RPSBLAST alignment for GI: 254780582 and conserved domain: PRK08317

>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional. Length = 241
 Score = 41.8 bits (99), Expect = 2e-04
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 85  SEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131
               LP  D S D V     L+  EDP   L EI RVL  GGR++V+
Sbjct: 77  DADGLPFPDGSFDAVRSDRVLQHLEDPARALAEIARVLRPGGRVVVL 123