HHsearch alignment for GI: 254780583 and conserved domain: PRK04286

>PRK04286 hypothetical protein; Provisional.
Probab=97.93  E-value=0.00019  Score=49.56  Aligned_cols=153  Identities=20%  Similarity=0.268  Sum_probs=74.0

Q ss_pred             EEEEEECCCCEEEEECCCCH------------------HHHHHHHHHCCCCEEEEEECCCCHHHHCH-HHHH--------
Q ss_conf             69999889984999869998------------------99999999859964399985898433000-0011--------
Q gi|254780583|r   16 CILIHNHKYRLTAAIDAPDT------------------YIISKMLREKGWFLTHIFNTHHHIDHTRA-NLNL--------   68 (256)
Q Consensus        16 ~YlI~d~~t~~~viIDpgd~------------------~~i~~~l~~~~~~i~~Il~TH~H~DHigg-~~~l--------   68 (256)
T Consensus        17 a~~Vet--~d~~IlIDPgvaLap~RygLpPhp~E~~~l~~~r~kI~~~a~~advvvISHYHyDH~~p~~~~~Y~~~~~~~   94 (294)
T PRK04286         17 ATFVET--RDVRILIDPGVSLAPRRYGLPPHPIELERLEEVREKILELAKKADVVTISHYHYDHHTPFYESVYEATSEEE   94 (294)
T ss_pred             EEEEEE--CCEEEEECCCHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCHHHCCCCCC
T ss_conf             799983--885799777021187667989980999999999999999984299999913366677855343010244423


Q ss_pred             -HHHCC-CEEEEC-CCC------CC-------CCC--CCCEEEEEHHCCCCCCCCCCCCC-CCCCCC-CC-----CEEEE
Q ss_conf             -11000-101200-012------34-------323--32203310100111122233102-554456-75-----22686
Q gi|254780583|r   69 -KKFFN-CTIFGP-LEE------SS-------KIP--GIDHGLSDGDTFDFGSHPIKIIA-TPGHTI-GH-----ICYHF  123 (256)
Q Consensus        69 -~~~~~-~~v~~~-~~~------~~-------~i~--~~~~~l~dgd~i~ig~~~~~vi~-tPGHT~-g~-----i~~~~  123 (256)
T Consensus        95 ~~eiY~gK~~~~K~P~~~IN~SQr~Ra~~flk~~~~~~~~i~~aDg~~f~~g~~~i~fS~pvp-HG~~gsklG~Vi~~~I  173 (294)
T PRK04286         95 YKEIYGGKIVLIKDPTENINWSQRRRAYGFLKAVKGIAKKIEYADGKEFRFGGTVIEFSPPVP-HGAEGSKLGYVVMVRI  173 (294)
T ss_pred             HHHHHCCCEEEECCCHHHCCHHHHHHHHHHHHHHHHHCCEEEECCCCEEEECCEEEEECCCCC-CCCCCCCCCEEEEEEE
T ss_conf             588857858998194264388899999999997652043489758866887888899668877-8988885567999999


Q ss_pred             C--CCCCCCCCCE-------------------EEECCC-----CCCCCCCHHHHHHHHHHHHCCCCCCEEECCC
Q ss_conf             1--4654313770-------------------430461-----3446663156776654420134465020166
Q gi|254780583|r  124 M--NDHFLCVGDT-------------------LFSLGC-----GRIFEDSYAEMFESLEKIKSFSDKTHIYFGH  171 (256)
Q Consensus       124 ~--~~~~lFtGDt-------------------LF~~g~-----Gr~~~G~~~~l~~Sl~kl~~Lp~~t~i~pGH  171 (256)
T Consensus       174 ~dg~~~~~~~SDvqG~~~~e~v~~il~~~P~ivii~GPPtYL~gr~~~~~le~~i~Nl~~ii~~~~~~lIlDHH  247 (294)
T PRK04286        174 SDGDESFVFASDVQGPLNDEAVEFILEKKPTVVIIGGPPTYLLYRVSGEDLEKGIENLERIILLRPKTLILDHH  247 (294)
T ss_pred             ECCCEEEEECCCCCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHCCHHHHHHHHHHHHHHHHHCCCEEEEECH
T ss_conf             74976899805566768789999998639998996798456522046766999999999999818987998141