RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780582|ref|YP_003064995.1| Methyltransferase type 11 [Candidatus Liberibacter asiaticus str. psy62] (242 letters) >gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]. Length = 238 Score = 40.6 bits (95), Expect = 4e-04 Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 88 NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131 NLP D+S D V + L D L E++RVL GGR++V+ Sbjct: 112 NLPFPDNSFDAVTISFGLRNVTDIDKALKEMYRVLKPGGRLLVL 155 >gnl|CDD|147424 pfam05219, DREV, DREV methyltransferase. This family contains DREV protein homologues from several eukaryotes. The function of this protein is unknown. However, these proteins appear to be related to other methyltransferases (Bateman A pers obs). Length = 265 Score = 34.5 bits (79), Expect = 0.030 Identities = 21/95 (22%), Positives = 39/95 (41%), Gaps = 10/95 (10%) Query: 83 LVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIV--VVP------N 134 +++E D ++D +L ++ L+ DPF +L +I L GR+IV V+P Sbjct: 139 VLTEIEWQETDVNLDLILCLNLLDRCFDPFKLLEDIHLALAPNGRVIVALVLPYMHYVET 198 Query: 135 KRGMWARMEHTPFGSGQPYS--WYQMISLLREANF 167 G +G + + + + A F Sbjct: 199 NTGSHLPPRPLLENNGASFEEEVARFMEVFENAGF 233 >gnl|CDD|39501 KOG4300, KOG4300, KOG4300, Predicted methyltransferase [General function prediction only]. Length = 252 Score = 34.2 bits (78), Expect = 0.038 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Query: 88 NLP-LADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV--VPNKRGMWARMEH 144 NLP LAD S D V+ L EDP L+E+ R+L GGR+I + V + G W R+ Sbjct: 137 NLPQLADGSYDTVVCTLVLCSVEDPVKQLNEVRRLLRPGGRIIFIEHVAGEYGFWNRILQ 196 Query: 145 TPFGSGQPY 153 Sbjct: 197 QVAEPLWHL 205 >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).. Length = 107 Score = 33.2 bits (76), Expect = 0.067 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Query: 85 SEGNLPLADSSVDCVLMVHYLE-FAEDPFLMLHEIWRVLTSGGRMIVVV 132 +E P AD S D ++ L ED L E R+L GG +++ + Sbjct: 56 AEELPPEADESFDVIISDPPLHHLVEDLARFLEEARRLLKPGGVLVLTL 104 >gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family. Length = 233 Score = 29.0 bits (65), Expect = 1.1 Identities = 16/43 (37%), Positives = 22/43 (51%) Query: 89 LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVV 131 LP D S D V + L D +L E +RVL GGR++ + Sbjct: 110 LPFEDDSFDIVTISFGLRNFPDYLKVLKEAFRVLKPGGRVVCL 152 >gnl|CDD|30846 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]. Length = 257 Score = 29.0 bits (61), Expect = 1.2 Identities = 22/80 (27%), Positives = 33/80 (41%) Query: 86 EGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT 145 G LP DS+ +++ + P L E+ RVL GGR+++ + G+ Sbjct: 109 GGVLPFEDSASFDLVISLLVLHLLPPAKALRELLRVLKPGGRLVLSDLLRDGLLEGRLAA 168 Query: 146 PFGSGQPYSWYQMISLLREA 165 G G P I L EA Sbjct: 169 LLGFGDPVLERGDILLELEA 188 >gnl|CDD|147365 pfam05148, Methyltransf_8, Hypothetical methyltransferase. This family consists of several uncharacterized eukaryotic proteins which are related to methyltransferases pfam01209. Length = 214 Score = 28.6 bits (64), Expect = 1.5 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 88 NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGG 126 +PL D SVD + L + L E R+L +GG Sbjct: 110 RVPLEDESVDVAVFCLSL-MGTNIADFLKEANRILKNGG 147 >gnl|CDD|36753 KOG1540, KOG1540, KOG1540, Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]. Length = 296 Score = 28.4 bits (63), Expect = 1.7 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Query: 79 SSTALVSEGN---LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGR 127 SS EG+ LP D S D + + L E +RVL GGR Sbjct: 158 SSRVEWVEGDAEDLPFDDDSFDAYTIAFGIRNVTHIQKALREAYRVLKPGGR 209 >gnl|CDD|36483 KOG1269, KOG1269, KOG1269, SAM-dependent methyltransferases [Lipid transport and metabolism, General function prediction only]. Length = 364 Score = 28.4 bits (63), Expect = 2.0 Identities = 17/50 (34%), Positives = 24/50 (48%) Query: 87 GNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136 G +P D++ D V + + A D + EI+RVL GG IV K Sbjct: 170 GKMPFEDNTFDGVRFLEVVCHAPDLEKVYAEIYRVLKPGGLFIVKEWIKT 219 >gnl|CDD|32409 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]. Length = 243 Score = 28.3 bits (63), Expect = 2.1 Identities = 10/39 (25%), Positives = 17/39 (43%) Query: 97 DCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNK 135 D V + LE DP L +++ GG + + N+ Sbjct: 126 DVVTCMEVLEHVPDPESFLRACAKLVKPGGILFLSTINR 164 >gnl|CDD|39548 KOG4347, KOG4347, KOG4347, GTPase-activating protein VRP [General function prediction only]. Length = 671 Score = 28.0 bits (62), Expect = 2.1 Identities = 10/62 (16%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Query: 2 RVDIVELRQFYSSFLGKCTTDAISKVLSTTWDDVTGCRLLGLGYAIPFFSCFHGKVERTL 61 +D + ++ F D + W + G + F CF E Sbjct: 3 DLDARLKSEDFAFFRLPEKLDG--STMCNLWTPYSRYHEQGRLFLSTNFICFASDTEWLC 60 Query: 62 AF 63 +F Sbjct: 61 SF 62 >gnl|CDD|147105 pfam04780, DUF629, Protein of unknown function (DUF629). This family represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family. Length = 466 Score = 28.1 bits (63), Expect = 2.4 Identities = 8/29 (27%), Positives = 17/29 (58%) Query: 1 MRVDIVELRQFYSSFLGKCTTDAISKVLS 29 ++V I +L+ + G+ +A+S+ LS Sbjct: 19 LKVSISKLKSYVERVYGREGREALSEALS 47 >gnl|CDD|39190 KOG3987, KOG3987, KOG3987, Uncharacterized conserved protein DREV/CGI-81 [Function unknown]. Length = 288 Score = 27.7 bits (61), Expect = 2.8 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 12/94 (12%) Query: 93 DSSVDCVLMVHYLEFAEDPFLMLHEIWRVLT-SGGRMIV--VVP-------NKRGMWARM 142 D +D +L ++ L+ DPF +L +I VL S GR+IV V+P N G+ R Sbjct: 167 DVKLDLILCLNLLDRCFDPFKLLEDIHLVLAPSNGRVIVALVLPYMHYVETNTSGLPLRP 226 Query: 143 EHTPFGSGQPYSWY--QMISLLREANFTLSITSR 174 ++ +G+ + + + LLR + + +R Sbjct: 227 DNLLENNGRSFEEEVARFMELLRNCGYRVEAWTR 260 >gnl|CDD|33543 COG3748, COG3748, Predicted membrane protein [Function unknown]. Length = 407 Score = 27.3 bits (60), Expect = 3.8 Identities = 9/50 (18%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Query: 142 MEHTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWS 191 H P G ++W ++ F + + R +F H + W+ Sbjct: 238 SNHYPLAFGTQFNW-----IIAALVFLMGVLIRH-WFNTRHARKGKPTWT 281 >gnl|CDD|31029 COG0685, MetF, 5,10-methylenetetrahydrofolate reductase [Amino acid transport and metabolism]. Length = 291 Score = 27.3 bits (60), Expect = 4.3 Identities = 13/50 (26%), Positives = 19/50 (38%) Query: 158 MISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGI 207 L EA I FPP + L + E++ + GPGF + Sbjct: 2 RERNLTEALKEGKIEVSFELFPPKTDEGEENLEKLLERLAILLGPGFDSV 51 >gnl|CDD|31225 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism]. Length = 613 Score = 26.8 bits (59), Expect = 4.9 Identities = 10/52 (19%), Positives = 15/52 (28%), Gaps = 4/52 (7%) Query: 162 LREANFTLSITSRSLFFPPTHKK----CILKLWSVFEKIGNIFGPGFAGIYV 209 L N + PP L L +FE+ + G+ V Sbjct: 211 LTHRNLLAQVAGIDEVLPPIGPGDRVLSFLPLAHIFERAFEGGLALYGGVTV 262 >gnl|CDD|34247 COG4627, COG4627, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 185 Score = 26.9 bits (59), Expect = 5.6 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Query: 89 LPLADSSVDCVLMVHYLE---FAEDPFLMLHEIWRVLTSGGRMIVVVPN 134 D+SVD + H LE + E L E R L GG++ + VP+ Sbjct: 41 SMFEDNSVDAIYAEHVLEHLTYDEGTS-ALKECHRFLRPGGKLRIAVPD 88 >gnl|CDD|34716 COG5113, UFD2, Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones]. Length = 929 Score = 26.2 bits (57), Expect = 8.4 Identities = 14/61 (22%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Query: 77 YFSSTALVSEGNLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKR 136 A G+ L ++S D +L+ + + F L E + L + IV P Sbjct: 27 ELFKEAECIRGS-YLTNNSSDNILLTLLPRYKNNTFSYLQESAKFLIQTIKRIVKNPEMA 85 Query: 137 G 137 G Sbjct: 86 G 86 >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 293 Score = 26.0 bits (58), Expect = 9.0 Identities = 8/28 (28%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Query: 114 MLHEIWRVLTSGGRMIVVVPNKRGMWAR 141 +L WR L GR + + KR + + Sbjct: 191 LLRASWRCLAPFGRFVEI--GKRDILSN 216 >gnl|CDD|36780 KOG1567, KOG1567, KOG1567, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism]. Length = 344 Score = 26.1 bits (57), Expect = 9.2 Identities = 18/79 (22%), Positives = 33/79 (41%), Gaps = 25/79 (31%) Query: 89 LPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFG 148 LP+ ++C LM Y+EF D R++V + N++ + Sbjct: 263 LPVNLIGMNCDLMSQYIEFVAD----------------RLLVELGNEK---------YYN 297 Query: 149 SGQPYSWYQMISLLREANF 167 + P+ + + ISL + NF Sbjct: 298 AENPFDFMENISLAGKTNF 316 >gnl|CDD|38036 KOG2825, KOG2825, KOG2825, Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]. Length = 323 Score = 26.1 bits (57), Expect = 9.4 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 15/85 (17%) Query: 137 GMWARMEHTPFGSGQPYSWYQMISLLREANFTLSI--------TSRSLFFPPTHKKCILK 188 GM + + G + S+ +++ L++ NF + + T R L FP T +K + K Sbjct: 113 GMLQELANAFPGIDEAMSFAEVMKLVKGMNFDVVVFDTAPTGHTLRLLQFPTTLEKGLGK 172 Query: 189 LWSVFEK-------IGNIFGPGFAG 206 L S+ K +G++FG AG Sbjct: 173 LLSLKNKIGPMLSQMGSMFGMEDAG 197 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.139 0.442 Gapped Lambda K H 0.267 0.0604 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,135,322 Number of extensions: 164465 Number of successful extensions: 422 Number of sequences better than 10.0: 1 Number of HSP's gapped: 421 Number of HSP's successfully gapped: 25 Length of query: 242 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 151 Effective length of database: 4,297,318 Effective search space: 648895018 Effective search space used: 648895018 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 56 (25.6 bits)