HHsearch alignment for GI: 254780583 and conserved domain: TIGR03307

>TIGR03307 PhnP phosphonate metabolism protein PhnP. This family of proteins found in operons encoding phosphonate C-P lyase systems as is observed in E. coli and is a member of the metallo-beta-lactamase superfamily (pfam00753). As defined by this model, all instances of this protein are associated with the C-P lyase, but not all genomes containing the C-P lyase system contain phnP.
Probab=98.82  E-value=6e-08  Score=72.23  Aligned_cols=113  Identities=23%  Similarity=0.295  Sum_probs=70.8

Q ss_pred             EEEEEECCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHCHHHHHHH--HCCCEEEECCCCC-----CCCCC
Q ss_conf             6999988998499986999899999999859964399985898433000001111--0001012000123-----43233
Q gi|254780583|r   16 CILIHNHKYRLTAAIDAPDTYIISKMLREKGWFLTHIFNTHHHIDHTRANLNLKK--FFNCTIFGPLEES-----SKIPG   88 (256)
Q Consensus        16 ~YlI~d~~t~~~viIDpgd~~~i~~~l~~~~~~i~~Il~TH~H~DHigg~~~l~~--~~~~~v~~~~~~~-----~~i~~   88 (256)
T Consensus        39 s~li~~~--~~~iLID~g~pd-lr~ql~~--~~IdaVllTH~H~DHi~GlddlR~~~~~~ipvy~~~~~~~~~~~~~~~~  113 (249)
T TIGR03307        39 SAVIEVN--GVRTLIDAGLTD-LAERFPP--GSLQAILLTHYHMDHVQGLFPLRWGMGEPIPVYGPPDPEGCDDLFKHPG  113 (249)
T ss_pred             EEEEEEC--CCEEEEECCCHH-HHHHCCC--CCCCEEEEECCCHHHHCCCHHHHHCCCCCEEEEECCCHHHHHHHHCCCC
T ss_conf             8999989--928999899779-9986051--6878899965334544662445521688657886887889999862698


Q ss_pred             ---CCEEEEEHHCCCCCCCCCCCCCCCCCCCCCCEEEECCC--CCCCCCCE
Q ss_conf             ---22033101001111222331025544567522686146--54313770
Q gi|254780583|r   89 ---IDHGLSDGDTFDFGSHPIKIIATPGHTIGHICYHFMND--HFLCVGDT  134 (256)
Q Consensus        89 ---~~~~l~dgd~i~ig~~~~~vi~tPGHT~g~i~~~~~~~--~~lFtGDt  134 (256)
T Consensus       114 ~~~~~~~~~~~~~~~i~g~~i~p~~~~-H~~~~~Gy~i~~~g~~~aY~tD~  163 (249)
T TIGR03307       114 ILDFSKPLLAFEPFHLGGLRVTPVPLV-HSKLTFGYLLETDGQRLAYLTDT  163 (249)
T ss_pred             CCCCCCCCCCCCCEEECCEEEEEEEEE-CCCCCEEEEEECCCCEEEEECCC
T ss_conf             424346547989677398189999996-07864699995189559996788