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH-----TPFGSGQPYSWYQMISL 161
           +  D    L EI RVL +GG           ++   E      T        +  Q+   
Sbjct: 128 WCVDLSYPLREIRRVLKAGGAGCFSTLADGSLYELREAWSKIDTYQHVNNFITHNQVKIA 187

Query: 162 LREANFTLSI 171
           L ++      
Sbjct: 188 LAQSWCHNHH 197


>gi|148656545|ref|YP_001276750.1| type 11 methyltransferase [Roseiflexus sp. RS-1]
 gi|148568655|gb|ABQ90800.1| Methyltransferase type 11 [Roseiflexus sp. RS-1]
          Length = 254

 Score = 79.8 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 64/184 (34%), Gaps = 11/184 (5%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSS 80
               + +L   +      R+L  G        F  +     A   A + A    ++   +
Sbjct: 23  RAIAAALLDEVYAGRRDLRILDAGCGTGGNVVFLRRYGSVAAVDLAPEAALFGRERLRGA 82

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEF--AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
            A  +   LP  D+  D V     L      D    L E WRVL  GGR+++ +P    +
Sbjct: 83  LARATVLALPFVDACFDLVTSFEVLYHRGVPDEGAALRETWRVLRPGGRLLLRLPAFEWL 142

Query: 139 WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGN 198
             R +    G  + Y+   + +LLR   F +   S            +L  + + +++  
Sbjct: 143 RGRHDCAVHGR-RRYTIGDVQTLLRNQGFVIERISYVN--------TLLLPFPLVQRLIE 193

Query: 199 IFGP 202
              P
Sbjct: 194 RLLP 197


>gi|46203966|ref|ZP_00209189.1| hypothetical protein Magn03004620 [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/94 (44%), Positives = 54/94 (57%)

Query: 1  MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
          MR+D+ +LR FY+S LG  T   + + +      V+G R+LGLGY  P+    H   ERT
Sbjct: 1  MRLDVTDLRAFYASPLGVVTHRVVGRAIHGFLGSVSGLRVLGLGYVTPYLGPVHVIAERT 60

Query: 61 LAFMPAGQGATNWPDQYFSSTALVSEGNLPLADS 94
          LAFMPA QG  NWP    S TAL     LPL ++
Sbjct: 61 LAFMPATQGVVNWPSSGRSVTALADLTMLPLPEA 94


>gi|330506896|ref|YP_004383324.1| methyltransferase [Methanosaeta concilii GP-6]
 gi|328927704|gb|AEB67506.1| methyltransferase, putative [Methanosaeta concilii GP-6]
          Length = 216

 Score = 79.4 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 74/221 (33%), Gaps = 22/221 (9%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           +  E  ++Y          +  + L +          L +G     F+         +  
Sbjct: 10  NAAEYDEWYDENPAAYI--SEIQALRSLIPSS--GTGLEVGAGTGRFAAPL---GIKIGV 62

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
            PA   A     +            LP  D S D VLMV  + F +DP L   E  R L 
Sbjct: 63  EPAQAMAKRARARG-IEVIYALAEALPFRDESFDFVLMVTTVCFLDDPLLACQEAKRTLV 121

Query: 124 SGGRMIVVVPNKRGMWAR---MEHT---PFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
            GG +I+ + ++     R    + T    +   +  S  +++S L++ +F   +T +++F
Sbjct: 122 PGGSLIIGMIDRDSPAGRDYDRKKTTSKFYKFARFRSADEVMSWLKDLDFYDILTRQTIF 181

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ 218
                K   +      E  G            + ARK    
Sbjct: 182 K--NSKTGAVDAEPFTEGHGR------GAFLALSARKRDRP 214


>gi|15644048|ref|NP_229097.1| hypothetical protein TM1293 [Thermotoga maritima MSB8]
 gi|170289309|ref|YP_001739547.1| methyltransferase type 11 [Thermotoga sp. RQ2]
 gi|4981851|gb|AAD36367.1|AE001784_9 conserved hypothetical protein [Thermotoga maritima MSB8]
 gi|170176812|gb|ACB09864.1| Methyltransferase type 11 [Thermotoga sp. RQ2]
          Length = 207

 Score = 79.4 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 74/182 (40%), Gaps = 15/182 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           + E  +++   + +    +  + +     +  G   + +G     F+         +   
Sbjct: 9   VNEYERWF--LVHRFAYLSELQAVKCLLPEGRG---VEIGVGTGRFAVPLK---IKIGVE 60

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P+ + A     +        +  NLPL D S D  LMV  + F +DP   L E +R+L  
Sbjct: 61  PSERMAEIARKRG-VFVLKGTAENLPLKDESFDFALMVTTICFVDDPERALKEAYRILKK 119

Query: 125 GGRMIVVVPNKRGMWAR------MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
           GG +IV + ++     R       +   + + + +S  +++ L+R+A F      ++LF 
Sbjct: 120 GGYLIVGIVDRESFLGREYEKNKEKSVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFK 179

Query: 179 PP 180
            P
Sbjct: 180 HP 181


>gi|206890019|ref|YP_002249648.1| SAM-dependent methyltransferase, UbiE/COQ5 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741957|gb|ACI21014.1| SAM-dependent methyltransferase, UbiE/COQ5 family
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 216

 Score = 79.4 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 72/227 (31%), Gaps = 24/227 (10%)

Query: 1   MRVD------IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M +D        +   +Y S  GK   +   K L    +D  G ++L +G     F+   
Sbjct: 1   MSIDEPFESYATQYDAWYDSERGKILYENEKKCLKKLINDCNG-KVLEVGVGTGRFAVLA 59

Query: 55  GKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLM 114
            +         A         +            LP  D    CV+++  L F +DP L 
Sbjct: 60  EEAF---GVDVAEAPLRIAKLRG-IRVIKAKAEELPFRDKVFSCVMLIVTLCFVKDPLLA 115

Query: 115 LHEIWRVLTSGGRMIVVVPNKRGMWA--RMEHTPFGS-----GQPYSWYQMISLLREANF 167
           L E  RVL   G++I+        W     +    G         YS+     ++     
Sbjct: 116 LKEAKRVLKEEGKVIIGDVFLDSEWGKLYAQKKKEGHLFYKLANFYSFENFKKIVSLVGL 175

Query: 168 TLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            +     +L   P  +    +  ++ + I +       G   +E  K
Sbjct: 176 KIKRVFGTLKKSPFDEPSPEESEAIADDISSY------GFVCVELTK 216


>gi|300779873|ref|ZP_07089729.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Corynebacterium genitalium ATCC 33030]
 gi|300533983|gb|EFK55042.1| ubiquinone/menaquinone biosynthesis methyltransferase UbiE
           [Corynebacterium genitalium ATCC 33030]
          Length = 228

 Score = 79.4 bits (194), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 54/187 (28%), Gaps = 4/187 (2%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNL 89
              D   G R+L L       +    K           QG             +    +L
Sbjct: 45  ELLDLKPGERVLDLAAGTAVSTEELAKSGAWCVACDFSQGMLAAGAHRNVPKVVGDAMHL 104

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS 149
           P AD + D V + + L    D    L E+ RV   GGR++V   +   +           
Sbjct: 105 PFADETFDAVTISYGLRNVHDFEAGLREMARVTKPGGRLVVNEFSTPVIPVFSTIYSTVL 164

Query: 150 GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK-LWSVFEKIGNIFGPGFAGIY 208
            +      +  +           + S+   P  ++       S +E+        F  + 
Sbjct: 165 PRMIPL--LGKVFSSNAPAYEYLAESIKAWPAQEQLASAINASGWERATWK-NLAFGIVA 221

Query: 209 VIEARKI 215
           +  A K 
Sbjct: 222 LHRAEKR 228


>gi|311895828|dbj|BAJ28236.1| putative methyltransferase [Kitasatospora setae KM-6054]
          Length = 246

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 75/232 (32%), Gaps = 47/232 (20%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMP-------------AGQGATNWPD 75
           + +    G R+L LG      +   + +    +A                A + A   P 
Sbjct: 7   SRFPLAPGDRVLDLGCGGGRHAFECYRRGANVVALDRNAEEIAEVRRWFAAMEQAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++       NLP  D + D +++   +E   D   +L E+ RVL  GG + V VP  
Sbjct: 67  GASATAMEGDALNLPFDDDTFDKIIISEVMEHIPDDKGVLAEMVRVLKPGGLLAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTL--SITSRSLFFPPTHKK--- 184
                 WA  +       G  + Y   +++  +REA  T   S  + +L  P    K   
Sbjct: 127 LPEKICWALSDEYHEVEGGHIRIYKGDELVDKVREAGLTPYGSHHAHALHSPYWWIKCAV 186

Query: 185 ----------CILKLWSVFEKIG------------NIFGPGFAGIYVIEARK 214
                            V++ +G                P     +V+ A K
Sbjct: 187 GVNNDKALPVRAYHQLLVWDIVGTPVISTLTKAAEKALNPVLGKSFVVYASK 238


>gi|294788525|ref|ZP_06753767.1| generic methyl-transferase [Simonsiella muelleri ATCC 29453]
 gi|294483402|gb|EFG31087.1| generic methyl-transferase [Simonsiella muelleri ATCC 29453]
          Length = 231

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 73/220 (33%), Gaps = 15/220 (6%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           + + FLG          +    + +    +L +G  +  F                    
Sbjct: 10  WTNHFLGHDVCLQEHHFVQKYLNTMLPENILSMGMDLGTFRLPEKCTWI----------- 58

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFA-EDPFLMLHEIWRVLTSGGRMI 129
               ++   +  L +   LP    S D V++ H L+   +   L+L +I  +L   GR+I
Sbjct: 59  --RQNESLPADVLANSLALPWVAQSFDVVVVCHELDCVGQHWQLVLTQIEHILQPHGRLI 116

Query: 130 VVVPNKRGMWAR-MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
           +   N   +W     H           + +     + ++ +       + PP   +  ++
Sbjct: 117 LTGFNPYSLWRLDWRHEVPDVRHALHLHDLKMWCAKHHWQIEQGQFLNYLPPIRSRKWIE 176

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
                E+ GN + P  A +Y +  RK +       + +  
Sbjct: 177 NLRFLEQAGNRWLPHIAAVYALILRKDVLNVRLSKQGQNV 216


>gi|325527249|gb|EGD04628.1| methyltransferase type 11 [Burkholderia sp. TJI49]
          Length = 181

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 59/179 (32%), Gaps = 20/179 (11%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQY--- 77
                  L     DV G   L LG         +    R L   PA   +  +   +   
Sbjct: 2   LGWEQAQLDRIVSDVFGFHALQLGLPQLDALRENRMPYRGLVLDPASGASAPFQYPWARA 61

Query: 78  ---------FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
                      ST      +LP    SVD ++M H LEF  DP  +L E  RVL   G++
Sbjct: 62  AHAPQHAPADRSTTWCDLLDLPFESQSVDLIVMPHTLEFTSDPHRLLREAERVLMPEGQL 121

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWY--------QMISLLREANFTLSITSRSLFFP 179
           ++   N   +W   +     + +P+           ++   ++   F L       + P
Sbjct: 122 VITGFNSLSLWGMRQTFGRMANRPFVPATRDQIAFIRLKDWIKLLGFDLERGRFGCYRP 180


>gi|329934831|ref|ZP_08284872.1| methyltransferase [Streptomyces griseoaurantiacus M045]
 gi|329305653|gb|EGG49509.1| methyltransferase [Streptomyces griseoaurantiacus M045]
          Length = 259

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 63/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  R +A    G+                  P 
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGARVVALDRNGEEIREVAKWFAAMEQEGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   ++++ +REA      +  +           LK 
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYRAGELLARMREAGLRPYGSHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|110667142|ref|YP_656953.1| S-adenosylmethionine-dependent methyltransferase-like protein
           [Haloquadratum walsbyi DSM 16790]
 gi|109624889|emb|CAJ51298.1| S-adenosylmethionine-dependent methyltransferase homolog
           [Haloquadratum walsbyi DSM 16790]
          Length = 263

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 57/194 (29%), Gaps = 14/194 (7%)

Query: 5   IVELRQFYSSFL----GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-R 59
             ++ Q Y S      G+       + +  + + VTG  +L +      F+    +    
Sbjct: 9   ADDVAQAYESKRFSRGGQLIDRREKRAVLDSLNPVTGADILEIACGTGRFTAMLAERGAN 68

Query: 60  TLAFMPAGQGATNWPDQYFSSTAL-------VSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
            +    +         +  ++               LP  D+  D V  + +   AE P 
Sbjct: 69  IVGIDISDAMLAQGRRKARNNGVNDTLELLRGDAARLPFPDNHFDAVFAMRFFHLAETPG 128

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSIT 172
             L E+ RV      +     N R                YS  Q+  LL +A   +   
Sbjct: 129 TFLTEMARVS--NDIVFFDTFNHRSTRIIYNWLLPMGSHLYSRSQVKKLLSDAELAMVDD 186

Query: 173 SRSLFFPPTHKKCI 186
           +     P    + I
Sbjct: 187 THDFLLPYGFYRKI 200


>gi|297199307|ref|ZP_06916704.1| methyltransferase [Streptomyces sviceus ATCC 29083]
 gi|297147360|gb|EDY61207.2| methyltransferase [Streptomyces sviceus ATCC 29083]
          Length = 221

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A                        P+
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDQNADEIREVATWFAAMKEAGEAPE 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYKADELLAKIREAGLKPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|28897889|ref|NP_797494.1| biotin synthesis protein BioC [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838278|ref|ZP_01990945.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus AQ3810]
 gi|260364475|ref|ZP_05777100.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus K5030]
 gi|260877048|ref|ZP_05889403.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus AN-5034]
 gi|260896837|ref|ZP_05905333.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus Peru-466]
 gi|260902440|ref|ZP_05910835.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus AQ4037]
 gi|28806102|dbj|BAC59378.1| biotin synthesis protein BioC [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748333|gb|EDM59192.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus AQ3810]
 gi|308086990|gb|EFO36685.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus Peru-466]
 gi|308093726|gb|EFO43421.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus AN-5034]
 gi|308110654|gb|EFO48194.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus AQ4037]
 gi|308114604|gb|EFO52144.1| biotin biosynthesis protein BioC [Vibrio parahaemolyticus K5030]
          Length = 268

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/177 (14%), Positives = 50/177 (28%), Gaps = 10/177 (5%)

Query: 19  CTTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATNWPDQ 76
                +   L      D+T  R+L LG    +FS     +    +    +        ++
Sbjct: 35  AFQRDVGHRLLEKLPSDLTNKRVLDLGCGTGYFSQLLLERGASVVCADLSQGMLDKARER 94

Query: 77  ---YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
              +     +    +LP  D+S D V     L++  D    L EI R+L + G+      
Sbjct: 95  CGDHNVRYVVADAESLPFEDASFDYVFSSLALQWCVDLSYPLREIRRILAANGKGCFSTL 154

Query: 134 NKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKC 185
               +           T        +  Q+   L ++         +          
Sbjct: 155 VDGSLCELRYSWAKIDTYQHVNNFITLNQVKIALAQSRCHNHHLDSTTITVWYDSAF 211


>gi|269836889|ref|YP_003319117.1| methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
 gi|269786152|gb|ACZ38295.1| Methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
          Length = 327

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 64/188 (34%), Gaps = 18/188 (9%)

Query: 5   IVELRQFY--------SSFLGKCTTDAISKV-LSTTWDDV-TGCRLLGLGYAIPFFSCFH 54
             EL +FY           +     D   +  +++ W  +    R+L +G          
Sbjct: 61  AEELARFYPEDYAPFTRRGIAARVRDWQRRRDVASLWRYLGPPARVLDVGCGTGDLLRAI 120

Query: 55  GKVER--TLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPF 112
                   L   P+ Q      +++           + L  +SVD VL+ H +E    P 
Sbjct: 121 RDRGNPEVLGIEPSPQAVRIARERWDLDVRQGDLHTVQLPAASVDAVLLSHVIEHLPSPS 180

Query: 113 LMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP------FGSGQPYSWYQMISLLREAN 166
             L EI RVL  GG +I+ +PN     AR                 ++   + +LL    
Sbjct: 181 ATLAEITRVLRPGGALILWLPNAASWAARFWRENWIGYDVPRHLYAFTPATLGALLARHG 240

Query: 167 FTLSITSR 174
           FT++    
Sbjct: 241 FTVTEIRH 248


>gi|29832399|ref|NP_827033.1| methyltransferase [Streptomyces avermitilis MA-4680]
 gi|29609518|dbj|BAC73568.1| putative methyltransferase [Streptomyces avermitilis MA-4680]
          Length = 248

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A     +                  P 
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDQNAEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 W   +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYKADELLAKIREAGLKPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|85713110|ref|ZP_01044144.1| SAM-dependent methyltransferase [Idiomarina baltica OS145]
 gi|85693058|gb|EAQ31022.1| SAM-dependent methyltransferase [Idiomarina baltica OS145]
          Length = 256

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 75/240 (31%), Gaps = 15/240 (6%)

Query: 6   VELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMP 65
            E   +     G+     + + L  +         + LG            + R +    
Sbjct: 13  QEPDDWDQLANGQMIQSCVQQQLDDSRKHCLNGTTVTLGNLAQQLDVSGFTLGRPIHICQ 72

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
             + A                  LP+ + SVD ++    L+F+ DP  +L E  RVL   
Sbjct: 73  IQKPAEK------CHGVRAHYTQLPIKNESVDTLVCPFVLDFSADPHQVLREALRVLADD 126

Query: 126 GRMIVVVPNKRGMWARM------EHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFP 179
           G +I+   N                +    G+ +S  ++   L    F +      +   
Sbjct: 127 GTLILAGFNPLSPAMLSGLWRSQRWSFPWQGRYFSQARVKDWLSLLGFRVERQRYFIGHF 186

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHT 239
              +    +     E +        AG +++  +K  Y    + +S+K+ +S    +P  
Sbjct: 187 LAKQDA--EFGGYSEWLCQRCSWLSAGYWLVV-KKSCYIKPQVNKSRKERLSLTQALPAA 243


>gi|148658459|ref|YP_001278664.1| type 11 methyltransferase [Roseiflexus sp. RS-1]
 gi|148570569|gb|ABQ92714.1| Methyltransferase type 11 [Roseiflexus sp. RS-1]
          Length = 221

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/187 (19%), Positives = 62/187 (33%), Gaps = 7/187 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVT-GCRLLGLGYAIPFFSCFHG-KVERTLA 62
           +     +Y +  G+    A  +++      V     LL +G     F+ +   +  R   
Sbjct: 16  VAGYETWYETD-GRTADIAERRLIRWLLSGVPQAQSLLEVGVGTGHFARWLASEGYRVTG 74

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
              +         +     A      LP  D++ D VL++  LEF   P   L E  RV 
Sbjct: 75  VDLSAPMIAEAARRGSVLLARADAEALPFPDNAFDGVLLITALEFLPHPERALQEAARVA 134

Query: 123 TSGGRMIVV--VPNKRGMWARMEHTPFGSGQPYSWYQMISLLR--EANFTLSITSRSLFF 178
             G  + V+           R     +   + Y+  ++  L+R     F L IT R+   
Sbjct: 135 RHGIVLGVLNRWHPLAWQRKRSGLPVWQIARFYTPAELERLVRRVLHPFNLQITWRTTLL 194

Query: 179 PPTHKKC 185
           P      
Sbjct: 195 PGLWWYS 201


>gi|92114066|ref|YP_573994.1| methyltransferase type 11 [Chromohalobacter salexigens DSM 3043]
 gi|91797156|gb|ABE59295.1| Methyltransferase type 11 [Chromohalobacter salexigens DSM 3043]
          Length = 266

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 48/232 (20%), Positives = 77/232 (33%), Gaps = 22/232 (9%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           + E R+F++S  G     A    L    +   G   L LG A         +   T    
Sbjct: 14  VREGRRFWASEEGAALWQAQRACLGPLCESRFGLHSLQLGMAARLTDMCPIRHALTW--- 70

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            +   A        +S  +   G LPL D S+D VL+ H LE   +   ++ E  RV   
Sbjct: 71  -SPTRALAE----DASVLVCDPGALPLPDESLDLVLVHHLLEVVPNAHHLMREAARVTRD 125

Query: 125 GGRMIVVVPNKRG--------MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
            G ++V+  N  G           R      G  +     ++   L   +F +       
Sbjct: 126 DGLLVVMGWNPFGADALGHLAPAGRRRWPCKGHWRR--TGRLREWLAFVDFEIERVDYCG 183

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKK 228
           F  P  +   L      E +G  +       Y+I AR+      P     ++
Sbjct: 184 FRLPGGQVHNL----GLETLGRRYNLPVGVCYLIVARRKQAPIQPARTLFQR 231


>gi|326779635|ref|ZP_08238900.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
 gi|326659968|gb|EGE44814.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
          Length = 243

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 62/184 (33%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  R +A     +                  P+  
Sbjct: 9   FPLAAGDRVLDLGCGAGRHAFECYRRGARVVALDRNAEEIREVATWFAAMKEAGEAPEGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP    
Sbjct: 69  TATAMEGDALNLPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               W   +       G  + Y   Q+++ +REA      T  +           LK   
Sbjct: 129 EKVCWTLSDAYHEVEGGHIRIYKADQLLARIREAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|224371649|ref|YP_002605813.1| putative SAM-dependent methyltransferase [Desulfobacterium
           autotrophicum HRM2]
 gi|223694366|gb|ACN17649.1| putative SAM-dependent methyltransferase [Desulfobacterium
           autotrophicum HRM2]
          Length = 268

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 34/244 (13%), Positives = 68/244 (27%), Gaps = 13/244 (5%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPF-FSCFHGKVERTLA 62
           D      ++         +    +L          R+L +G            K      
Sbjct: 9   DARFYDAWFDKACRGHAFNLEMDLLLRMLAPHECDRILDIGCGTGRSLEPLLSKGLHLTG 68

Query: 63  FMPAGQGA--TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
             P+                    S   LP  D++ D  ++   LEF E P   + E  R
Sbjct: 69  VDPSTPMLDIARGRLGEKVDLHQGSAEALPFEDNAFDHAILFTSLEFTERPAKAVEEACR 128

Query: 121 VLTSGGRMIVVVPNKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSITSRS 175
           V      + V   +      R        TPF     +S +++  +L      + +T R+
Sbjct: 129 VARKSVIIGVFNSHAPLNLLRRIKNIFVSTPFSQAHYFSIWELKKILYAILGDVPLTWRT 188

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPIL 235
               P     +       E+   +       + +++  K + +   I     +   +   
Sbjct: 189 TLQFPWCSGPL---AGFIEQQALVERSPLGTMIIMK-IKPVPKFR-IRPLWLRVKLARNY 243

Query: 236 VPHT 239
            P +
Sbjct: 244 DPVS 247


>gi|293390317|ref|ZP_06634651.1| SmtA protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950851|gb|EFE00970.1| SmtA protein [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 232

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 71/222 (31%), Gaps = 20/222 (9%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G    +A+S   +  +  + G ++L +G      +C      +           
Sbjct: 16  WQQLPNGNAYCNALSDYFAPWFTKICGYQILKIGGLSAEIACDLPLRHQISINEKTPPNL 75

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           T      + S        LP  +  +D  ++ + L FA+DP  +L E  RVL   G + +
Sbjct: 76  TAL-LGDYHSVVQSKLTELPFIEQHIDACILTNTLNFAQDPHQILRETHRVLADDGYLFL 134

Query: 131 VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            + N    +           + Y  +++   L   NF +                     
Sbjct: 135 SLFNPMSTFMFKTRLGEFPLRHYCAWRVADWLELLNFEILEQHNLA-------------- 180

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                +       F+ + V+ A+K  Y  +   +  +  I +
Sbjct: 181 -----LNERQSGWFSPLIVMVAQKRTYPLILNPQKVRSKIPA 217


>gi|283852908|ref|ZP_06370169.1| Methyltransferase type 11 [Desulfovibrio sp. FW1012B]
 gi|283571737|gb|EFC19736.1| Methyltransferase type 11 [Desulfovibrio sp. FW1012B]
          Length = 248

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 59/212 (27%), Gaps = 16/212 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFM 64
              ++ +  G+       ++L          G RLL +G     F               
Sbjct: 10  YDAWFQTPPGEFALKREIRLLERMTAGWPRRGQRLLEVGCGTGIFLDVLHSAGFEVTGLD 69

Query: 65  PAGQGATNWPDQYFSST--ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
            +         +        L    +LP  D+  D  ++   LEF  DP L+L E  RV 
Sbjct: 70  ASPAMLEAARARMAGRADLHLGDASHLPFDDNEFDFCVLFTVLEFCRDPGLVLREAGRVA 129

Query: 123 TSGGRMIVVVPNKRGMWARMEHTPFGSG-------QPYSWYQMISLLREANFTLSITSRS 175
                +  +  N+   +        G G       + ++ + M  L RE+     I  R 
Sbjct: 130 RKAVLIGFL--NRFSCYGLSMRLFPGRGKGPLRTARWFTPWGMGRLARESLGRPPI--RM 185

Query: 176 LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207
               P  K    +          I        
Sbjct: 186 RSVLPGPKATWRESPPWRHLNAPILSLPLGAF 217


>gi|90414523|ref|ZP_01222498.1| putative biotin synthesis protein BioC [Photobacterium profundum
           3TCK]
 gi|90324431|gb|EAS40993.1| putative biotin synthesis protein BioC [Photobacterium profundum
           3TCK]
          Length = 279

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 49/151 (32%), Gaps = 11/151 (7%)

Query: 12  YSSFLGKCTTDAISKVLSTTWDDV--TGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQ 68
           Y           +   L      V   G R+L LG    +FS     +    LA   + +
Sbjct: 39  YDKA--AAFQRIVGHQLLERLPAVIQAGTRVLDLGCGTGYFSEQLMQRGYDVLAADLSIE 96

Query: 69  GATNWPDQY--FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                  +     +       NLP+ D+  D       L++ +D  + L E+ RV+  GG
Sbjct: 97  MLVQAKSRCGDSVTYLEADAENLPIKDNQFDVAFSSLALQWCDDLSVPLKELRRVVKPGG 156

Query: 127 RMIVVVPNKRG----MWARMEHTPFGSGQPY 153
           +++     +        A  E   +     +
Sbjct: 157 KIMFTTLVEGSLFELSQAWQEVDRYQHVNHF 187


>gi|182438981|ref|YP_001826700.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178467497|dbj|BAG22017.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 243

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 62/184 (33%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  R +A     +                  P+  
Sbjct: 9   FPLAAGDRVLDLGCGAGRHAFECYRRGARVVALDRNAEEIREVAKWFAAMKEAGEAPEGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP    
Sbjct: 69  TATAMEGDALNLPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               W   +       G  + Y   Q+++ +REA      T  +           LK   
Sbjct: 129 EKVCWTLSDAYHEVEGGHIRIYKADQLLARIREAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|312140519|ref|YP_004007855.1| sam dependent methyltransferase [Rhodococcus equi 103S]
 gi|325675861|ref|ZP_08155545.1| 3-demethylubiquinone-9 3-O-methyltransferase [Rhodococcus equi ATCC
           33707]
 gi|311889858|emb|CBH49175.1| SAM dependent methyltransferase [Rhodococcus equi 103S]
 gi|325553832|gb|EGD23510.1| 3-demethylubiquinone-9 3-O-methyltransferase [Rhodococcus equi ATCC
           33707]
          Length = 271

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/169 (17%), Positives = 52/169 (30%), Gaps = 3/169 (1%)

Query: 29  STTWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAFMPAGQGATNWPDQYF-SSTALVSE 86
                  TG  +L  G    + +        +            +   +Y        + 
Sbjct: 52  RDLLPRCTGRHVLEAGSGEGYGANMIADVATKVTGLDYDISAVEHVRSRYPRVEMLHGNL 111

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEH-T 145
             LPL D SVD V+    +E   D    L E  RVL  GG ++V  PN+       +   
Sbjct: 112 AELPLPDGSVDTVVNFQVIEHLWDQAQFLRECHRVLAPGGELLVSTPNRITFSPGRDTPL 171

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFE 194
                +  +  ++  LL +A F + + +                 S  +
Sbjct: 172 NPFHTRELNAAELTELLVDAGFRVEVMTGVHHGERLRALDAKHGGSFID 220


>gi|300712208|ref|YP_003738022.1| N-methyltransferase-like protein [Halalkalicoccus jeotgali B3]
 gi|299125891|gb|ADJ16230.1| N-methyltransferase-like protein [Halalkalicoccus jeotgali B3]
          Length = 235

 Score = 78.3 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 65/204 (31%), Gaps = 23/204 (11%)

Query: 9   RQFYSSFL-------------GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH- 54
           +++Y +               G+       + +S+   D+ G ++L +      F+    
Sbjct: 4   KEWYQTAEVAEEYEDKRFSRGGRLIDRREKEAVSSALGDLEGKKVLEIACGTGRFTAMLA 63

Query: 55  GKVERTLAFMPAGQGATNWPDQYFSS-------TALVSEGNLPLADSSVDCVLMVHYLEF 107
            +    +    +    +   ++   +               LP  D   D VL + +   
Sbjct: 64  ARGAEVVGLDISDAMLSQGREKARVAGLSERVEFVRGDAARLPFPDGHFDAVLAMRFFHL 123

Query: 108 AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANF 167
             +P   L EI RV    GR++    N     +          + Y+   + ++L    +
Sbjct: 124 IPNPDRYLREIRRVT--DGRLVFDTFNTPSTRSIYNWLLPMGSRLYADEDVHAMLDRTGY 181

Query: 168 TLSITSRSLFFPPTHKKCILKLWS 191
            L+ +S     P    + I +  +
Sbjct: 182 KLADSSHDFLLPYGLYRAIPRALA 205


>gi|322419700|ref|YP_004198923.1| type 11 methyltransferase [Geobacter sp. M18]
 gi|320126087|gb|ADW13647.1| Methyltransferase type 11 [Geobacter sp. M18]
          Length = 217

 Score = 78.3 bits (191), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 77/219 (35%), Gaps = 24/219 (10%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAF 63
           +  E   ++          A    +            + +G     F+        ++  
Sbjct: 16  NATEYDAWFERH--HDIYQAELAAVRAAVPVT--GHGVEIGVGTGRFAGPL---GISVGV 68

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
            P+ + A     +        S  +LPLAD+S D  +MV  + F +D      E WR+L 
Sbjct: 69  EPSPRMAEIARRRG-IEVLEGSAESLPLADNSFDFAVMVTVVCFLDDVAKAFQETWRILK 127

Query: 124 SGGRMIVVVPNKRGMWAR---MEHTPFGS-GQPYSWYQMISLLREANFTLSITSRSLFFP 179
            GG ++V   ++     R    + + F    + YS  ++   L +A F+     ++LF  
Sbjct: 128 PGGTLVVGFIDRESELGRTCSQKKSVFYRDARFYSVGELAEWLAKAGFSGFSCRQTLFPG 187

Query: 180 PTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQ 218
                          ++G   G G     VI+A+K   +
Sbjct: 188 EAT------------RLGVREGFGTGSFVVIQAQKQERR 214


>gi|297194652|ref|ZP_06912050.1| methyltransferase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197720319|gb|EDY64227.1| methyltransferase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 244

 Score = 78.3 bits (191), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 64/186 (34%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDQNGEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++       NLP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALNLPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   ++++ +++A      T  +           LK 
Sbjct: 127 GPEKICWALSDAYHEVEGGHIRIYKADELLAKMKQAGLRPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|239940829|ref|ZP_04692766.1| putative methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|239987307|ref|ZP_04707971.1| putative methyltransferase [Streptomyces roseosporus NRRL 11379]
 gi|291444265|ref|ZP_06583655.1| methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|291347212|gb|EFE74116.1| methyltransferase [Streptomyces roseosporus NRRL 15998]
          Length = 243

 Score = 78.3 bits (191), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 63/184 (34%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  + +A    G+                  P+  
Sbjct: 9   FPLAAGDRVLDLGCGAGRHAFECYRRGAQVVALDRNGEEIREVAKWFAAMKEAGEAPEGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP    
Sbjct: 69  TATAMEGDALNLPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               W   +       G  + Y   Q+++ +REA      T  +           LK   
Sbjct: 129 EKICWTLSDAYHEVEGGHIRIYKADQLLARIREAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|290960905|ref|YP_003492087.1| SAM-dependent methyltransferase [Streptomyces scabiei 87.22]
 gi|260650431|emb|CBG73547.1| putative SAM-dependent methyltransferase [Streptomyces scabiei
           87.22]
          Length = 255

 Score = 78.3 bits (191), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 64/186 (34%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P+
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDQNGEEIREVAKWFAAMKEAGEAPE 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYKADELLARIREAGLQPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|256371306|ref|YP_003109130.1| Methyltransferase type 11 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007890|gb|ACU53457.1| Methyltransferase type 11 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 222

 Score = 78.3 bits (191), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 62/184 (33%), Gaps = 16/184 (8%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNL 89
                + G R+L LG      + +        A + AG       D+       +    L
Sbjct: 7   EHLAPLEGRRVLDLGAGGGRHAAWLRDHG---ALVVAGDLVVEPTDREGVDWVRLDGAAL 63

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR------ME 143
           P AD S D VL    LE    P  ++ E  RVL  GG+++V VP+               
Sbjct: 64  PFADGSFDVVLCAEVLEHVAHPAQVVREARRVLAPGGQLVVSVPSAWPEAVCWALSLEYH 123

Query: 144 HTPFGSGQPYSWYQMISLLREANFTL--SITSRSLFFPPTHKKCIL-----KLWSVFEKI 196
             P G  + ++   +  LL    F +       +L  P    +C+L           E +
Sbjct: 124 AVPGGHVRIWTLAGIRRLLEAEGFRVVARHRRHALHAPYWWARCLLGVERSGQDPRIEWL 183

Query: 197 GNIF 200
           G   
Sbjct: 184 GWRL 187


>gi|328882080|emb|CCA55319.1| putative methyltransferase [Streptomyces venezuelae ATCC 10712]
          Length = 244

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 62/184 (33%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  + +A    G+                  P   
Sbjct: 9   FPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDQNGEEIREVAKWFAAMKEAGEAPAGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP    
Sbjct: 69  TATAMEGDALNLPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               W   +       G  + Y   +++  +R+A      T  +           LK   
Sbjct: 129 EKICWTLSDAYHEVEGGHIRIYKADELLGKIRQAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|318077127|ref|ZP_07984459.1| glycosyl transferase [Streptomyces sp. SA3_actF]
          Length = 739

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/186 (20%), Positives = 63/186 (33%), Gaps = 26/186 (13%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMP-------------AGQGATNWPDQY 77
           +    G R+L LG      +   + +  R +A                A + A   P   
Sbjct: 474 FPLAPGDRVLDLGCGAGRHAFECYRRGARVVALDRNTEEIREVAKWFAAMEEAGEVPAGA 533

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP    
Sbjct: 534 TATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPRHFP 593

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLS--ITSRSLFFPPTHKKCILKL 189
               WA  +       G  + Y   ++ + +R A         + +L  P       LK 
Sbjct: 594 EKVCWALSDAYHEVEGGHIRIYKATELAARMRGAGLRPYGAHHAHALHSP----YWWLKC 649

Query: 190 WSVFEK 195
               + 
Sbjct: 650 AFGVDN 655


>gi|302342142|ref|YP_003806671.1| methyltransferase type 11 [Desulfarculus baarsii DSM 2075]
 gi|301638755|gb|ADK84077.1| Methyltransferase type 11 [Desulfarculus baarsii DSM 2075]
          Length = 264

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 59/187 (31%), Gaps = 6/187 (3%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            +  +   +  +  G     A   +L    D   G R+L +G  +        +      
Sbjct: 26  QETAQYEAWLETPAGAQYLRASCALLDQILDFTPGWRVLDVGCGLGAHLEHLHERGMFCQ 85

Query: 63  FM---PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
            +   P      +      +        +LP  D+  D V++V+ LE  E    +L E  
Sbjct: 86  GLEAGPVAAKLASQRLGGRARIVKGDAHDLPFDDNEFDAVVLVNTLELTERRAQVLAEAA 145

Query: 120 RVLTSGGRMIVVVPNKRGMWA---RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
           RV  S   +I   P               P  +G+P     +  L+RE    +  T  S 
Sbjct: 146 RVAASRVCVISANPFDPSAQIARWLGRKHPVLTGRPIGLLGLRRLVREVLGPVPTTWSSA 205

Query: 177 FFPPTHK 183
              P  +
Sbjct: 206 VTWPWPR 212


>gi|163801967|ref|ZP_02195863.1| dithiobiotin synthetase [Vibrio sp. AND4]
 gi|159174108|gb|EDP58916.1| dithiobiotin synthetase [Vibrio sp. AND4]
          Length = 268

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/163 (16%), Positives = 45/163 (27%), Gaps = 10/163 (6%)

Query: 19  CTTDAISKVLSTTWDD-VTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQ 76
                +   L       +TG R+L LG    +FS     +    +    +         +
Sbjct: 35  AFQRDVGHRLLDKLPKNLTGLRVLDLGCGTGYFSQLLQQRGADVVCGDISQAMLDKAERR 94

Query: 77  YFSSTAL---VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
                         NLP  D S D V     L++  D      E+ RVL   G +     
Sbjct: 95  CGMERMQYTLADAENLPFDDESFDYVFSSLALQWCVDLSCAFKEVRRVLKKDGTVCFSTL 154

Query: 134 NKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSI 171
               ++   E      T        +  Q+   L ++      
Sbjct: 155 TDGSLYELREAWSKIDTNQHVNHFITRNQVKIALAQSGCPKHH 197


>gi|54309494|ref|YP_130514.1| putative biotin synthesis protein BioC [Photobacterium profundum
           SS9]
 gi|46913930|emb|CAG20712.1| putative biotin synthesis protein BioC [Photobacterium profundum
           SS9]
          Length = 279

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 48/151 (31%), Gaps = 11/151 (7%)

Query: 12  YSSFLGKCTTDAISKVLSTTWDDV--TGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQ 68
           Y           +   L      V  TG R+L LG    +FS     +     A   + +
Sbjct: 39  YDKA--AAFQRIVGHQLLERLPAVIPTGTRVLDLGCGTGYFSEQLMQRGYDVSAADLSIE 96

Query: 69  GATNWPDQY--FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                  +     +       NLP+ D+  D       L++ +D  + L E+ RV+   G
Sbjct: 97  MLAQAKSRCGDSVTYLEADAENLPIDDNQFDVAFSSLALQWCDDLSVPLKELRRVVKPDG 156

Query: 127 RMIVVVPNKRG----MWARMEHTPFGSGQPY 153
           +++     +        A  E   +     +
Sbjct: 157 KIMFTTLVEGSLFELSQAWQEVDRYQHVNHF 187


>gi|156742998|ref|YP_001433127.1| type 11 methyltransferase [Roseiflexus castenholzii DSM 13941]
 gi|156234326|gb|ABU59109.1| Methyltransferase type 11 [Roseiflexus castenholzii DSM 13941]
          Length = 258

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 65/188 (34%), Gaps = 6/188 (3%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSS 80
               + +L   +      R+L  G        F  +     A   A + A    ++   +
Sbjct: 34  RAIAAALLDEVYAGRRDLRILDAGCGTGGNVVFLRRYGSVAAVDLAPEAALFGAERLRGA 93

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFL--MLHEIWRVLTSGGRMIVVVPNKRGM 138
               S   LP  D   D V     L   + P     L E WRVL  GGR+++ +P    +
Sbjct: 94  LVRASVLALPFVDEWFDLVTSFEVLYHRDVPDETVALRETWRVLRPGGRLLLRLPAFEWL 153

Query: 139 WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL---FFPPTHKKCILKLWSVFEK 195
             R +    G  + Y+  ++  LL+   F +   S         P  ++ I ++    ++
Sbjct: 154 RGRHDCAVHGR-RRYTANEVRELLQPQGFEVERISYVNTLLLPLPLTQRFIERVAPAIDR 212

Query: 196 IGNIFGPG 203
            G+     
Sbjct: 213 NGSDLQLP 220


>gi|159900339|ref|YP_001546586.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893378|gb|ABX06458.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 251

 Score = 77.9 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 66/205 (32%), Gaps = 14/205 (6%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAI-PFFSCFHGKVERTLAFMPAGQGATNWPDQYFSS 80
             I++            R L  G       +   G                    +  + 
Sbjct: 23  RQIAQAWLDQLPTQRAWRALDAGCGTAGNVAYLLGDYGPAYGLDLMQAAVQLGRKKTDAP 82

Query: 81  TALVSEGNLPLADSSVDCVLMVHYLEF--AEDPFLMLHEIWRVLTSGGRMIVVVPNKRGM 138
               S   LP  D S D V     L      D    L EI+RVL  GG +++ +P    +
Sbjct: 83  LTQGSVLTLPYRDESFDLVTSFEVLYHRAVPDEVAALQEIYRVLKPGGWVLLRMPAYHWL 142

Query: 139 WARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL---FFPPTHKKCILKLWS---- 191
           ++  + +     + Y+  ++  LLR ANFT+  +S      F     ++ I ++      
Sbjct: 143 YSAHDRSVHTR-RRYTNKEVQKLLRAANFTIERSSYINSMLFPLILLQRLIERIRPSAPT 201

Query: 192 ---VFEKIGNIFGPGFAGIYVIEAR 213
                +  G +    F      EAR
Sbjct: 202 NESAMQLPGRLANKLFGTAMRFEAR 226


>gi|320011066|gb|ADW05916.1| Methyltransferase type 11 [Streptomyces flavogriseus ATCC 33331]
          Length = 243

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 61/184 (33%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  + +A     +                  P   
Sbjct: 9   FPLAAGDRVLDLGCGAGRHAFECYRRGAQVVALDQNAEEIREVAKWFAAMKEAGEAPAGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP    
Sbjct: 69  TATAMEGDALNLPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               W   +       G  + Y   +++  +REA      T  +           LK   
Sbjct: 129 EKVCWTLSDAYHEVEGGHIRIYKADELLGKIREAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|307352210|ref|YP_003893261.1| type 11 methyltransferase [Methanoplanus petrolearius DSM 11571]
 gi|307155443|gb|ADN34823.1| Methyltransferase type 11 [Methanoplanus petrolearius DSM 11571]
          Length = 550

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 76/237 (32%), Gaps = 32/237 (13%)

Query: 8   LRQFYSSFLGK----------CTTDAISKV----LSTTWDDVTGCRLLGLGYAIPFFSCF 53
           L +FY++  G                  +     +    D      ++ +G         
Sbjct: 316 LEEFYNTIDGDIDEKSYNSDLLVQKYWQQRKTEEIKNCLDIDKNDVIIDIGCGSGVQIRE 375

Query: 54  --HGKVERTLAFMPAGQGATNWPDQ--YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
                 +  L             ++    S   L    +LP+    VD ++    +E   
Sbjct: 376 TGASDAKMVLGIDLNRNALKFAREKGIPNSDYILADAEHLPVRSGKVDKIICAEIIEHLI 435

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTP--FGSGQ--------PYSWYQMI 159
            P  M+ EI RVL  GG +++  PN+   W   E     FG G+         +S  ++ 
Sbjct: 436 SPDKMVSEIKRVLNKGGEIVITTPNEFSFWGVYEMMWDLFGRGRNYGETHLMFFSPKELR 495

Query: 160 SLLREANFTLSITSRS--LFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            L  + +   + T      F      + +L L   F+ +      G +   ++ A+K
Sbjct: 496 LLFSDFSRAETKTIFFVSPFVALLKSEKLLDLSQRFDGLFERANIGLS--LILYAKK 550


>gi|192359996|ref|YP_001980591.1| Cyclopropane-fatty-acyl-phospholipid synthase [Cellvibrio japonicus
           Ueda107]
 gi|190686161|gb|ACE83839.1| Cyclopropane-fatty-acyl-phospholipid synthase [Cellvibrio japonicus
           Ueda107]
          Length = 249

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 55/181 (30%), Gaps = 24/181 (13%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC--FHGKVERTLAFMPA----------GQGATNWPDQYFS 79
           +    G R+L LG      +   +  +   ++                Q        +  
Sbjct: 9   FPLSAGDRVLDLGCGEGRHAINVYLQERVLSIGVDLNLRDLRTAQARAQPFLQADRPHQL 68

Query: 80  STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK---- 135
                    LP AD S D ++    LE   D   +L E+ RVL  GG + + VP      
Sbjct: 69  IFKQADATGLPFADGSFDKIICSEVLEHIADYHAVLREVARVLKPGGLLAITVPRAWPEK 128

Query: 136 --RGMWARMEHTPFGSGQPYSWYQMISLLREANFT--LSITSRSLFFPPTHKKCILKLWS 191
               +         G  + ++ + +   +++  F       + +L  P       LK   
Sbjct: 129 ICWWLSDEYHQVEGGHIRIFNGHHLRDEIKQQGFHYYRRHWAHALHSP----FWWLKCLF 184

Query: 192 V 192
            
Sbjct: 185 W 185


>gi|54401368|gb|AAV34462.1| predicted SAM-dependent methyltransferases [uncultured
           proteobacterium RedeBAC7D11]
          Length = 234

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 55/186 (29%), Gaps = 25/186 (13%)

Query: 29  STTWDDVTGCRLLGLGYAIP--FFSCFHGKVERTLAFMPAGQGATNWPDQYF-------- 78
               +   G ++L LG       F  +         F    +        +         
Sbjct: 6   LEYLNPEKGSKILDLGCGQGRHCFGAYLHADVDVFGFDMNHEDVLKAQKNFKDFDESSNY 65

Query: 79  --SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
              S  +     LP  ++S D V+    LE   D   ++ EI RVL  GG     VP   
Sbjct: 66  KSCSFGVTDGRKLPFDNNSFDYVICSEVLEHIIDFESVIEEIERVLKPGGIFAASVPKYL 125

Query: 137 GMWARME------HTPFGSGQPYSWYQMISLLRE--ANFTLSITSRSLFFPPTHKKCILK 188
             W   +        P G  + + +      + +   +F     + +L  P       L+
Sbjct: 126 PEWICWKLSKAYQEMPGGHVRIFKYRHFKKSIEKRGFSFLKRHWNHALHSP----YWWLQ 181

Query: 189 LWSVFE 194
               +E
Sbjct: 182 CM-FWE 186


>gi|269127860|ref|YP_003301230.1| type 11 methyltransferase [Thermomonospora curvata DSM 43183]
 gi|268312818|gb|ACY99192.1| Methyltransferase type 11 [Thermomonospora curvata DSM 43183]
          Length = 255

 Score = 77.5 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 59/181 (32%), Gaps = 22/181 (12%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMP-------------AGQGATNWPD 75
             +    G  +L +G      +     +    +AF               A + A   P 
Sbjct: 7   ERFPITPGDHVLDMGCGAGRHAFELYRRGAHVVAFDLDADELAGVEKMFRAMRAAGEVPK 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
           +  + T       LP  D S D ++    LE   D    + E+ RVL  GGR+ V VP+ 
Sbjct: 67  EATARTVRGDARRLPFPDDSFDKIVASEVLEHIPDDMTAMSELLRVLKPGGRLAVTVPSW 126

Query: 136 ---RGMWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
              R  WA  E       G  + Y+  ++ + L+     +     +           +K 
Sbjct: 127 LPERICWALSEDYHTAPGGHVRIYTRAELEAKLKSLGLRVDGHHHA--HGLHSPYWWIKC 184

Query: 190 W 190
            
Sbjct: 185 A 185


>gi|156740730|ref|YP_001430859.1| type 11 methyltransferase [Roseiflexus castenholzii DSM 13941]
 gi|156232058|gb|ABU56841.1| Methyltransferase type 11 [Roseiflexus castenholzii DSM 13941]
          Length = 225

 Score = 77.5 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 64/193 (33%), Gaps = 7/193 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVT-GCRLLGLGYAIPFFSCFHG-KVERTLA 62
            V    +Y++  G+    A  ++L+     +     L+ +G     F+ +   +  R + 
Sbjct: 19  AVGYEAWYATE-GRAADQAERRLLTWLLSGLPQPQTLVEIGVGTGHFARWLASEGYRVVG 77

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
              +         +           +LP A+ + D  L++  LEF   P   L E  RV 
Sbjct: 78  VDRSAPMLAEALQRGSVPLIRADAADLPFANDAFDVALLITTLEFLPCPERALQEAARVA 137

Query: 123 TSGGRMIVV--VPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
             G  + V+           R   + +   + Y+  ++  L+ +A       +   +   
Sbjct: 138 RQGMILGVLNRWHPLAWQRKRSGLSVWQVARFYAPPELARLVHQALH--RSVASMTWRTT 195

Query: 181 THKKCILKLWSVF 193
                 ++  S  
Sbjct: 196 LLPAPWVQSSSRL 208


>gi|326780919|ref|ZP_08240184.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
 gi|326661252|gb|EGE46098.1| Methyltransferase type 11 [Streptomyces cf. griseus XylebKG-1]
          Length = 241

 Score = 77.5 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 77/241 (31%), Gaps = 43/241 (17%)

Query: 8   LRQFYSSFL-------GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK--VE 58
           LR FY +         G+    A  ++L+       G  +L +G      +         
Sbjct: 11  LRDFYENPAVPVASGDGRTLRQA--RLLADALG-APGQVILDVGCGDGTAAATAAPILAG 67

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGN--LPLADSSVDCVLMVHYLEFAEDPFLMLH 116
             L  +   Q A                 +  LPLAD   D VL    LE   DP   L 
Sbjct: 68  HRLVGVDWSQDALRRARPRMGHVVRGELEHGGLPLADGCADAVLFSEILEHLVDPDQALD 127

Query: 117 EIWRVLTSGGRMIVVVPN----------------------KRGMWARMEHTPFGSGQPYS 154
           E+ RVL  GG +++  PN                       RG+  R      G  + Y+
Sbjct: 128 ELRRVLRPGGHLMLSTPNLAAWYNRALLLAGVQPVFSEVSLRGIHGRPGSEVVGHLRLYT 187

Query: 155 WYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
              + S L  + F     + + F        + +   + ++      PG A I +  AR+
Sbjct: 188 ARALRSFLAASGFDDVRITGAPFH------GVPRPLRLLDRAACSV-PGAASILLAHARR 240

Query: 215 I 215
            
Sbjct: 241 R 241


>gi|289164924|ref|YP_003455062.1| hypothetical protein LLO_1590 [Legionella longbeachae NSW150]
 gi|288858097|emb|CBJ11959.1| hypothetical protein LLO_1590 [Legionella longbeachae NSW150]
          Length = 245

 Score = 77.5 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 80/214 (37%), Gaps = 15/214 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPA 66
           L +++ S LG  T       L +T +   G  LL LG      +      + + +A   +
Sbjct: 13  LNKWFHSPLGHFTAHEFLVNLDSTMEYSYGEILLQLGNCGDNPWLKKLNYMHKWIA---S 69

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                N   Q        +   LPL  +S+DC++    LE       ++ EI R+L+  G
Sbjct: 70  PFYLANKKSQ-----IECALNQLPLERNSIDCIIAPLTLEPFGSSLSLIDEIDRLLSPMG 124

Query: 127 RMIVVVPNKRGMWARMEHTPFGSG------QPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +I++  N   +W                    + + +  +  +  +     S   + PP
Sbjct: 125 FVILLGINPWSLWGGAMKMGLLHCYDDTKVNMRTPFNLNRIFLQRGYRQYSLSSFCYIPP 184

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                ++K  +  ++IG +  P  +G Y   A+K
Sbjct: 185 VSNPTLIKKLTFLDEIGKMLWPFPSGFYCYIAQK 218


>gi|270156623|ref|ZP_06185280.1| putative methyltransferase [Legionella longbeachae D-4968]
 gi|269988648|gb|EEZ94902.1| putative methyltransferase [Legionella longbeachae D-4968]
          Length = 244

 Score = 77.5 bits (189), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 80/214 (37%), Gaps = 15/214 (7%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLG-YAIPFFSCFHGKVERTLAFMPA 66
           L +++ S LG  T       L +T +   G  LL LG      +      + + +A   +
Sbjct: 12  LNKWFHSPLGHFTAHEFLVNLDSTMEYSYGEILLQLGNCGDNPWLKKLNYMHKWIA---S 68

Query: 67  GQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126
                N   Q        +   LPL  +S+DC++    LE       ++ EI R+L+  G
Sbjct: 69  PFYLANKKSQ-----IECALNQLPLERNSIDCIIAPLTLEPFGSSLSLIDEIDRLLSPMG 123

Query: 127 RMIVVVPNKRGMWARMEHTPFGSG------QPYSWYQMISLLREANFTLSITSRSLFFPP 180
            +I++  N   +W                    + + +  +  +  +     S   + PP
Sbjct: 124 FVILLGINPWSLWGGAMKMGLLHCYDDTKVNMRTPFNLNRIFLQRGYRQYSLSSFCYIPP 183

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
                ++K  +  ++IG +  P  +G Y   A+K
Sbjct: 184 VSNPTLIKKLTFLDEIGKMLWPFPSGFYCYIAQK 217


>gi|307328692|ref|ZP_07607864.1| Methyltransferase type 11 [Streptomyces violaceusniger Tu 4113]
 gi|306885641|gb|EFN16655.1| Methyltransferase type 11 [Streptomyces violaceusniger Tu 4113]
          Length = 247

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/194 (20%), Positives = 66/194 (34%), Gaps = 22/194 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 7   SRFPLAAGDRVLDLGCGAGRHAFECYRRGAQVVALDQNGEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL +GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLKAGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   +++  +REA      T  +           LK 
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYRADELLEKMREAGLRPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEKIGNIFGPG 203
               +K G+     
Sbjct: 185 AFGVDKDGDEAPLP 198


>gi|302534191|ref|ZP_07286533.1| methyltransferase [Streptomyces sp. C]
 gi|302443086|gb|EFL14902.1| methyltransferase [Streptomyces sp. C]
          Length = 247

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 61/186 (32%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 7   SRFPLAAGDRVLDLGCGAGRHAFECYRRGAQVVAVDRNGEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   ++++ +  A      T  +           LK 
Sbjct: 127 GPEKICWALSDAYHEVEGGHIRIYKADELLAKMEAAGLKPYGTHHA--HGLHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|219557964|ref|ZP_03537040.1| hypothetical protein MtubT1_11937 [Mycobacterium tuberculosis T17]
 gi|260201105|ref|ZP_05768596.1| hypothetical protein MtubT4_13529 [Mycobacterium tuberculosis T46]
          Length = 229

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 61/196 (31%), Gaps = 12/196 (6%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            D      +Y S  G+         L     +V     L +G     F+           
Sbjct: 9   RDAAAYDAWYDSPTGRPILATEVAALRPLI-EVFAQPRLEIGVGTGRFADLL---GVRFG 64

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
             P+    T    +     A      +P        VLM   L F  DP  +  E  R+L
Sbjct: 65  LDPSRDALTFARRRG-VLVANAVGEAVPFVSRHFGAVLMAFTLCFVTDPAAIFRETRRLL 123

Query: 123 TSGGRMIVVVPNKRGMWA-----RMEHTPFGS--GQPYSWYQMISLLREANFTLSITSRS 175
             GG +++    +   WA     R      G    + Y+  ++  LL ++ F +     +
Sbjct: 124 ADGGGLVIGFLPRGTPWADLYALRAARGQPGYRDARFYTAAELEQLLADSGFRVIARRCT 183

Query: 176 LFFPPTHKKCILKLWS 191
           L  PP   +  ++   
Sbjct: 184 LHQPPGLARYDIEAAH 199


>gi|330752338|emb|CBL87291.1| protein containing methyltransferase domain [uncultured
           Sphingobacteria bacterium]
          Length = 253

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/181 (21%), Positives = 66/181 (36%), Gaps = 7/181 (3%)

Query: 2   RVDIVELRQ---FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
            V+  EL +   ++ + L      AI    S         ++L +G A    S       
Sbjct: 6   YVEYYELERNHWWFKARL-HLLKTAIQTHTSAI--PQKKLKILNVGAATGVTSQMLETFG 62

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
              +     Q      ++        S  +LP  DSS D +     +E  ED    + EI
Sbjct: 63  EVTSLEYDKQCCIFLKEKTGIEAVNASLTDLPFKDSSFDVICGFDVVEHIEDDEKAIREI 122

Query: 119 WRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
            RVLT  G+  + VP  + +W+  +       + Y+    +SLL      +S +S   F+
Sbjct: 123 NRVLTPNGQYFLTVPAFQFLWSNHDVVN-HHFRRYTQKSFLSLLYSNGLNVSFSSYFNFW 181

Query: 179 P 179
            
Sbjct: 182 L 182


>gi|62195093|ref|YP_220416.1| hypothetical protein p49879_2p07 [Leptospirillum ferrooxidans]
 gi|61105609|gb|AAX38528.1| ORF213 [Leptospirillum ferrooxidans]
          Length = 213

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 68/217 (31%), Gaps = 17/217 (7%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS-CFHGKVERTL 61
           +D      +Y +  G    +   +++S   D  T   LL +G    +F+  F     R  
Sbjct: 1   MDAASYDGWYETPRGHWIGETEYRLVSRILDVQTDDSLLDVGCGTGWFTRRFFQNDLRMT 60

Query: 62  AFMPAGQGATNWPDQYF--SSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
              P  Q  +    +             +LP  + S D V  V  L F E+    + EI 
Sbjct: 61  GIDPDPQWISFAKKRGPTGIDWIRGDARSLPFRNRSYDRVFSVSALCFVEEERQAVSEIV 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSG-----QPYSWYQMISLLREANFTLSITSR 174
           RV     R  +   N+  +  R +    G G     + +S  ++                
Sbjct: 121 RVTK--RRFAIGWLNRDSLLYRKKGGGEGVGSYRGARWHSPDELSGFFASLPIRDLRMHS 178

Query: 175 SLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIE 211
           ++F P        K     E +        +G  +I 
Sbjct: 179 AVFLP-----SGSKWARTIENVLP--NKVLSGALLIV 208


>gi|313127579|ref|YP_004037849.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Halogeometricum borinquense DSM 11551]
 gi|312293944|gb|ADQ68404.1| methylase involved in ubiquinone/menaquinone biosynthesis
           [Halogeometricum borinquense DSM 11551]
          Length = 220

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 53/179 (29%), Gaps = 7/179 (3%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAFMPAGQGATNW----PDQ 76
           + +              R+L +G    F +    +  +   A   +              
Sbjct: 31  EEMRDDALELLGIQPDDRVLDVGCGTGFATEGLLRYSDDVHALDQSIHQMQKAFGKFGKN 90

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                       LP AD+S D +     +E+  +P   L E  RV+  G R++VV P+  
Sbjct: 91  DEVRFYRGDAERLPFADNSFDVIWSSGSIEYWPNPVDALEEFRRVVKPGRRVLVVGPDYP 150

Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEK 195
                 +         Y  ++   +  EA F            P   K I  +    E+
Sbjct: 151 -ESGLFQRVADAIMLFYDEHEAQRMFEEAGFVDIEH-HIQQAYPGSPKAITTIARAPER 207


>gi|215427363|ref|ZP_03425282.1| hypothetical protein MtubT9_13629 [Mycobacterium tuberculosis T92]
 gi|215430924|ref|ZP_03428843.1| hypothetical protein MtubE_09650 [Mycobacterium tuberculosis
           EAS054]
          Length = 235

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 61/196 (31%), Gaps = 12/196 (6%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            D      +Y S  G+         L     +V     L +G     F+           
Sbjct: 15  RDAAAYDAWYDSPTGRPILATEVAALRPLI-EVFAQPRLEIGVGTGRFADLL---GVRFG 70

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
             P+    T    +     A      +P        VLM   L F  DP  +  E  R+L
Sbjct: 71  LDPSRDALTFARRRG-VLVANAVGEAVPFVSRHFGAVLMAFTLCFVTDPAAIFRETRRLL 129

Query: 123 TSGGRMIVVVPNKRGMWA-----RMEHTPFGS--GQPYSWYQMISLLREANFTLSITSRS 175
             GG +++    +   WA     R      G    + Y+  ++  LL ++ F +     +
Sbjct: 130 ADGGGLVIGFLPRGTPWADLYALRAARGQPGYRDARFYTAAELEQLLADSGFRVIARRCT 189

Query: 176 LFFPPTHKKCILKLWS 191
           L  PP   +  ++   
Sbjct: 190 LHQPPGLARYDIEAAH 205


>gi|215404191|ref|ZP_03416372.1| hypothetical protein Mtub0_11010 [Mycobacterium tuberculosis
           02_1987]
 gi|215411697|ref|ZP_03420493.1| hypothetical protein Mtub9_10269 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215446215|ref|ZP_03432967.1| hypothetical protein MtubT_09848 [Mycobacterium tuberculosis T85]
 gi|218753720|ref|ZP_03532516.1| hypothetical protein MtubG1_09859 [Mycobacterium tuberculosis GM
           1503]
 gi|254232174|ref|ZP_04925501.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254551025|ref|ZP_05141472.1| hypothetical protein Mtube_11271 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260186977|ref|ZP_05764451.1| hypothetical protein MtubCP_13223 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260205285|ref|ZP_05772776.1| hypothetical protein MtubK8_13377 [Mycobacterium tuberculosis K85]
 gi|294996937|ref|ZP_06802628.1| hypothetical protein Mtub2_21133 [Mycobacterium tuberculosis 210]
 gi|297731565|ref|ZP_06960683.1| hypothetical protein MtubKR_10766 [Mycobacterium tuberculosis KZN
           R506]
 gi|306797846|ref|ZP_07436148.1| hypothetical protein TMFG_03513 [Mycobacterium tuberculosis
           SUMu006]
 gi|306968124|ref|ZP_07480785.1| hypothetical protein TMIG_00662 [Mycobacterium tuberculosis
           SUMu009]
 gi|306972349|ref|ZP_07485010.1| hypothetical protein TMJG_00256 [Mycobacterium tuberculosis
           SUMu010]
 gi|308232001|ref|ZP_07414576.2| hypothetical protein TMAG_02185 [Mycobacterium tuberculosis
           SUMu001]
 gi|308369584|ref|ZP_07418359.2| hypothetical protein TMBG_00543 [Mycobacterium tuberculosis
           SUMu002]
 gi|308370884|ref|ZP_07423092.2| hypothetical protein TMCG_00091 [Mycobacterium tuberculosis
           SUMu003]
 gi|308372112|ref|ZP_07427450.2| hypothetical protein TMDG_02828 [Mycobacterium tuberculosis
           SUMu004]
 gi|308373294|ref|ZP_07431764.2| hypothetical protein TMEG_01901 [Mycobacterium tuberculosis
           SUMu005]
 gi|308375746|ref|ZP_07444968.2| hypothetical protein TMGG_00552 [Mycobacterium tuberculosis
           SUMu007]
 gi|308376884|ref|ZP_07440394.2| hypothetical protein TMHG_01184 [Mycobacterium tuberculosis
           SUMu008]
 gi|308380245|ref|ZP_07489228.2| hypothetical protein TMKG_00258 [Mycobacterium tuberculosis
           SUMu011]
 gi|308403083|ref|ZP_07493746.2| hypothetical protein TMLG_01284 [Mycobacterium tuberculosis
           SUMu012]
 gi|313658898|ref|ZP_07815778.1| hypothetical protein MtubKV_10776 [Mycobacterium tuberculosis KZN
           V2475]
 gi|124601233|gb|EAY60243.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|308215351|gb|EFO74750.1| hypothetical protein TMAG_02185 [Mycobacterium tuberculosis
           SUMu001]
 gi|308327061|gb|EFP15912.1| hypothetical protein TMBG_00543 [Mycobacterium tuberculosis
           SUMu002]
 gi|308330502|gb|EFP19353.1| hypothetical protein TMCG_00091 [Mycobacterium tuberculosis
           SUMu003]
 gi|308334337|gb|EFP23188.1| hypothetical protein TMDG_02828 [Mycobacterium tuberculosis
           SUMu004]
 gi|308338138|gb|EFP26989.1| hypothetical protein TMEG_01901 [Mycobacterium tuberculosis
           SUMu005]
 gi|308341830|gb|EFP30681.1| hypothetical protein TMFG_03513 [Mycobacterium tuberculosis
           SUMu006]
 gi|308345318|gb|EFP34169.1| hypothetical protein TMGG_00552 [Mycobacterium tuberculosis
           SUMu007]
 gi|308349620|gb|EFP38471.1| hypothetical protein TMHG_01184 [Mycobacterium tuberculosis
           SUMu008]
 gi|308354249|gb|EFP43100.1| hypothetical protein TMIG_00662 [Mycobacterium tuberculosis
           SUMu009]
 gi|308358226|gb|EFP47077.1| hypothetical protein TMJG_00256 [Mycobacterium tuberculosis
           SUMu010]
 gi|308362157|gb|EFP51008.1| hypothetical protein TMKG_00258 [Mycobacterium tuberculosis
           SUMu011]
 gi|308365811|gb|EFP54662.1| hypothetical protein TMLG_01284 [Mycobacterium tuberculosis
           SUMu012]
 gi|323719494|gb|EGB28621.1| hypothetical protein TMMG_01268 [Mycobacterium tuberculosis
           CDC1551A]
          Length = 229

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 60/196 (30%), Gaps = 12/196 (6%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            D      +Y S  G+         L     +V     L +G     F+           
Sbjct: 9   RDAAAYDAWYDSPTGRPILATEVAALRPLI-EVFAQPRLEIGVGTGRFADLL---GVRFG 64

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
             P+         +     A      +P        VLM   L F  DP  +  E  R+L
Sbjct: 65  LDPSRDALMFARRRG-VLVANAVGEAVPFVSRHFGAVLMAFTLCFVTDPAAIFRETRRLL 123

Query: 123 TSGGRMIVVVPNKRGMWA-----RMEHTPFGS--GQPYSWYQMISLLREANFTLSITSRS 175
             GG +++    +   WA     R      G    + Y+  ++  LL ++ F +     +
Sbjct: 124 ADGGGLVIGFLPRGTPWADLYALRAARGQPGYRDARFYTAAELEQLLADSGFRVIARRCT 183

Query: 176 LFFPPTHKKCILKLWS 191
           L  PP   +  ++   
Sbjct: 184 LHQPPGLARYDIEAAH 199


>gi|260914300|ref|ZP_05920769.1| metallothionein SmtA [Pasteurella dagmatis ATCC 43325]
 gi|260631401|gb|EEX49583.1| metallothionein SmtA [Pasteurella dagmatis ATCC 43325]
          Length = 238

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 48/254 (18%), Positives = 89/254 (35%), Gaps = 38/254 (14%)

Query: 1   MRVDIV-----EL-RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           MR D        L   +     G+   +A+S      +  + G +LL LG      +   
Sbjct: 1   MRWDAKYTKAMTLPNSWQELHNGEHYCNALSDYFYNWFPKILGNQLLKLG---GLSAEIP 57

Query: 55  GKVERTLAFMPAG---QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDP 111
                T   + +    +    +  Q  +S    +  +LP  ++SV+ V++ + L F++DP
Sbjct: 58  CDCFLTHQILLSPNINERLYTFSKQKNTSVIQANMTDLPFVENSVNGVVLANILHFSQDP 117

Query: 112 FLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS-----GQPYSWYQMISLLREAN 166
             +L E+ RVLT  G + + + N         H           + Y  ++++  L   N
Sbjct: 118 HQILREVERVLTEDGYLFLSLFNPFSSLLFKRHLNSSKQPTLPLRHYLPWRVLDWLSLLN 177

Query: 167 FTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESK 226
           F +    +                   EK    F P       I ARK +Y    +   K
Sbjct: 178 FEILDQQQLGHC---------------EK--TKFFPHL---IAIVARKRVYPLT-LNPQK 216

Query: 227 KKHISSPILVPHTV 240
            +  +  +  P + 
Sbjct: 217 VRFKNQEVFEPVSA 230


>gi|167970469|ref|ZP_02552746.1| hypothetical protein MtubH3_21533 [Mycobacterium tuberculosis
           H37Ra]
          Length = 235

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 60/196 (30%), Gaps = 12/196 (6%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA 62
            D      +Y S  G+         L     +V     L +G     F+           
Sbjct: 15  RDAAAYDAWYDSPTGRPILATEVAALRPLI-EVFAQPRLEIGVGTGRFADLL---GVRFG 70

Query: 63  FMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVL 122
             P+         +     A      +P        VLM   L F  DP  +  E  R+L
Sbjct: 71  LDPSRDALMFARRRG-VLVANAVGEAVPFVSRHFGAVLMAFTLCFVTDPAAIFRETRRLL 129

Query: 123 TSGGRMIVVVPNKRGMWA-----RMEHTPFGS--GQPYSWYQMISLLREANFTLSITSRS 175
             GG +++    +   WA     R      G    + Y+  ++  LL ++ F +     +
Sbjct: 130 ADGGGLVIGFLPRGTPWADLYALRAARGQPGYRDARFYTAAELEQLLADSGFRVIARRCT 189

Query: 176 LFFPPTHKKCILKLWS 191
           L  PP   +  ++   
Sbjct: 190 LHQPPGLARYDIEAAH 205


>gi|257387329|ref|YP_003177102.1| methyltransferase type 11 [Halomicrobium mukohataei DSM 12286]
 gi|257169636|gb|ACV47395.1| Methyltransferase type 11 [Halomicrobium mukohataei DSM 12286]
          Length = 206

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 46/156 (29%), Gaps = 6/156 (3%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV-ERTLAFMPAGQGATNWP----DQ 76
           + +        D      +L +G    F +    +  E       +             +
Sbjct: 31  EEMRDEAIAKLDIEPDDHVLDVGCGTGFATEGLLEATEHVYGLDQSAHQLEKAYAKFGKR 90

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
              +        LP  D + D V     +E+  +P   L E  R+   GGR+++V P+  
Sbjct: 91  GPVAFHRGDAERLPFQDDTFDVVWSSGSIEYWPNPVDALEECRRITKPGGRVLIVGPDYP 150

Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSIT 172
                 +         Y   +   +  +A FT    
Sbjct: 151 SQSVFQKLADAIML-FYDEDEADRMFEDAGFTDFEH 185


>gi|46581770|ref|YP_012578.1| hypothetical protein DVU3369 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601077|ref|YP_965477.1| methyltransferase type 11 [Desulfovibrio vulgaris DP4]
 gi|46451193|gb|AAS97838.1| conserved domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561306|gb|ABM27050.1| Methyltransferase type 11 [Desulfovibrio vulgaris DP4]
 gi|311232329|gb|ADP85183.1| Methyltransferase type 11 [Desulfovibrio vulgaris RCH1]
          Length = 262

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/250 (14%), Positives = 75/250 (30%), Gaps = 17/250 (6%)

Query: 4   DIVELRQFYSSFLGKCTTDAISKVLSTTWD--DVTGCRLLGLGYAIPFFSCFHGK-VERT 60
           D+     +  +  G        ++L          G  LL +G     F  +  +     
Sbjct: 6   DVKSFLDWADTPAGAFALRHERRLLQHLVSGWPRRGHSLLDVGCGPGIFLEYFWESGFDV 65

Query: 61  LAFMPAGQGATNWPDQ--YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
                +         +    +   L    +LP  D++ D V +++ LEF +D   +L E 
Sbjct: 66  TGLDASPDMLAAARSRLGPRADFHLGVGDHLPFEDNAFDYVTLLNVLEFVDDAAAVLAEA 125

Query: 119 WRVLTSG---GRMIVVVPNKRGM--WARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           +RV   G     +    P             +     +  S  +M+ L+R+     ++T 
Sbjct: 126 FRVAARGVLVAVLNRWSPYYLSHGVPMPGSSSRLRQARWRSLPEMLRLVRQGCGGCAVTW 185

Query: 174 RSLFFPPTHKKCILKLWSVFEKIGNI--FGPGFAGIYVIEA-RKILYQGLPITESKKKHI 230
           R++   P+              + N       F     +           P+  + +K  
Sbjct: 186 RTVLHAPSCT----WREGTLFNLCNRGIALNPFGAYLALRVDTGRGLPVTPLLLTTRKTA 241

Query: 231 SSPILVPHTV 240
              +  P  V
Sbjct: 242 PMRVCPPTVV 251


>gi|315647581|ref|ZP_07900683.1| Methyltransferase type 11 [Paenibacillus vortex V453]
 gi|315277020|gb|EFU40361.1| Methyltransferase type 11 [Paenibacillus vortex V453]
          Length = 244

 Score = 77.1 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/245 (15%), Positives = 72/245 (29%), Gaps = 34/245 (13%)

Query: 1   MRVDIVELRQFYS--SFLGKCTTDA----ISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M  +I +  +F+   S L +             L +   D+TG  +L LG    +FS + 
Sbjct: 3   MTQNIYDNDEFFKGYSQLSRSVHGLDGAPEWSSLRSMLPDLTGAHVLDLGCGFGWFSRWA 62

Query: 55  GKVE--RTLAFMPAGQGATNWPDQ---YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
            +    + L    +    T    +      +        L L   S D V       + +
Sbjct: 63  RQHGATKVLGVDVSENMLTRGRAETQDSHITYIRADMEVLELEPESYDLVYSSLAFHYIK 122

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNK---------RGMWARMEHTPFGSGQPYSWYQMIS 160
           +   ++ E++  L  G  ++  V +                  +T       Y   +  +
Sbjct: 123 NLSGLMGEVYSSLKPGASLVCSVEHPIYTASIRPEWIQHPNGHNTWPVDNYQYEGMRTTN 182

Query: 161 LLREANFTLSITSRSLFFPPTHKKCILKLWSVF----EKIGNI-------FGPGFAGIYV 209
            L E       T  +           +     +    E+I +          P F    +
Sbjct: 183 WLAEGVVKQHRTMGTYLNMMIGLGFTITHVEDWGPSDEQIMSHPEWEEECHRPMF---LL 239

Query: 210 IEARK 214
           I ARK
Sbjct: 240 ISARK 244


>gi|281354849|ref|ZP_06241343.1| Methyltransferase type 11 [Victivallis vadensis ATCC BAA-548]
 gi|281317729|gb|EFB01749.1| Methyltransferase type 11 [Victivallis vadensis ATCC BAA-548]
          Length = 242

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/166 (21%), Positives = 61/166 (36%), Gaps = 16/166 (9%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAG 67
           L  FY S  G      I++++     ++ G R+L +G     +          +      
Sbjct: 23  LNHFYFSRHG------IARMMEKLAPELEG-RILDVGCGTRPYEKLFTACTGYVGVEIDT 75

Query: 68  QGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
             A        ++        LP    + D V++   LE   +P  +L E+ RVL  GGR
Sbjct: 76  PAARQAG----NADYFYDGQTLPFDSETFDGVVLNEVLEHVFNPEELLTELRRVLRPGGR 131

Query: 128 MIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           +I+ VP        +EH        Y+ + + +LL    F +    
Sbjct: 132 IILTVPFAW-----IEHEKPFDYARYTSFGLKALLERNGFAVLRQE 172


>gi|300709747|ref|YP_003735561.1| Methyltransferase type 11 [Halalkalicoccus jeotgali B3]
 gi|299123430|gb|ADJ13769.1| Methyltransferase type 11 [Halalkalicoccus jeotgali B3]
          Length = 206

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 48/157 (30%), Gaps = 6/157 (3%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWP----DQ 76
           + +     +  D     R+L +G    F +       E       +              
Sbjct: 31  EQMRGQALSMLDIDPDDRVLDVGCGTGFATEGLLEHAEDVHGLDQSPHQLEKAWAKLGKH 90

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
              S  L     LP AD S D V     +E+  DP   L EI R+   GG ++VV PN  
Sbjct: 91  DPVSFYLGDAERLPFADDSFDVVWSSGSIEYWPDPVAALREIKRITAPGGEVLVVGPNYP 150

Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
                M+         Y   +   +  EA F      
Sbjct: 151 -KSGLMQKVADSIMLFYDAEEADRMFAEAGFEDVEHR 186


>gi|16127123|ref|NP_421687.1| hypothetical protein CC_2891 [Caulobacter crescentus CB15]
 gi|221235921|ref|YP_002518358.1| methyltransferase [Caulobacter crescentus NA1000]
 gi|13424509|gb|AAK24855.1| hypothetical protein CC_2891 [Caulobacter crescentus CB15]
 gi|220965094|gb|ACL96450.1| methyltransferase [Caulobacter crescentus NA1000]
          Length = 241

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 49/157 (31%), Gaps = 2/157 (1%)

Query: 21  TDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSS 80
              I + L        G ++L +G                 A  P  +       +   +
Sbjct: 22  RRQILRGLLRRIGTPAGAKILEVGCGAGGNVPLLRDFGAVTALEPDDESRAYASQRLGLA 81

Query: 81  TALVSEGN-LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
                  + LP A  S D V     +E  +D    +  + R++  GG ++  VP  + MW
Sbjct: 82  VDTGLLPDGLPYAPESFDLVCAFDVVEHVDDDAASVQALARLVKPGGAILTTVPAYQWMW 141

Query: 140 ARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSL 176
           +  +       + Y      +L   A  T+   +   
Sbjct: 142 SHHDVLH-HHKRRYRLPAYRALFEAAGLTIETATYFN 177


>gi|239939458|ref|ZP_04691395.1| putative methyltransferase [Streptomyces roseosporus NRRL 15998]
 gi|239985946|ref|ZP_04706610.1| putative methyltransferase [Streptomyces roseosporus NRRL 11379]
 gi|291442888|ref|ZP_06582278.1| ubiE/COQ5 methyltransferase family protein [Streptomyces
           roseosporus NRRL 15998]
 gi|291345835|gb|EFE72739.1| ubiE/COQ5 methyltransferase family protein [Streptomyces
           roseosporus NRRL 15998]
          Length = 241

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 78/241 (32%), Gaps = 43/241 (17%)

Query: 8   LRQFYSSFL-------GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK--VE 58
           LR FY +         G+    A  ++L+    D  G  +L +G      +         
Sbjct: 11  LRDFYENPSVPVASGDGRTLRQA--RLLADAL-DAPGQVILDIGCGDGTAAATAAPFLAG 67

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGN--LPLADSSVDCVLMVHYLEFAEDPFLMLH 116
             L  +   Q A                 +  LPLAD   D VL    LE   DP   L 
Sbjct: 68  HRLIGVDWSQDALRRARPRMGHVVRGELEHGGLPLADGCADAVLFSEILEHLVDPDQALD 127

Query: 117 EIWRVLTSGGRMIVVVPN----------------------KRGMWARMEHTPFGSGQPYS 154
           E+ RVL  GG +++  PN                       RG+  R      G  + Y+
Sbjct: 128 ELRRVLRPGGHLMLSTPNLAAWYNRALLLAGVQPVFSEVSLRGIHGRPGSEVVGHLRLYT 187

Query: 155 WYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
              + S L  + FT      + F        + +   + ++      PG + I +  AR+
Sbjct: 188 ARALRSFLTASGFTDVTIKGAPFH------GVPRPLRLLDRAACAV-PGASSILLAHARR 240

Query: 215 I 215
            
Sbjct: 241 R 241


>gi|310827304|ref|YP_003959661.1| hypothetical protein ELI_1712 [Eubacterium limosum KIST612]
 gi|308739038|gb|ADO36698.1| hypothetical protein ELI_1712 [Eubacterium limosum KIST612]
          Length = 206

 Score = 76.7 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 51/172 (29%), Gaps = 11/172 (6%)

Query: 12  YS-SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV--ERTLAFMPAGQ 68
           Y  S  GK     +   +     D+    +L LG           K           +  
Sbjct: 22  YDKSHDGKFVQ-CMYDTIVNRVLDLNPKTILDLGCGNGNIIARLQKRLNADYYGLDISEA 80

Query: 69  GATNWPDQ-YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127
                  +       +     LP  D+  D ++          P  ++ EI RVL   G 
Sbjct: 81  MIAQAEKRLLNVHFMVGDAEKLPYEDNKFDAIVCNASFHHYPHPKAVIREIQRVLKKDGT 140

Query: 128 MIVVVPNKRGM------WARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
           +I+  P            + M H+  G    Y   ++I LL +  F +   +
Sbjct: 141 LILGDPTVPFKLLTGFLNSTMAHSNSGDHHIYHKSEIIDLLSQEGFQVYGWA 192


>gi|254386875|ref|ZP_05002162.1| methyltransferase [Streptomyces sp. Mg1]
 gi|194345707|gb|EDX26673.1| methyltransferase [Streptomyces sp. Mg1]
          Length = 245

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 60/186 (32%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 7   SRFPLAAGDRVLDLGCGAGRHAFECYRRGAQVVAVDRNGEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   ++I  +  A      T  +           LK 
Sbjct: 127 GPEKICWALSDAYHEVEGGHIRIYKADELIGKMEAAGLKPYGTHHA--HGLHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|169630445|ref|YP_001704094.1| hypothetical protein MAB_3364 [Mycobacterium abscessus ATCC 19977]
 gi|169242412|emb|CAM63440.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 273

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/169 (18%), Positives = 58/169 (34%), Gaps = 8/169 (4%)

Query: 19  CTTDAI--SKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAFMPAGQGATNWPD 75
                    + LS+      G R+L  G    + +    +  +  +          +   
Sbjct: 45  WFRRHEVVYERLSSLCA---GRRVLEAGSGEGYGADMLAQVAQHVIGLDYDESAIAHVKA 101

Query: 76  QYFSSTALV-SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
           +Y        +  +LPLAD SVD V+    +E   D    + E  RVL  GG +++  PN
Sbjct: 102 RYPRVDMRAGNLADLPLADGSVDVVVNFQVIEHLWDQGQFIRECARVLRPGGSLLISTPN 161

Query: 135 KRGMWARMEH-TPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           +       +        +  +  ++  LL E  F+L   +     P   
Sbjct: 162 RITFSPGRDTPLNPFHTRELNGAELTELLEENGFSLESMNGVFHGPRLR 210


>gi|219855372|ref|YP_002472494.1| hypothetical protein CKR_2029 [Clostridium kluyveri NBRC 12016]
 gi|219569096|dbj|BAH07080.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 206

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 57/188 (30%), Gaps = 15/188 (7%)

Query: 1   MRVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M  D         +     +   D I K +           LL +G           + +
Sbjct: 14  MNFDKQAENYDDGFDGRFVRVMYDEIIKRIDKF----QNGILLDVGCGTGNILSRLYENK 69

Query: 59  --RTLAFMPAGQGATNWPDQYFSSTA--LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLM 114
                    + +                +     +P  D++ D +L         +P  +
Sbjct: 70  KLHLCGLDISNKMIEVARRNLNDDILLKVGDAEFIPWPDNTFDIILCNASFHHYPNPQKV 129

Query: 115 LHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ-----PYSWYQMISLLREANFTL 169
           L E+ RV+ + G++I+  P    +  ++ +  FG         YS  +M  LLR   F  
Sbjct: 130 LLEMKRVVKADGKLIIGDPTAPPLIRQVLNFIFGICHNGDYKIYSLKEMKKLLRRCGFRP 189

Query: 170 SITSRSLF 177
               +  +
Sbjct: 190 FEFKKINY 197


>gi|153954925|ref|YP_001395690.1| methyltransferase [Clostridium kluyveri DSM 555]
 gi|146347783|gb|EDK34319.1| Predicted methyltransferase [Clostridium kluyveri DSM 555]
          Length = 205

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 57/188 (30%), Gaps = 15/188 (7%)

Query: 1   MRVD--IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE 58
           M  D         +     +   D I K +           LL +G           + +
Sbjct: 13  MNFDKQAENYDDGFDGRFVRVMYDEIIKRIDKF----QNGILLDVGCGTGNILSRLYENK 68

Query: 59  --RTLAFMPAGQGATNWPDQYFSSTA--LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLM 114
                    + +                +     +P  D++ D +L         +P  +
Sbjct: 69  KLHLCGLDISNKMIEVARRNLNDDILLKVGDAEFIPWPDNTFDIILCNASFHHYPNPQKV 128

Query: 115 LHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ-----PYSWYQMISLLREANFTL 169
           L E+ RV+ + G++I+  P    +  ++ +  FG         YS  +M  LLR   F  
Sbjct: 129 LLEMKRVVKADGKLIIGDPTAPPLIRQVLNFIFGICHNGDYKIYSLKEMKKLLRRCGFRP 188

Query: 170 SITSRSLF 177
               +  +
Sbjct: 189 FEFKKINY 196


>gi|297154199|gb|ADI03911.1| C5-O-methyltransferase [Streptomyces bingchenggensis BCW-1]
          Length = 286

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 49/147 (33%), Gaps = 10/147 (6%)

Query: 14  SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA---------FM 64
           S LG    D ++  L     DV G R+L +G      +    +   T             
Sbjct: 44  SPLG-VAADRLTDHLIGKLGDVAGRRVLDVGCGSGRPTVRLAQRAPTEVVGVTVSPVQIE 102

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            A   A                  LP  ++S D V  +  +     P  +L EI RVL  
Sbjct: 103 RATALAEREGVADRVRFVRADAMTLPFPEASFDAVWALECMFHMPSPAQVLREIARVLRP 162

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQ 151
           GGR+ V+    R   AR +      G+
Sbjct: 163 GGRLAVMDVVLREPIARRDRGAVERGR 189


>gi|254392168|ref|ZP_05007356.1| methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|294812384|ref|ZP_06771027.1| Methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|326440784|ref|ZP_08215518.1| putative methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|197705843|gb|EDY51655.1| methyltransferase [Streptomyces clavuligerus ATCC 27064]
 gi|294324983|gb|EFG06626.1| Methyltransferase [Streptomyces clavuligerus ATCC 27064]
          Length = 243

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/186 (22%), Positives = 66/186 (35%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMP-------------AGQGATNWPD 75
           + +    G R+L LG      +   + +  R +A                A + A   P+
Sbjct: 7   SRFPLAAGDRVLDLGCGAGRHAFECYRRGARVVALDRNGDEIREVATWFAAMKEAGEAPE 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++       NLP  D S D V++   LE   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALNLPFPDDSFDVVIISEVLEHIHDDKGVLAEMVRVLKPGGRIAVTVPRH 126

Query: 136 ---RGMWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
              R  WA  +       G  + Y   ++++ + EA      T  +           LK 
Sbjct: 127 GPERICWALSDAYHEVEGGHIRIYKADELLARIEEAGLVPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|302545869|ref|ZP_07298211.1| methyltransferase type 11 [Streptomyces hygroscopicus ATCC 53653]
 gi|302463487|gb|EFL26580.1| methyltransferase type 11 [Streptomyces himastatinicus ATCC 53653]
          Length = 245

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  R +A    G+                  P 
Sbjct: 7   SRFPLAAGDRVLDLGCGAGRHAFECYRRGARVVALDRNGEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 WA  +       G  + Y   +++  +REA      T  +           LK 
Sbjct: 127 GPEKVCWALSDAYHEVEGGHIRIYRGDELLERMREAGLRPYGTHHA--HGLHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|197337515|ref|YP_002158416.1| biotin biosynthesis protein BioC [Vibrio fischeri MJ11]
 gi|197314767|gb|ACH64216.1| biotin biosynthesis protein BioC [Vibrio fischeri MJ11]
          Length = 273

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 47/129 (36%), Gaps = 5/129 (3%)

Query: 20  TTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQY 77
               ++  L +    D+TG R+L +G    +       +  R +AF  +        ++ 
Sbjct: 39  FQRQVADTLLSYLPTDLTGLRILDVGCGTGYCCEALLKRGARVVAFDLSSVMLEKAKERC 98

Query: 78  FSS---TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
                        +LP  D   D V+    L++ +D  + L E+ R+  +  ++I     
Sbjct: 99  GDHNITYIQGDAEDLPFMDDEFDGVVSSLALQWCQDLSVPLREMRRISHNKSKVIFSTLL 158

Query: 135 KRGMWARME 143
              ++   +
Sbjct: 159 DGSLFELKK 167


>gi|163792788|ref|ZP_02186765.1| hypothetical protein BAL199_18113 [alpha proteobacterium BAL199]
 gi|159182493|gb|EDP67002.1| hypothetical protein BAL199_18113 [alpha proteobacterium BAL199]
          Length = 245

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 55/184 (29%), Gaps = 20/184 (10%)

Query: 1   MRVDIVELRQFYS--SFLGK----CTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M  +I +  +F++  S LG+        A    L     ++ G  ++ LG    +F  + 
Sbjct: 1   MTQNIYDNAEFFAGYSQLGRSVGGLAAAAEWPALWAMLPEMRGLTVVDLGCGFGWFCRWA 60

Query: 55  GKVE--RTLAFMPAGQGATNWPDQYFSSTA---LVSEGNLPLADSSVDCVLMVHYLEFAE 109
            +    + L    +         +   +           L L  ++ D       L +  
Sbjct: 61  REQGATQVLGLDVSENMLGRARAETSDTAIVYERADMERLVLPATTFDLAYSSLVLHYVA 120

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNK---------RGMWARMEHTPFGSGQPYSWYQMIS 160
           D   +  E+ R L  GG  +  + +            + A    T           +  +
Sbjct: 121 DLGRLFAEVRRGLAPGGAFVFSIEHPIYMAPTAPGWSVDATGRKTWPVDRYLVEGPRTTN 180

Query: 161 LLRE 164
            L E
Sbjct: 181 WLAE 184


>gi|258651859|ref|YP_003201015.1| type 11 methyltransferase [Nakamurella multipartita DSM 44233]
 gi|258555084|gb|ACV78026.1| Methyltransferase type 11 [Nakamurella multipartita DSM 44233]
          Length = 252

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 56/144 (38%), Gaps = 7/144 (4%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV--- 57
           M  D+    Q Y +F+G+ + + ++  L+   + V G R L +G      +    +    
Sbjct: 1   MSFDVA--AQAYGAFMGRYS-EPLADRLADLLEPVPGARALDVGCGPGALTARLVERLGP 57

Query: 58  ERTLAFMPAGQGATNWPDQYFSSTAL-VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLH 116
           ++  A  P+        D++            LP  D+S D       + F  DP   L 
Sbjct: 58  DQVCAIDPSAPFVAAARDRFPGLDVRSGRAEELPWPDASFDLAAASLVVHFMRDPVAGLG 117

Query: 117 EIWRVLTSGGRMIVVVPNKRGMWA 140
           E+ RV+ +GG +   V +  G   
Sbjct: 118 EMGRVVRAGGTVAATVWDHAGERG 141


>gi|261252564|ref|ZP_05945137.1| biotin synthesis protein BioC [Vibrio orientalis CIP 102891]
 gi|260935955|gb|EEX91944.1| biotin synthesis protein BioC [Vibrio orientalis CIP 102891]
          Length = 267

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/181 (15%), Positives = 53/181 (29%), Gaps = 10/181 (5%)

Query: 19  CTTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSCF-HGKVERTLAFMPAGQGATNWPDQ 76
                + + L      D+TG  +L +G    +FS     +    + F  + Q       +
Sbjct: 34  AFQRDVGERLLAKMPQDLTGKTVLDVGCGTGYFSFELLKRGAHVICFDLSEQMLDAAQSR 93

Query: 77  YFSSTA---LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
             S            LP   +SVD V     L++ +D  + + EI RV+   G   +   
Sbjct: 94  CGSDHVTYQQGDAEKLPFETNSVDYVFSSLALQWCQDLSVPMREIRRVVKPQGSAYLSTL 153

Query: 134 NKRG----MWARMEHTPFGSGQ-PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
                     +  +   +       S  Q+   L ++         +           L 
Sbjct: 154 LDGSLNELKQSWAKIDSYQHVNEFISANQVKIALAQSECHEHQLDLAAITVWYDTAFALM 213

Query: 189 L 189
            
Sbjct: 214 R 214


>gi|325577980|ref|ZP_08148174.1| metallothionein SmtA [Haemophilus parainfluenzae ATCC 33392]
 gi|325160213|gb|EGC72341.1| metallothionein SmtA [Haemophilus parainfluenzae ATCC 33392]
          Length = 238

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 72/232 (31%), Gaps = 21/232 (9%)

Query: 9   RQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQ 68
             + +   G+   + ++   +     + G ++L +G      +     +   +       
Sbjct: 21  ESWQALPQGEAYCNVLTHYFAQWTPKILGYQILKVGALSGEIAFDLP-LRHQIVLAEKTA 79

Query: 69  GATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRM 128
             +        S    S   LP  +  +D  L+ + L FA+DP  +L E  RVL   G +
Sbjct: 80  YFSTALLNESDSLIQASPLALPFIEKEMDACLLANTLNFAQDPHQILREAHRVLKDDGWI 139

Query: 129 IVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
            + + N                + Y+ +++I  L   NF +    R              
Sbjct: 140 FITLFNPMSPLLFKPKLGDFKFRQYATWRVIDWLSLLNFDVIAEERLSIKQEKTT----- 194

Query: 189 LWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISSPILVPHTV 240
                           + + VI A+K  Y      E  +  + +  L P   
Sbjct: 195 --------------LCSPLTVIIAQKRTYPLTLNPEKARSKMPA-FLEPAGA 231


>gi|254679736|gb|ACL79581.2| C5-O-methyltransferase [Streptomyces bingchenggensis]
          Length = 281

 Score = 76.7 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 49/147 (33%), Gaps = 10/147 (6%)

Query: 14  SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLA---------FM 64
           S LG    D ++  L     DV G R+L +G      +    +   T             
Sbjct: 44  SPLG-VAADRLTDHLIGKLGDVAGRRVLDVGCGSGRPTVRLAQRAPTEVVGVTVSPVQIE 102

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            A   A                  LP  ++S D V  +  +     P  +L EI RVL  
Sbjct: 103 RATALAEREGVADRVRFVRADAMTLPFPEASFDAVWALECMFHMPSPAQVLREIARVLRP 162

Query: 125 GGRMIVVVPNKRGMWARMEHTPFGSGQ 151
           GGR+ V+    R   AR +      G+
Sbjct: 163 GGRLAVMDVVLREPIARRDRGAVERGR 189


>gi|327399550|ref|YP_004340419.1| type 11 methyltransferase [Hippea maritima DSM 10411]
 gi|327182179|gb|AEA34360.1| Methyltransferase type 11 [Hippea maritima DSM 10411]
          Length = 316

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 79/224 (35%), Gaps = 27/224 (12%)

Query: 2   RVDIVE-----LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK 56
            +D+ E       +++  +      ++  K+L          R L +G     F+     
Sbjct: 109 NIDVFEECTEKYEEWFDKY--SAIYESELKMLKAIIPKF--ERALEIGVGSGRFAAPL-- 162

Query: 57  VERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLH 116
                   P+ + A     +           NLP  D   D +L+   + F +DP   L 
Sbjct: 163 -GIKEGIEPSEKMAQIAKQRG-IKVYPGFAENLPFMDEEYDFILIAVTICFVKDPKKTLK 220

Query: 117 EIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSW------YQMISLLREANFTLS 170
           E +RVL  GG+++V + ++     +        G+ Y +       ++  +L+E  F   
Sbjct: 221 EAYRVLKKGGKIVVAIVDRASEIGKEYLNKKEKGRFYKYVTFFSAEELQDILKETGFEAE 280

Query: 171 ITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
            T ++LF     +  I    S  E  G        G   + A+K
Sbjct: 281 NTYQTLFGKSIKE--INSPQSFKEGYGE------GGFVAVVAKK 316


>gi|197284135|ref|YP_002150007.1| hypothetical protein PMI0226 [Proteus mirabilis HI4320]
 gi|194681622|emb|CAR40648.1| conserved hypothetical protein [Proteus mirabilis HI4320]
          Length = 211

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 67/216 (31%), Gaps = 26/216 (12%)

Query: 23  AISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSSTA 82
           AI   L   W  + G  +L LG            V   +          N      ++  
Sbjct: 2   AIELRLQNWWPKIYGFHMLKLGQLSAELDTKSSMVSHQV----------NVTTTTTNTDV 51

Query: 83  LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG----- 137
           + S   LP  + SVD  LM H L+++ DP  +L E  RVL   G +I+   N        
Sbjct: 52  MASLNYLPFENKSVDVCLMAHVLDYSADPHWLLREADRVLVDDGWIILSSFNPISLLGIG 111

Query: 138 -MWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKI 196
                + H      + +S  + +  L   N+ +         P              ++ 
Sbjct: 112 KCTPILRHKQPYYCRMFSLRRQVDWLSVLNYEVITQQNFQIMP---------FSRPVKRD 162

Query: 197 GNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
           G  +      + +I ARK      P          S
Sbjct: 163 GKRY-HVGGCLNLILARKRTLPLTPTAMKFALPRMS 197


>gi|118617517|ref|YP_905849.1| hypothetical protein MUL_1921 [Mycobacterium ulcerans Agy99]
 gi|183981697|ref|YP_001849988.1| hypothetical protein MMAR_1683 [Mycobacterium marinum M]
 gi|118569627|gb|ABL04378.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99]
 gi|183175023|gb|ACC40133.1| conserved hypothetical protein [Mycobacterium marinum M]
          Length = 272

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 51/157 (32%), Gaps = 3/157 (1%)

Query: 29  STTWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAFMPAGQGATNWPDQYFSSTAL-VSE 86
                   G  +L  G    + +        R +A         +   +Y     +  + 
Sbjct: 50  ERLAPRCEGRDVLEAGCGEGYGADMIADVARRVVAVDYDEAAVAHVRHRYPRVEVMQANL 109

Query: 87  GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT- 145
            +LPL D+S+D V+    +E   D    + E  RVL   G ++V  PN+       +   
Sbjct: 110 ADLPLPDASMDVVVNFQVIEHLWDQGQFVRECARVLRPSGVLMVSTPNRITFSPGRDTPI 169

Query: 146 PFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
                +  +  ++  LL EA F           P   
Sbjct: 170 NPFHTRELNAAELTELLLEAGFAEVTMYGLFHGPQLR 206


>gi|291439943|ref|ZP_06579333.1| methyltransferase [Streptomyces ghanaensis ATCC 14672]
 gi|291342838|gb|EFE69794.1| methyltransferase [Streptomyces ghanaensis ATCC 14672]
          Length = 248

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDRNGEEIREVAQWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 67  GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 W   +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYRADELLAKIREAGLRPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|116625356|ref|YP_827512.1| type 11 methyltransferase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228518|gb|ABJ87227.1| Methyltransferase type 11 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 314

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 47/143 (32%), Gaps = 7/143 (4%)

Query: 40  LLGLGYAIPFFS-CFHGKVERTLAFMPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDC 98
           LL +G     F      +  R +    + + A     +      +      PL   S+  
Sbjct: 101 LLDIGCGGGLFLGMMRERGFRVVGLDNSREAAGIAWRRQQVPAVVADTERAPLRAGSLAG 160

Query: 99  VLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT------PFGSGQP 152
           + M H +E   DP   L     +L   GR++V VPN     AR+  +             
Sbjct: 161 LTMFHVMEHLYDPRAYLRAARELLAPDGRLVVQVPNAASWQARLLGSAWNGADVPRHLYD 220

Query: 153 YSWYQMISLLREANFTLSITSRS 175
           +    ++ +L  A F +      
Sbjct: 221 FRDRDLVKILEAAGFEVLRRKYF 243


>gi|182440257|ref|YP_001827976.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468773|dbj|BAG23293.1| putative methyltransferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 241

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 77/241 (31%), Gaps = 43/241 (17%)

Query: 8   LRQFYSSFL-------GKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGK--VE 58
           LR FY +         G+    A  ++L+       G  +L +G      +         
Sbjct: 11  LRDFYENPAVPVASGDGRTLRQA--RLLADALG-APGQVILDVGCGDGTAAATAAPILAG 67

Query: 59  RTLAFMPAGQGATNWPDQYFSSTALVSEGN--LPLADSSVDCVLMVHYLEFAEDPFLMLH 116
             L  +   Q A                 +  LPLAD   D VL    LE   DP   L 
Sbjct: 68  HRLIGVDWSQDALRRARPRMGHVVRGELEHGGLPLADGCADAVLFSEILEHLVDPDQALD 127

Query: 117 EIWRVLTSGGRMIVVVPN----------------------KRGMWARMEHTPFGSGQPYS 154
           E+ RVL  GG +++  PN                       RG+  R      G  + Y+
Sbjct: 128 ELRRVLRPGGHLMLSTPNLAAWYNRALLLAGVQPVFSEVSLRGIHGRPGSEVVGHLRLYT 187

Query: 155 WYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARK 214
              + S L  + F     + + F        + +   + ++      PG A I +  AR+
Sbjct: 188 ARALRSFLAASGFDDVRITGAPFH------GVPRPLRLLDRAACSV-PGAASILLAHARR 240

Query: 215 I 215
            
Sbjct: 241 R 241


>gi|119513359|ref|ZP_01632394.1| hypothetical protein N9414_05884 [Nodularia spumigena CCY9414]
 gi|119461999|gb|EAW43001.1| hypothetical protein N9414_05884 [Nodularia spumigena CCY9414]
          Length = 216

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 64/189 (33%), Gaps = 15/189 (7%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGC-RLLGLGYAIPFFSCFH---GKVERTLA 62
           ++   Y           +S  +   W ++     +L +G     F          +    
Sbjct: 12  QIADLYDQRWNTYIAKTLS--IFKIWAEIAPEATVLDIGCGTGEFEQLLLTENPQQMMTG 69

Query: 63  FMPAGQGATNWPDQY----FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEI 118
              +         +       S    S  NLP A++S D ++      + +DP   L EI
Sbjct: 70  VDISEAMLLVAKQKCRTYSHVSFQNASVLNLPFANNSFDVIVSASAFHYFDDPNAALIEI 129

Query: 119 WRVLTSGGRMIVVVPNKRGMWARM-----EHTPFGSGQPYSWYQMISLLREANFTLSITS 173
            RVL   G++ ++   K  +  ++     +       Q Y+  ++ SLL  A F +  T+
Sbjct: 130 RRVLKPEGKVFILDWCKDYLSCQICDFILKFVDPAYKQCYTQKELHSLLTSAQFDIERTT 189

Query: 174 RSLFFPPTH 182
           +  F     
Sbjct: 190 KFRFSLVWG 198


>gi|315634013|ref|ZP_07889302.1| metallothionein SmtA [Aggregatibacter segnis ATCC 33393]
 gi|315477263|gb|EFU68006.1| metallothionein SmtA [Aggregatibacter segnis ATCC 33393]
          Length = 232

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 69/222 (31%), Gaps = 20/222 (9%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +     G+   +A++   +  +  + G ++L +G       C      +        +  
Sbjct: 17  WQQLPNGRAYCNALNAYFAPWFTKICGYQILKIGGLSAEIQCDLPLRHQISLSEKIAENL 76

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
           T   D + S         LP     +D  ++ + L F +DP  +L E  RVL   G + +
Sbjct: 77  TVLLDDHHSV-VQAKLTELPFIQQQLDACVLANTLNFVQDPHQVLRETHRVLNDDGYLFL 135

Query: 131 VVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
            + N                + Y  +++I  L   NF +           T         
Sbjct: 136 SLFNPLNGLFFKSKMGDFPARHYCIWRIIDWLELLNFDILEQRNLALSHQTAG------- 188

Query: 191 SVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
                        FA + VI  +K  Y      +  +  I +
Sbjct: 189 ------------WFAPLTVIVTQKRTYPLTLNPQKVRSKIPA 218


>gi|239931572|ref|ZP_04688525.1| glycosyl transferase [Streptomyces ghanaensis ATCC 14672]
          Length = 731

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 490 SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDRNGEEIREVAQWFAAMKEAGEAPA 549

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ + VP  
Sbjct: 550 GATATAMEGDALALPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAITVPRY 609

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 W   +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 610 GPEKVCWTLSDAYHEVEGGHIRIYRADELLAKIREAGLRPYGTHHA--HALHSPYWWLKC 667

Query: 190 WSVFEK 195
               + 
Sbjct: 668 AFGVDN 673


>gi|222111383|ref|YP_002553647.1| type 11 methyltransferase [Acidovorax ebreus TPSY]
 gi|330825942|ref|YP_004389245.1| type 11 methyltransferase [Alicycliphilus denitrificans K601]
 gi|221730827|gb|ACM33647.1| Methyltransferase type 11 [Acidovorax ebreus TPSY]
 gi|329311314|gb|AEB85729.1| Methyltransferase type 11 [Alicycliphilus denitrificans K601]
          Length = 219

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 70/223 (31%), Gaps = 12/223 (5%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER--T 60
           ++  E   +Y S  G+    A  +++ +        +LL +G    +F+       R   
Sbjct: 1   MNPTEYDAWYDSPRGRWIGQAEYRLMWSGLGCPAAGQLLDVGCGTGWFTRRLAAQSRLQV 60

Query: 61  LAFMPAGQGATNWPDQYFSSTA-LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
                  +       Q   ST        LP  D+S D V+ +  L F  D    + E+ 
Sbjct: 61  TGIDLDAESLAFARSQDPVSTYRQADALALPFVDASFDHVVSMAALCFTADWRQAVSEMV 120

Query: 120 RVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQ---PYSWYQMISLLREANFTLSITSRSL 176
           RV      + ++  +      +      G+ +     S  +        +        ++
Sbjct: 121 RVTRQRFAIGLLNRHSLLWIDKGRLGGSGAYRGALWLSPAEFRQAFSGLSVANLCLQSAV 180

Query: 177 FFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQG 219
           +FP            + E++     P   G  V+   K +  G
Sbjct: 181 YFP-----SGRWPARLMEQLIPGGLP-LGGFMVVSGSKTVRAG 217


>gi|330722068|gb|EGG99985.1| Biotin synthesis protein bioC [gamma proteobacterium IMCC2047]
          Length = 268

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 55/171 (32%), Gaps = 11/171 (6%)

Query: 19  CTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV---ERTLAFMPAGQGATNWPD 75
                ++  L +   D +   ++ LG      +    +    ER      A    T    
Sbjct: 33  ALQRQVADTLLSRVPDRSFANVVDLGCGTGVVAAQLAQRAGTERIFGLDIAEGMLTFARH 92

Query: 76  QYFS---STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG--GRMIV 130
           QY             NLPL   SVD V     +++ +D   +  EI RVL  G    +  
Sbjct: 93  QYPQSKLHWCGADAENLPLKSESVDLVFSSLAVQWCDDFNRVCEEIQRVLKPGGYCLLAT 152

Query: 131 VVPNKRGMWARMEHTPFG--SGQPYSWYQMISL-LREANFTLSITSRSLFF 178
           + P       R      G     P++    +   +REA F +     ++  
Sbjct: 153 LGPETLYELRRAWQQVDGYVHVNPFTNADFVQQAVREAGFQVENWQETIVM 203


>gi|222100176|ref|YP_002534744.1| Ubiquinone/menaquinone biosynthesis methyltransferase-related
           protein [Thermotoga neapolitana DSM 4359]
 gi|221572566|gb|ACM23378.1| Ubiquinone/menaquinone biosynthesis methyltransferase-related
           protein [Thermotoga neapolitana DSM 4359]
          Length = 258

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 47/159 (29%), Gaps = 6/159 (3%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIP-FFSCFHGKVERTLAF 63
             E    Y +   +     I   LS        CR+L LG     +      +       
Sbjct: 13  AKEYDSMYETPKWRLYHRLIQSFLSEHL--KVPCRVLDLGGGTGRWSLFLLERGFDVTLV 70

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMV-HYLEFAEDPFLMLHEIWRVL 122
            P+ +       +           +LP +  S D VL +   L + E+      EI RVL
Sbjct: 71  DPSEEMLKIAEKKGVKKFLKARAEDLPFSSHSFDTVLAMGDVLSYVENKVKAFSEIARVL 130

Query: 123 TSGGRMIVVV--PNKRGMWARMEHTPFGSGQPYSWYQMI 159
             GG +I  V            E+T     +      + 
Sbjct: 131 KPGGLLIATVDNFYTFLQHMIEENTWEKIPRFLKTQTIE 169


>gi|52696211|pdb|1VLM|A Chain A, Crystal Structure Of Sam-Dependent Methyltransferase,
           Possible Histamine N-Methyltransferase (Tm1293) From
           Thermotoga Maritima At 2.20 A Resolution
 gi|52696212|pdb|1VLM|B Chain B, Crystal Structure Of Sam-Dependent Methyltransferase,
           Possible Histamine N-Methyltransferase (Tm1293) From
           Thermotoga Maritima At 2.20 A Resolution
          Length = 219

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 72/182 (39%), Gaps = 15/182 (8%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFM 64
           + E  +++   + +    +  + +     +  G   + +G     F+         +   
Sbjct: 21  VNEYERWF--LVHRFAYLSELQAVKCLLPEGRG---VEIGVGTGRFAVPLK---IKIGVE 72

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
           P+ + A     +        +  NLPL D S D  L V  + F +DP   L E +R+L  
Sbjct: 73  PSERXAEIARKRG-VFVLKGTAENLPLKDESFDFALXVTTICFVDDPERALKEAYRILKK 131

Query: 125 GGRMIVVVPNKRGMWAR-----MEHTPFG-SGQPYSWYQMISLLREANFTLSITSRSLFF 178
           GG +IV + ++     R      E + F  + + +S  ++  L R+A F      ++LF 
Sbjct: 132 GGYLIVGIVDRESFLGREYEKNKEKSVFYKNARFFSTEELXDLXRKAGFEEFKVVQTLFK 191

Query: 179 PP 180
            P
Sbjct: 192 HP 193


>gi|284164062|ref|YP_003402341.1| methyltransferase type 11 [Haloterrigena turkmenica DSM 5511]
 gi|284013717|gb|ADB59668.1| Methyltransferase type 11 [Haloterrigena turkmenica DSM 5511]
          Length = 240

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 55/184 (29%), Gaps = 21/184 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFF--SCFHGKVERTLAFMPAGQGATNWPDQY---------- 77
                  G R+L +G        +     V   +      +  T   + Y          
Sbjct: 7   DRLTLTPGMRVLDIGCGEGRHVHAAALENVREVVGIDIGRENLTAAREDYEAYIAGETDV 66

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP---N 134
             + A      LP AD S D V     LE   D    L E+ RV   GG + V VP    
Sbjct: 67  PVTFAAGDALRLPFADGSFDVVCCTEVLEHIPDYEAALDELRRVCKPGGTLAVSVPREGP 126

Query: 135 KRGMWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
           +R  WA  E       G  + +   ++ + +    F       +           LK   
Sbjct: 127 ERVCWALSEEYHQVEGGHVRIFDRDELQAAIERRGFRRVDDHFA--HALHAPYWWLKCL- 183

Query: 192 VFEK 195
            +++
Sbjct: 184 WWDR 187


>gi|91226050|ref|ZP_01260977.1| biotin synthesis protein BioC [Vibrio alginolyticus 12G01]
 gi|91189491|gb|EAS75768.1| biotin synthesis protein BioC [Vibrio alginolyticus 12G01]
          Length = 273

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 42/129 (32%), Gaps = 5/129 (3%)

Query: 19  CTTDAISKVLSTTWDD-VTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQ 76
                +   L     + +TG R+L LG    +FS     +    +    +         +
Sbjct: 40  AFQRDVGHQLLDKLPENLTGKRVLDLGCGTGYFSQLLQQRGAEVVCGDISQAMLDKAEQR 99

Query: 77  YFSSTAL---VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
             +           NLP  D S D V     L++  D    L E+ RVL +GG+      
Sbjct: 100 CGAVRMHYQVADAENLPFDDDSFDYVFSSLALQWCTDLSYPLKEVRRVLKNGGKAWFSTL 159

Query: 134 NKRGMWARM 142
               ++   
Sbjct: 160 VDGSLYELR 168


>gi|307353143|ref|YP_003894194.1| type 11 methyltransferase [Methanoplanus petrolearius DSM 11571]
 gi|307156376|gb|ADN35756.1| Methyltransferase type 11 [Methanoplanus petrolearius DSM 11571]
          Length = 239

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 63/216 (29%), Gaps = 17/216 (7%)

Query: 5   IVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS-CFHGKVERTLAF 63
             +    Y +  G+     I   + +        +LL +G     F   +       +  
Sbjct: 12  ADDYDNHYDASNGRDYYSHICDGVISALP--KDGKLLDIGCGTGLFMQRYLKTGREAIGI 69

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT 123
             +         +  S  AL +   LP  + S D V  +    + + P  ML E +RVL 
Sbjct: 70  DISQGMIRRAKTRKVSDVALGTAEVLPFRNESFDAVSSLLAFSYFQHPESMLEESFRVLK 129

Query: 124 SGGRMIVVVPNKRGMWAR--------------MEHTPFGSGQPYSWYQMISLLREANFTL 169
            GG + +    +    +                    + S   Y   ++  LL +  F  
Sbjct: 130 PGGSLSICTLGRNIFTSMVPAAYRIGEKLNVKRVGMAYFSEHYYKEEEIKKLLEDVGFVD 189

Query: 170 SITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFA 205
           +   R  F     +  +  L    E       P  A
Sbjct: 190 TNVFRRSFAHVDLRPSVYYLSKKMEPFIESRMPYLA 225


>gi|111018986|ref|YP_701958.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhodococcus
           jostii RHA1]
 gi|110818516|gb|ABG93800.1| ubiquinone/menaquinone biosynthesis methyltransferase ubiE
           [Rhodococcus jostii RHA1]
          Length = 232

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 56/193 (29%), Gaps = 9/193 (4%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST 81
            +  K   +      G R+L L       +   G+           +G            
Sbjct: 42  RSWRKATRSALALKPGERVLDLAAGTGVSTVELGRSGAWCVATDFSKGMLQAGSGRHVPM 101

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
                 +LP AD+  D   +   L    D    L EI RV   GGR++V   +       
Sbjct: 102 VAGDAMHLPYADAVFDAATISFGLRNVSDFDAGLREIARVTKPGGRLVVSEFSTPVFGPF 161

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI-- 199
              T +      +  ++   +          + S+   PT ++  L+     E  G    
Sbjct: 162 R--TVYMEYLMRALPRVARAVSSNPDAYVYLAESIRAWPTQQELALR----IEAAGWRNV 215

Query: 200 -FGPGFAGIYVIE 211
            +     G+  + 
Sbjct: 216 QWRNLTGGVVALH 228


>gi|76803145|ref|YP_331240.1| S-adenosylmethionine-dependent methyltransferase 1 [Natronomonas
           pharaonis DSM 2160]
 gi|76559010|emb|CAI50608.1| S-adenosylmethionine-dependent methyltransferase 1 [Natronomonas
           pharaonis DSM 2160]
          Length = 208

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 46/157 (29%), Gaps = 6/157 (3%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWP----DQ 76
           + +     T +D   G R+L +G    F +       +       +             +
Sbjct: 31  EEMRDEALTWFDIDDGDRVLDVGCGTGFATEGLLEHTDDVWGLDQSAHQLAKAYAKFGKR 90

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
              +        LP  D+S D       +E+  +P   L E  RV   GG ++VV P+  
Sbjct: 91  GTVNFHRGDAERLPFDDNSFDAYWSSGSIEYWPNPVDALAEARRVTKPGGTVLVVGPDYP 150

Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITS 173
                 +         Y   +   +   A F      
Sbjct: 151 -NSTLFQKLADAIMLFYDEDEADRMFAAAGFETFEHR 186


>gi|198282702|ref|YP_002219023.1| hypothetical protein Lferr_0562 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667707|ref|YP_002424894.1| hypothetical protein AFE_0398 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247223|gb|ACH82816.1| hypothetical protein Lferr_0562 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519920|gb|ACK80506.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 265

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 77/230 (33%), Gaps = 18/230 (7%)

Query: 11  FYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGA 70
           +++   G+   D    +L    + +    +L LG   P F       E T   +  G   
Sbjct: 18  WWNGRSGRLLLDRARDMLPRWIERLQPETILQLG--QPVFWGLPPGHEHTWVLLNDGFAL 75

Query: 71  TNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV 130
                      A      +P A    D V++   L    +P  +L E WRVL   G +++
Sbjct: 76  ----PSDEYLQAYGVCEAMPFAAMRFDLVIVPFCLTRMANPQAVLEECWRVLRPEGHVLI 131

Query: 131 VVPNKRGMWA--------RMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTH 182
           +  N  G  +        R +             ++  LL E  F L       +  P  
Sbjct: 132 MDFNPGGSLSVVRRWHLWRRDRAWPWLRPFLPLGRLRGLLEEQGFVLREGRYFQYTVP-- 189

Query: 183 KKCILKLWSVFEKIGNIFGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
              + +     E +G+ + P  A  Y+I A++   +   +   +   + S
Sbjct: 190 --GLRRNAQWMELVGDRWWPAGANAYLILAQRRDPERPLVGAVRSFKVRS 237


>gi|172063908|ref|YP_001811559.1| methyltransferase type 11 [Burkholderia ambifaria MC40-6]
 gi|171996425|gb|ACB67343.1| Methyltransferase type 11 [Burkholderia ambifaria MC40-6]
          Length = 242

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 57/213 (26%), Gaps = 20/213 (9%)

Query: 1   MRVDIVELRQFYS--SFLGKCTTDA----ISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M  +I +   F+   S L +             L      + G  +L LG    +FS + 
Sbjct: 1   MTQNIYDDPAFFEGYSRLNRSVHGLAGAPEWPALRALLPPLRGANVLDLGCGYGWFSRWA 60

Query: 55  GKVE--RTLAFMPAGQGATNW---PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
            +      L    + +              +        L L D++ D         +  
Sbjct: 61  AEQGAASVLGIDVSERMLERAVSTAAHPAITYRRGDLETLALPDAAFDLAYSSLAFHYIA 120

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM---------EHTPFGSGQPYSWYQMIS 160
               +L  I R L  GGR++  + +      R          + +    G      ++  
Sbjct: 121 HLDTLLRTIHRALVPGGRLVFSIEHPIYTAPRRPGFIVDAQGKRSWPLDGYQREGERVTD 180

Query: 161 LLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
            L         T  +L          L   + +
Sbjct: 181 WLAPGVVKQHRTLGTLVNLLIGSGFTLTHLNEW 213


>gi|27366217|ref|NP_761745.1| Biotin synthesis protein bioC [Vibrio vulnificus CMCP6]
 gi|37679513|ref|NP_934122.1| biotin synthesis protein BioC [Vibrio vulnificus YJ016]
 gi|320156730|ref|YP_004189109.1| 8-amino-7-oxononanoate synthase [Vibrio vulnificus MO6-24/O]
 gi|27362417|gb|AAO11272.1| Biotin synthesis protein bioC [Vibrio vulnificus CMCP6]
 gi|37198257|dbj|BAC94093.1| biotin synthesis protein BioC [Vibrio vulnificus YJ016]
 gi|319932042|gb|ADV86906.1| 8-amino-7-oxononanoate synthase [Vibrio vulnificus MO6-24/O]
          Length = 269

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 52/163 (31%), Gaps = 10/163 (6%)

Query: 19  CTTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSCF-HGKVERTLAFMPAGQGATNWPDQ 76
                +   L      D++G R+L LG    +FS     +    +    + +       +
Sbjct: 36  AFQREVGHKLLDKLPQDLSGLRVLDLGCGTGYFSWQLLQRGAEVVCADLSHEMLEQAKAR 95

Query: 77  YFSSTA---LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
               +    +    +LP      D V     L++ ED    L E+ RV+   G+++    
Sbjct: 96  CGLESVSYRVADAESLPFERDEFDIVFSSLALQWCEDLSRPLREMNRVVKPHGQVLFSTL 155

Query: 134 NKRGMWARMEH-----TPFGSGQPYSWYQMISLLREANFTLSI 171
               +    +      +     +  S  Q+   L +++     
Sbjct: 156 LDGSLNELKQAWAKIDSYQHVNRFISANQVKIALAQSHSHNHH 198


>gi|282861667|ref|ZP_06270731.1| Methyltransferase type 11 [Streptomyces sp. ACTE]
 gi|282563483|gb|EFB69021.1| Methyltransferase type 11 [Streptomyces sp. ACTE]
          Length = 243

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 61/184 (33%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  + +A    G+                  P   
Sbjct: 9   FPLAAGDRVLDLGCGAGRHAFECYRRGAQVVALDQNGEEIREVAKWFAAMKEAGEAPAGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D+S D V++   +E   D   +L E+ RVL  GGR+ + VP    
Sbjct: 69  TATAMEGDALNLPFPDASFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               W   +       G  + Y   +++  +R A      T  +           LK   
Sbjct: 129 EKVCWTLSDAYHEVEGGHIRIYKADELLGKIRGAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|269967788|ref|ZP_06181835.1| biotin synthesis protein BioC [Vibrio alginolyticus 40B]
 gi|269827608|gb|EEZ81895.1| biotin synthesis protein BioC [Vibrio alginolyticus 40B]
          Length = 273

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 42/129 (32%), Gaps = 5/129 (3%)

Query: 19  CTTDAISKVLSTTWDD-VTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQ 76
                +   L     + +TG R+L LG    +FS     +    +    +         +
Sbjct: 40  AFQRDVGHQLLDKLPENLTGKRVLDLGCGTGYFSQLLQQRGAEVVCGDISQAMLDKAEQR 99

Query: 77  YFSSTAL---VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
             +           NLP  D S D V     L++  D    L E+ RVL +GG+      
Sbjct: 100 CGAVRMHYQVADAENLPFDDDSFDYVFSSLALQWCTDLSYPLKEVRRVLKNGGKAWFSTL 159

Query: 134 NKRGMWARM 142
               ++   
Sbjct: 160 VDGSLYELR 168


>gi|226361081|ref|YP_002778859.1| ubiquinone/menaquinone biosynthesis methyltransferase [Rhodococcus
           opacus B4]
 gi|226239566|dbj|BAH49914.1| menaquinone biosynthesis methyltransferase MenH [Rhodococcus opacus
           B4]
          Length = 232

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 31/193 (16%), Positives = 56/193 (29%), Gaps = 9/193 (4%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST 81
            +  K   +      G R+L L       +   G+           +G            
Sbjct: 42  RSWRKATRSALALKPGERVLDLAAGTGVSTVELGRSGAWCVATDFSKGMLQAGSGRHVPM 101

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
                 +LP AD+  D   +   L    D    L EI RV   GGR++V   +       
Sbjct: 102 VAGDAMHLPYADAVFDAATISFGLRNVSDFDAGLREIARVTKPGGRLVVSEFSTPVFGPF 161

Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNI-- 199
              T +      +  ++   +          + S+   PT ++  L+     E  G    
Sbjct: 162 R--TVYMEYLMKALPRVARAVSSNPDAYVYLAESIRAWPTQQELALR----IEAAGWRNV 215

Query: 200 -FGPGFAGIYVIE 211
            +     G+  + 
Sbjct: 216 QWRNLTGGVVALH 228


>gi|88602127|ref|YP_502305.1| UbiE/COQ5 methyltransferase [Methanospirillum hungatei JF-1]
 gi|88187589|gb|ABD40586.1| UbiE/COQ5 methyltransferase [Methanospirillum hungatei JF-1]
          Length = 237

 Score = 75.6 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 74/234 (31%), Gaps = 23/234 (9%)

Query: 2   RVDIVE-LRQFYS-SFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFS-CFHGKV- 57
             DI +   Q Y     G+   D I+  +    +      LL +G     F   +  +  
Sbjct: 5   YDDIADVYDQRYDHRERGRIYYDHIAGAVLGKINPS--GHLLDIGCGTGLFLERYLKEGT 62

Query: 58  -ERTLAFMPAGQGATNWPDQYFS-STALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLML 115
                    +        ++Y      + +   LP    S D +  +    + ++P   L
Sbjct: 63  DRTATGIDISPGMIKKARERYPDLPYVVGNAELLPFESDSFDSISSLLAFSYLQNPGQSL 122

Query: 116 HEIWRVLTSGGRMIVVV----------PNKRGMWARMEHTPFGSG----QPYSWYQMISL 161
            + +RVL  GGR+ V            P    + A+M+    G G      YS  +M  L
Sbjct: 123 SDCYRVLVPGGRLAVCTLGKNIFTSSLPALYSIGAKMKIRRVGVGSFAEHYYSAKEMYDL 182

Query: 162 LREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
           L +A F      +  F        +  +    E       P  A   +I A K 
Sbjct: 183 LDKAGFEEIEIFKCSFAHFNLAGPLFMIAKKVESFIEDNIPYLA-YNLIAAGKK 235


>gi|322418971|ref|YP_004198194.1| type 11 methyltransferase [Geobacter sp. M18]
 gi|320125358|gb|ADW12918.1| Methyltransferase type 11 [Geobacter sp. M18]
          Length = 273

 Score = 75.6 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 50/215 (23%), Positives = 74/215 (34%), Gaps = 24/215 (11%)

Query: 24  ISKVLSTTWDDVTGC--RLLGLGYAIPFFSCFHGKVE-------RTLAFMPAGQGATNWP 74
           I + L T   +  G   R L  G        + G+         R  A            
Sbjct: 60  ILRHLETRCAEGAGPVVRFLDAGCGDGINLQWAGEFFQDRGLEARISAVDFNPLRVERVR 119

Query: 75  DQYFSSTAL-VSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVP 133
            +  +  A   S   LP  D S D VL  H LE   +    L ++ RVL  GG ++V VP
Sbjct: 120 SKGLAHDAQVASLLELPFPDGSFDIVLCNHVLEHVHEYRRALDQLARVLHPGGLLVVGVP 179

Query: 134 NKRGMWARMEHTPFG--------SGQPYSWYQMISLLREANFTLSI-TSRSLFFPPTHKK 184
           N+  + ARM +  F             ++   +   L  + F L+       F P     
Sbjct: 180 NEGCLLARMRNHVFQRSILRSTDHVNFFTGQALEGALLASGFRLAKLHREGFFLPHFWLH 239

Query: 185 CILKLWSVFEK----IGNIFGPGFAGIYVIEARKI 215
             L  +   EK    +G I+    AG+ +  A K 
Sbjct: 240 YALSRFEWGEKLLFALGRIWPAQSAGV-IAHAVKR 273


>gi|261407428|ref|YP_003243669.1| type 11 methyltransferase [Paenibacillus sp. Y412MC10]
 gi|261283891|gb|ACX65862.1| Methyltransferase type 11 [Paenibacillus sp. Y412MC10]
          Length = 243

 Score = 75.6 bits (184), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 56/173 (32%), Gaps = 16/173 (9%)

Query: 1   MRVDIVELRQFYS--SFLGKCTTDA----ISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M  +I +   F+   S L +           + L +   D++G  +L LG    +FS + 
Sbjct: 1   MTQNIYDDEGFFQGYSQLSRSVHGLDGAPEWETLRSMLPDLSGASVLDLGCGFGWFSRWA 60

Query: 55  GKVE---RTLAFMPAGQGATNWPDQ---YFSSTALVSEGNLPLADSSVDCVLMVHYLEFA 108
            +     + +    +         +      S        L L   + D V       + 
Sbjct: 61  REHGGAEKVIGVDVSENMLARGKAETQDSNISYIKADLETLELDSETYDLVYCSLAFHYI 120

Query: 109 EDPFLMLHEIWRVLTSGGRMIVVVPNK----RGMWARMEHTPFGSGQPYSWYQ 157
           E+   +L E+ R L  GG ++  V +           ++H       P   YQ
Sbjct: 121 ENLQGLLKEVHRSLKPGGSLVCSVEHPIYTASSRPEWIQHPSGHQTWPVDHYQ 173


>gi|319947210|ref|ZP_08021444.1| methyltransferase domain protein [Streptococcus australis ATCC
           700641]
 gi|319747258|gb|EFV99517.1| methyltransferase domain protein [Streptococcus australis ATCC
           700641]
          Length = 236

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 52/132 (39%), Gaps = 5/132 (3%)

Query: 1   MRVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERT 60
           M  +I    +      G+   D +   L     D+ G R+L  G      +    K  + 
Sbjct: 1   MAANIQAYLENLQQPWGQIYYDILFDQLQ----DIKGKRVLDFGSGFGLVANHLAKENQV 56

Query: 61  LAFMPAGQGATNWPDQYFSSTALVSEGNLPL-ADSSVDCVLMVHYLEFAEDPFLMLHEIW 119
           LA  P  +       ++     + S   L    D+S D +L  + LE+ ED  L+L E  
Sbjct: 57  LAVEPNEEMVALRAQEHSYQQLVGSLDQLASLEDASFDVILCHNVLEYVEDRKLVLEEFT 116

Query: 120 RVLTSGGRMIVV 131
           R+L  GG + +V
Sbjct: 117 RLLKPGGLLSIV 128


>gi|262197334|ref|YP_003268543.1| methyltransferase type 11 [Haliangium ochraceum DSM 14365]
 gi|262080681|gb|ACY16650.1| Methyltransferase type 11 [Haliangium ochraceum DSM 14365]
          Length = 239

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/140 (17%), Positives = 45/140 (32%), Gaps = 3/140 (2%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDV-TGCRLLGLGYAIPFFSCFHGK-VERTLAFM 64
           +   +Y    G+     +  +     +    G R+L +G              +  L   
Sbjct: 13  DFAAWYERERGRGYHQMLDDLEVELVERFGRGKRVLEVGCGTGLLLERFADFADSALGID 72

Query: 65  PAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTS 124
            +G        +   + A  S   LP  D+  D V     L    +  L L E+ RV   
Sbjct: 73  LSGGMLAKARARG-LAVAQASATALPFPDAHFDVVCSFKVLPHVSEIRLALAEMARVTRP 131

Query: 125 GGRMIVVVPNKRGMWARMEH 144
           GG ++    N R +   ++ 
Sbjct: 132 GGHVLAEFYNPRSLRYLVKK 151


>gi|297161009|gb|ADI10721.1| methyltransferase [Streptomyces bingchenggensis BCW-1]
          Length = 244

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 62/186 (33%), Gaps = 22/186 (11%)

Query: 30  TTWDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPD 75
           + +    G R+L LG      +   + +  + +A    G+                  P 
Sbjct: 7   SRFPLAPGDRVLDLGCGAGRHAFECYRRGAQVVALDRNGEEIREVAKWFAAMKEAGEAPA 66

Query: 76  QYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135
              ++        LP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP  
Sbjct: 67  GATATAMEGDALALPFPDDSFDVVIISEVMEHIPDDKGVLAEMVRVLRPGGRIAVTVPRY 126

Query: 136 RG---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKL 189
                 W   +       G  + Y   ++++ +REA      T  +           LK 
Sbjct: 127 GPEKVCWTLSDAYHEVEGGHIRIYRADELLAKMREAGLRPYGTHHA--HALHSPYWWLKC 184

Query: 190 WSVFEK 195
               + 
Sbjct: 185 AFGVDN 190


>gi|300857716|ref|YP_003782699.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Corynebacterium pseudotuberculosis FRC41]
 gi|300685170|gb|ADK28092.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Corynebacterium pseudotuberculosis FRC41]
 gi|302205458|gb|ADL09800.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Corynebacterium pseudotuberculosis C231]
 gi|302330011|gb|ADL20205.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Corynebacterium pseudotuberculosis 1002]
 gi|308275694|gb|ADO25593.1| ubiquinone/menaquinone biosynthesis methyltransferase
           [Corynebacterium pseudotuberculosis I19]
          Length = 232

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 39/120 (32%)

Query: 22  DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTLAFMPAGQGATNWPDQYFSST 81
               +      +   G R+L L       +   GK    +      QG      +     
Sbjct: 37  RKWREKTRERLNLQPGERVLDLAAGTAVSTVELGKSGAWVVACDFSQGMLAAGKERDVPK 96

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWAR 141
            +     LP AD+S D V + + L    D    L E+ RV   GGR+ +   +   +   
Sbjct: 97  VVGDGMQLPFADNSFDAVTISYGLRNVHDFQAALREMARVTKPGGRLTIAEFSTPNVPGF 156


>gi|15965862|ref|NP_386215.1| hypothetical protein SMc01426 [Sinorhizobium meliloti 1021]
 gi|307309618|ref|ZP_07589271.1| Methyltransferase type 11 [Sinorhizobium meliloti BL225C]
 gi|307321757|ref|ZP_07601145.1| Methyltransferase type 11 [Sinorhizobium meliloti AK83]
 gi|15075131|emb|CAC46688.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306892579|gb|EFN23377.1| Methyltransferase type 11 [Sinorhizobium meliloti AK83]
 gi|306899953|gb|EFN30575.1| Methyltransferase type 11 [Sinorhizobium meliloti BL225C]
          Length = 242

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/213 (11%), Positives = 61/213 (28%), Gaps = 20/213 (9%)

Query: 1   MRVDIVELRQFYS--SFLGKCTT----DAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M  ++ +  +F++  S LG+        A    +     D+   R+L LG    +F+ + 
Sbjct: 1   MAQNVYDRPEFFTGYSQLGRSLHGLAGAAEWPAIRAMLPDLRDLRVLDLGCGFGWFARWA 60

Query: 55  GK--VERTLAFMPAGQGATNWPDQYFSSTA---LVSEGNLPLADSSVDCVLMVHYLEFAE 109
            +    + L    + +       +    +    +    +L L ++S           + E
Sbjct: 61  RENGAAQVLGLDLSEKMIARARQETEDPSVEYRIADLEHLVLPEASFGFAYSSLAFHYIE 120

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNK---------RGMWARMEHTPFGSGQPYSWYQMIS 160
           D   ++  I R L  G   +  + +              A                ++  
Sbjct: 121 DFDRLVRTIHRSLLPGSHFVFTIEHPVYMAPTNPGWSTDAEGRRIWPLDRYSVEGKRVTD 180

Query: 161 LLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
            L +       T  +           ++    +
Sbjct: 181 WLAKGVVKYHRTLGTTLNTLIAAGFAIRRVQEW 213


>gi|239979203|ref|ZP_04701727.1| putative methyltransferase [Streptomyces albus J1074]
 gi|291451081|ref|ZP_06590471.1| methyltransferase [Streptomyces albus J1074]
 gi|291354030|gb|EFE80932.1| methyltransferase [Streptomyces albus J1074]
          Length = 244

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 37/184 (20%), Positives = 62/184 (33%), Gaps = 22/184 (11%)

Query: 32  WDDVTGCRLLGLGYAIPFFSC-FHGKVERTLAFMPAGQGATN-------------WPDQY 77
           +    G R+L LG      +   + +  + +A    G+                  P   
Sbjct: 9   FPLAAGDRVLDLGCGAGRHAFECYRRGAQVVALDQNGEEIREVATWFAAMKEAGEAPVGA 68

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
            ++       NLP  D S D V++   +E   D   +L E+ RVL  GGR+ V VP    
Sbjct: 69  TATAMEGDALNLPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAVTVPRYGP 128

Query: 138 ---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191
               WA  +       G  + Y   ++++ +R A      T  +           LK   
Sbjct: 129 EKVCWALSDAYHEVEGGHIRIYKADELLARMRGAGLKPYGTHHA--HALHSPYWWLKCAF 186

Query: 192 VFEK 195
             + 
Sbjct: 187 GVDN 190


>gi|254482752|ref|ZP_05095990.1| methyltransferase, UbiE/COQ5 family [marine gamma proteobacterium
           HTCC2148]
 gi|214037111|gb|EEB77780.1| methyltransferase, UbiE/COQ5 family [marine gamma proteobacterium
           HTCC2148]
          Length = 238

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 32/193 (16%), Positives = 60/193 (31%), Gaps = 26/193 (13%)

Query: 30  TTWDDVTGCRLLGLGYAIPFF--SCFHGKVERTLAFMPA-----------GQGATNWPDQ 76
           + +   +G  +L LG        S +      ++    +              A    + 
Sbjct: 7   SHFPLQSGDVVLDLGCGEGRHVISAYVEAQVHSIGVDLSLDDLKTTQQKFQDFAEPDNET 66

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                +  +   LP AD++ D V+    LE   D    L E+ RVL  GG     VP   
Sbjct: 67  KTFGLSSANALELPFADNTFDKVICSEVLEHIPDYQGALKEVERVLKPGGLFCASVPRLW 126

Query: 137 GMWAR------MEHTPFGSGQPYSWYQMISLLREANF--TLSITSRSLFFPPTHKKCILK 188
                        +TP G  + +   ++   +    F       + +L  P       LK
Sbjct: 127 PEKICWALSEEYHNTPGGHIRIFRASELRDDIESLGFSRYHRHWAHALHAP----YWWLK 182

Query: 189 LWSVFEKIGNIFG 201
               +++  + + 
Sbjct: 183 CL-FWDQQDSNWL 194


>gi|159897650|ref|YP_001543897.1| type 11 methyltransferase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890689|gb|ABX03769.1| Methyltransferase type 11 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 293

 Score = 75.6 bits (184), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 61/176 (34%), Gaps = 22/176 (12%)

Query: 25  SKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE--RTLAFMPAGQGATNWPDQYFSS-T 81
           ++ L    D   G  +L  G    F++    K+     + F  A        +    +  
Sbjct: 35  ARRLMQYLDLQDGDTVLDCGCGYGFYTQMIDKLRDLHVVGFDEAFDRLLVGQEHANRATF 94

Query: 82  ALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK----RG 137
                  +P A++S D +L+   LE   D    LHE+ R+L  GG + + VP+       
Sbjct: 95  VRGDGQGMPFANNSFDKILLSEVLEHIPDQQAALHELRRILKPGGILAISVPHANYPLWW 154

Query: 138 MWARMEHTPFG---------------SGQPYSWYQMISLLREANFTLSITSRSLFF 178
             A    T  G                 + Y   +++  +R A+F +     +  +
Sbjct: 155 DPASWIWTRLGGKPFTHTKFGSIWENHVRLYEPAELVRQVRMADFEVECCEEATHY 210


>gi|212712175|ref|ZP_03320303.1| hypothetical protein PROVALCAL_03257 [Providencia alcalifaciens DSM
           30120]
 gi|212685222|gb|EEB44750.1| hypothetical protein PROVALCAL_03257 [Providencia alcalifaciens DSM
           30120]
          Length = 271

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 53/174 (30%), Gaps = 8/174 (4%)

Query: 12  YSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGA 70
           Y    GK     I              ++L  G    FFS     +     A   +    
Sbjct: 39  YQQNSGKQLLGFIEDHALAEIPLEP-LQVLDAGCGTGFFSQILQARGAYVTALDLSVGML 97

Query: 71  TNWP-DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMI 129
                 Q            LP AD+S D V     +++ ++    L E++RV   GG + 
Sbjct: 98  EVAKNKQAAHRYVCGDMDALPFADASFDWVFSNLAIQWCQNLPHALSELYRVTKPGGVVG 157

Query: 130 VVVPNKRGMWARMEHTP-----FGSGQPYSWYQMISLLREANFTLSITSRSLFF 178
                +  +    +            +  ++ Q++   +     L   + +L+F
Sbjct: 158 FTTLAEHSLGELAQAWQTLDDDPHVNRFLAYSQIVEDCQSWRCQLYQQADTLYF 211


>gi|72160976|ref|YP_288633.1| hypothetical protein Tfu_0572 [Thermobifida fusca YX]
 gi|71914708|gb|AAZ54610.1| conserved hypothetical protein [Thermobifida fusca YX]
          Length = 243

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 59/180 (32%), Gaps = 22/180 (12%)

Query: 31  TWDDVTGCRLLGLGYAIPFFSCF-HGKVERTLAFMPAGQGATN-------------WPDQ 76
            +    G R+L LG      +   + +    +AF    +                  P +
Sbjct: 8   LFPVGPGHRVLDLGCGGGRHAFEVYRRGADVVAFDQNAEDLAAVSAMFAAMRAEGEAPAE 67

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
             + T       +P  D++ D V+    +E        + E++RVL  GG  +V VP+  
Sbjct: 68  ATAETVRGDALAMPFDDNTFDRVIAAEIMEHIPHDTAAMAEMYRVLRPGGIAVVTVPSWF 127

Query: 137 G---MWARMEHTP---FGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLW 190
                WA  E       G  + Y+  ++ + L+   F +     +           LK  
Sbjct: 128 PERICWALSEEYHTVEGGHIRIYTRAELEAKLKATGFIIGPHHHA--HALHSPYWWLKCA 185


>gi|297526089|ref|YP_003668113.1| Methyltransferase type 11 [Staphylothermus hellenicus DSM 12710]
 gi|297255005|gb|ADI31214.1| Methyltransferase type 11 [Staphylothermus hellenicus DSM 12710]
          Length = 216

 Score = 75.2 bits (183), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 67/218 (30%), Gaps = 28/218 (12%)

Query: 8   LRQFYSSFLGKCTTDAISKVLSTTWDDVTGCR--LLGLGYAIPFFSCFHGKVERTLAFMP 65
              +Y          A    + +      G    +L +G      +    K    +   P
Sbjct: 17  YENWY--LRNYNIMKAERDCIKSL-----GLHGKVLDVGVGTGILTYGLSKS--MVGVDP 67

Query: 66  AGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSG 125
           + +       + F  T       LP  D   D V++V  + F  DP  ML EI RVL   
Sbjct: 68  SEKMLLYASRRGF-LTINSFGEELPFIDGYFDTVIVVVTICFVNDPLKMLAEINRVLKKN 126

Query: 126 GRMIVVVPNKRGMWARMEHT--------PFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           G ++  V  K   W    +          +   + Y+  ++  +L    F +  T  +L 
Sbjct: 127 GTLVTCVVPKDSSWGIYYNWLKNSGKSLFYRYARFYTIQELFYMLSITGFIVKDTCSTLS 186

Query: 178 FPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIEARKI 215
           +PP +                      +G   I A K 
Sbjct: 187 YPPGNPPAYEVPIKSL--------VPDSGFICIRAEKK 216


>gi|254458052|ref|ZP_05071479.1| S-adenosylmethionine-dependent methyltransferase 3 family protein
           [Campylobacterales bacterium GD 1]
 gi|207085445|gb|EDZ62730.1| S-adenosylmethionine-dependent methyltransferase 3 family protein
           [Campylobacterales bacterium GD 1]
          Length = 189

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 55/161 (34%), Gaps = 10/161 (6%)

Query: 22  DAISKVLSTTWDDVTGC-RLLGLGYAIPFFSCFHGKVE---RTLAFMPAGQGATNWPDQY 77
             +   L    + + G   +L +G      S F  +     + +A  PA       P   
Sbjct: 21  KEVLDELCIFLEQLKGEESVLDVGAGTGVMSEFAHRCNSNLKYVAVDPAEGMLKYAP--N 78

Query: 78  FSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRG 137
           ++   +     LP  D + + VLM   L    DP + + E+ RVL   G++ +   +   
Sbjct: 79  YAQVHVGMAEALPFEDDNFEAVLMGESLHHFNDPDVAMKEVVRVLKKDGKLFIYDFDFGT 138

Query: 138 MWARMEHTP----FGSGQPYSWYQMISLLREANFTLSITSR 174
              +   T        G  Y    +  +L    F + I+  
Sbjct: 139 FRGKAICTMEKLLGEPGHFYEVDALKKMLESHGFKVEISKH 179


>gi|59713929|ref|YP_206704.1| biotin biosynthesis protein BioC [Vibrio fischeri ES114]
 gi|59482177|gb|AAW87816.1| biotin biosynthesis protein BioC [Vibrio fischeri ES114]
          Length = 273

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 46/129 (35%), Gaps = 5/129 (3%)

Query: 20  TTDAISKVLSTTWD-DVTGCRLLGLGYAIPFFSCFH-GKVERTLAFMPAGQGATNWPDQY 77
               ++  L +    D+TG R+L +G    +       +    +AF  +        ++ 
Sbjct: 39  FQRQVADTLLSYLPTDLTGLRILDVGCGTGYCCEALLKRGACVVAFDLSSVMLEKAKERC 98

Query: 78  FSS---TALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPN 134
                        +LP  D   D V+    L++ +D  + L E+ R+  +  ++I     
Sbjct: 99  GDHNITYIQGDAEDLPFMDDEFDGVVSSLALQWCQDLSVPLREMKRISHNKSKVIFSTLL 158

Query: 135 KRGMWARME 143
              ++   +
Sbjct: 159 DGSLFELKK 167


>gi|168701560|ref|ZP_02733837.1| hypothetical protein GobsU_18682 [Gemmata obscuriglobus UQM 2246]
          Length = 259

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 36/250 (14%), Positives = 74/250 (29%), Gaps = 16/250 (6%)

Query: 3   VDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVER-TL 61
            +  +   F +   G     +  +VL          R+L  G      SC         +
Sbjct: 10  FNQAQYDDFLAKS-GDVYAQSKYRVLLRWMSGRGRLRVLNAGCGSGELSCLLAAAGHQVV 68

Query: 62  AFMPAGQGATNWPDQYFSSTALVSEGNLPLAD----SSVDCVLMVHYLEFAEDPFLMLHE 117
              P         D+  S+          + +       D  +    LE  ED      +
Sbjct: 69  GIDPDPTYIALARDRAGSNFPDSEYHVCSIENYTGPGDFDAAVSTDVLEHIEDDRSAFAK 128

Query: 118 IWRVLTSGGRMIVVVPNKRGMWARMEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLF 177
           +  ++  GG ++V VP  + ++   +    G  + YS   + +L+ +      +      
Sbjct: 129 MAALVRPGGLVLVAVPAGQWLFGFHDE-QLGHYRRYSKRSLRALVSDHCDVTKVRYFGGT 187

Query: 178 FPP--THKKCILKLWSVFEKIGNI---FGPGFAGIYVIEARKILYQGLPITESKKKHISS 232
             P        L+      ++G           G  ++ A + +   LP+  S       
Sbjct: 188 LIPVCLAFSRWLRRPYPVGQVGGKPGVVSRVLNG--LLAAERRV--PLPLGTSVLLCGER 243

Query: 233 PILVPHTVST 242
           P+      S+
Sbjct: 244 PVAARQVASS 253


>gi|153006111|ref|YP_001380436.1| type 11 methyltransferase [Anaeromyxobacter sp. Fw109-5]
 gi|152029684|gb|ABS27452.1| Methyltransferase type 11 [Anaeromyxobacter sp. Fw109-5]
          Length = 244

 Score = 75.2 bits (183), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 60/187 (32%), Gaps = 14/187 (7%)

Query: 7   ELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKV-ERTLAFMP 65
           +   + +S LG+ T       +     +     +L +G     ++    +   R  A  P
Sbjct: 9   DYAAWRASRLGRITERLERAAVLDLVGEPATVDVLDVGAGDGAYAVALARQSARVTALDP 68

Query: 66  AGQGATNWP-----DQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWR 120
           +                           LP  D++ D V+ V  L F  +P   + EI R
Sbjct: 69  SAAALGAARRAARDCGERLRLVRGYAQALPFEDAAFDRVIAVTALCFVPEPDRAMSEIAR 128

Query: 121 VLTSGGRMIVVVPNKRGMWA--------RMEHTPFGSGQPYSWYQMISLLREANFTLSIT 172
           VL  GGR+++        WA            + +   + ++   +  L   A       
Sbjct: 129 VLRPGGRLVIGELGHWSAWAAWRRARALFRPSSIWRRTRFWTPRGLRRLAERAGLVPGRV 188

Query: 173 SRSLFFP 179
             ++F P
Sbjct: 189 WGAVFHP 195


>gi|78223384|ref|YP_385131.1| ubiquinone/menaquinone biosynthesis methylase-like protein
           [Geobacter metallireducens GS-15]
 gi|78194639|gb|ABB32406.1| Methylase involved in ubiquinone/menaquinone biosynthesis-like
           protein [Geobacter metallireducens GS-15]
          Length = 345

 Score = 74.8 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 56/152 (36%), Gaps = 8/152 (5%)

Query: 31  TWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAFMPAGQGATNWPDQYFSSTALVSEGNL 89
                 G RLL +G        + G    RT           N   +  +          
Sbjct: 134 YLRSRPGGRLLEIGCGSGTMLSYLGSLGWRTEGIDVDPSAVANARSKGLNVA-QGDLLEQ 192

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS 149
           P  D++ D V++ H +E   +P  +L E +R+L  GG + +V PN   M + +    +  
Sbjct: 193 PYGDNTFDAVMISHVIEHVPNPVELLTECYRILKPGGVLSLVTPNVESMGSHLFGRHWLH 252

Query: 150 GQP------YSWYQMISLLREANFTLSITSRS 175
             P      Y+   + +L R+A FT      +
Sbjct: 253 LDPPRHLILYNVRTIRALARKAGFTNMEIRTT 284


>gi|317491231|ref|ZP_07949667.1| biotin biosynthesis protein BioC [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920778|gb|EFV42101.1| biotin biosynthesis protein BioC [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 255

 Score = 74.8 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 40/121 (33%), Gaps = 2/121 (1%)

Query: 19  CTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVE-RTLAFMPAGQGATNWP-DQ 76
                  + L     +  G ++L  G    FFS        + +A   A         + 
Sbjct: 29  AFQRLCGEKLLARVSNYEGLKVLDAGCGTGFFSRRFRHAGAQVIALDLAAGMLEKSRGND 88

Query: 77  YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136
                 L    ++PL D SVD       +++       L E+ RV+  GG+++     + 
Sbjct: 89  SADEYVLADIEHIPLPDGSVDLCFSNLAIQWCSSLHAALAEMHRVVKPGGKVVFSSLAQG 148

Query: 137 G 137
            
Sbjct: 149 S 149


>gi|206564022|ref|YP_002234785.1| putative methyltransferase [Burkholderia cenocepacia J2315]
 gi|198040062|emb|CAR56043.1| putative methyltransferase [Burkholderia cenocepacia J2315]
          Length = 242

 Score = 74.8 bits (182), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 55/213 (25%), Gaps = 20/213 (9%)

Query: 1   MRVDIVELRQFYS--SFLGKCTTDA----ISKVLSTTWDDVTGCRLLGLGYAIPFFSCFH 54
           M  +I +   F+   S L +             L     D+ G  +L LG    +FS + 
Sbjct: 1   MTQNIYDDPAFFEGYSRLNRSIHGLDGAPEWPALRALLPDLHGRHVLDLGCGYGWFSRWA 60

Query: 55  GKVER--TLAFMPAGQGATNW---PDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEFAE 109
                   L    + +              +        L L D++ D         +  
Sbjct: 61  ADQGAAGVLGIDVSERMLERATSTTAHPAITYRRADLETLALPDAAFDLAYSSLAFHYVV 120

Query: 110 DPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARME---------HTPFGSGQPYSWYQMIS 160
               +L  I R L  GGR++  + +      R            +    G      ++  
Sbjct: 121 HLDTLLRTIHRALVPGGRLVFSIEHPIYTAPRRPGFVVDAQGNRSWPLDGYQREGERVTD 180

Query: 161 LLREANFTLSITSRSLFFPPTHKKCILKLWSVF 193
            L         T  +L          L     +
Sbjct: 181 WLAPGVVKQHRTLGTLVNLLIRSGFTLTHLDEW 213


>gi|288905252|ref|YP_003430474.1| methyltransferase [Streptococcus gallolyticus UCN34]
 gi|288731978|emb|CBI13543.1| hypothetical methyltransferase [Streptococcus gallolyticus UCN34]
          Length = 248

 Score = 74.8 bits (182), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 52/189 (27%), Gaps = 22/189 (11%)

Query: 28  LSTTWDDVTGCRLLGLGYAIPFFSCFHGK-VERTLAFMPAGQGATNWPDQY-FSSTALVS 85
           L           +L LG      +       + T+    +        + Y      +  
Sbjct: 23  LLEFVPKNKNQHILDLGCGTGTLTSQLADLADTTIGLDSSESMIEKAREHYADIQFVVGD 82

Query: 86  EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT 145
              LP      D V       +  D   +L +I +VL   G +I       G  A +E+T
Sbjct: 83  ALALPFEKQ-FDVVFSNAVFHWIADHNTLLKQIHKVLKPNGLLICE-FGANGNIATIENT 140

Query: 146 PFGSGQ-----------PY