RPSBLAST alignment of GI: 254780582 and protein with PDBid: 3dli

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240
 Score = 58.4 bits (140), Expect = 1e-09
 Identities = 31/223 (13%), Positives = 66/223 (29%), Gaps = 22/223 (9%)

Query: 11  FYSSFLGK--CTTDAISKVLSTTWDDVT-GCRLL----GLGYAIPFFSCFHGKVERTLAF 63
           +Y  F  K   + + +   L           R+L    G G  +        +       
Sbjct: 13  YYFLFEEKFRGSRELVKARLRRYIPYFKGCRRVLDIGCGRGEFLELCKEEGIESIGVDIN 72

Query: 64  MPAGQGATNWPDQYFSSTALVSEGNLPLADSSVDCVLMVHYLEF--AEDPFLMLHEIWRV 121
               +      +   S      E    L D  +D V++ H++E    E  F +L   +  
Sbjct: 73  EDMIKFCEGKFNVVKSDA---IEYLKSLPDKYLDGVMISHFVEHLDPERLFELLSLCYSK 129

Query: 122 LTSGGRMIVVVPNKRGMWARME-HTPFGSGQPYSWYQMISLLREANFTLSITSRSLFFPP 180
           +     +++  PN   +++ +  +      +P     +  +L    F             
Sbjct: 130 MKYSSYIVIESPNPTSLYSLINFYIDPTHKKPVHPETLKFILEYLGFRDVKIEFFEECEE 189

Query: 181 THKKCILKLWSVFEKIGNIFGPGFAGI---------YVIEARK 214
             K   +   +V E++  +       +         Y I A+K
Sbjct: 190 LTKLAKIDSNTVSEEVIRVINENIEKLNRILFGPQDYAIIAKK 232