RPSBLAST alignment of GI: 254780582 and protein with PDBid: 1p91

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269
 Score = 43.2 bits (101), Expect = 6e-05
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 88  NLPLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMW 139
            LP +D+S+D ++ ++    AE       E+ RV+  GG +I   P  R + 
Sbjct: 141 RLPFSDTSMDAIIRIYAPCKAE-------ELARVVKPGGWVITATPGPRHLM 185