RPSBLAST alignment of GI: 254780582 and protein with PDBid: 1nkv

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256
 Score = 40.7 bits (94), Expect = 3e-04
 Identities = 11/79 (13%), Positives = 23/79 (29%), Gaps = 4/79 (5%)

Query: 95  SVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHT----PFGSG 150
             D    V     A         + + L  GG M++  P  R + A  E         + 
Sbjct: 103 KCDVAACVGATWIAGGFAGAEELLAQSLKPGGIMLIGEPYWRQLPATEEIAQACGVSSTS 162

Query: 151 QPYSWYQMISLLREANFTL 169
              +   ++    +  + +
Sbjct: 163 DFLTLPGLVGAFDDLGYDV 181