RPSBLAST alignment of GI: 254780582 and protein with PDBid: 3i9f

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170
 Score = 46.7 bits (110), Expect = 4e-06
 Identities = 22/99 (22%), Positives = 41/99 (41%), Gaps = 10/99 (10%)

Query: 90  PLADSSVDCVLMVHYLEFAEDPFLMLHEIWRVLTSGGRMIVVVPNKRGMWARMEHTPFGS 149
            + D+SVD +L  +     +D   ++ E+ R+L   GR+I++   K       E+T  G 
Sbjct: 70  EIPDNSVDFILFANSFHDMDDKQHVISEVKRILKDDGRVIIIDWRK-------ENTGIGP 122

Query: 150 GQPYSWYQMISLLREANFTLSITSRSLFFPPTHKKCILK 188
                  +   +   +NF +    +     P H   +LK
Sbjct: 123 PLSIRMDEKDYMGWFSNFVV---EKRFNPTPYHFGLVLK 158