RPSBLAST alignment of GI: 254780582 and protein with PDBid: 1vlm

>1vlm_A SAM-dependent methyltransferase; possible histamine N-methyltransferase, structural genomics, JCSG, protein structure initiative, PSI; 2.20A {Thermotoga maritima MSB8} SCOP: c.66.1.41 Length = 219
 Score = 43.6 bits (101), Expect = 5e-05
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 15/123 (12%)

Query: 98  CVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARM------EHTPFGSGQ 151
             LMV  + F +DP   L E +R+L  GG +IV + ++     R       +   + + +
Sbjct: 105 FALMVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNKEKSVFYKNAR 164

Query: 152 PYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILKLWSVFEKIGNIFGPGFAGIYVIE 211
            +S  +++ L+R+A F      ++LF  P+    I  +           G G     VI 
Sbjct: 165 FFSTEELMDLMRKAGFEEFKVVQTLFKHPSELSEIEPVKE---------GYGEGAFVVIR 215

Query: 212 ARK 214
             K
Sbjct: 216 GTK 218